2IDKA

Crystal structure of rat glycine n-methyltransferase complexed with folate
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
291
structure length
277
Chain Sequence
DSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSKDITTSVLTVNNKAHMVTLDYTVQFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine N-methyltransferase
publication title 5-methyltetrahydrofolate is bound in intersubunit areas of rat liver folate-binding protein glycine N-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 71
structure length 277
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 2idkA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2idkA02
1BKYA 4E70A 2YX1A 3EEOA 2GPYA 2JH9A 2XVAA 3LKZA 1QAQA 3PS9A 3CKKA 3MB5A 1QYRA 4GQBA 4P7GA 1O54A 2PWPA 1FP2A 2P41A 4RVGA 4V0RA 3GWZA 3DULA 3UJ8A 2XYRA 3GIWA 1XVAA 5EIFA 5FUBA 1RJGA 2R6ZA 3HA3A 3QOXA 2H00A 2YQZA 3I53A 5K05A 1YFLA 3UZUA 1JG1A 3EVDA 3LDGA 4P7JA 3UFBA 3CJQA 1VE3A 3G2MA 5C1IA 3CCFA 4HTFA 5E1DA 1EJ0A 2UYQA 2ZWAA 4P7FA 2Y1WA 5CUQA 4YV0A 4OBWA 5FWDA 4E2YA 5BW5A 3A7DA 5DRYA 1JG2A 3P9CA 1N7JA 2BM9A 4RX1A 1N2XA 4IKPA 5KS2A 1VP9A 1RI5A 1M6EX 3E8SA 4ZTBA 2XVMA 5FA8A 3OFJA 2ORED 4X61A 5FA5A 4EK9A 5BP7A 4C07A 3HA7A 5LQJA 1RI4A 3KU1A 3MCTA 4KIFA 5E2AA 4BLVA 3EGVA 3FTCA 4G56A 1KIAA 5EOVA 1G8SA 2BH2A 2G70A 2IP2A 1BHJA 2R3SA 4YMHA 5K09A 3CVOA 5CVUA 3KR1A 1U2ZA 1XTPA 5GWXA 5HILA 5E1BA 3ID6C 2C7RA 5BXYA 4GOLD 5K0CA 2AVNA 4IV8A 2G72A 1RJDA 4FSDA 4R8RA 5G02A 1SQGA 4A6EA 4ER7A 1IXKA 1DL5A 3MERA 3PB3A 2B25A 4GUAA 5K0NA 4R6WA 3GRVA 3QOWA 5KVAA 3MHTA 2PWYA 2CKDA 3JWGA 4RVHA 2EJUA 4RYLA 3KQTA 1ORHA 1SUIA 2AOXA 3P2KA 4WXHA 3UJ9A 1L3CA 2FRXA 3M6XA 2N47A 3L8DA 4HC4A 3RIEA 2IBTA 5DX0A 4KDRA 2QM3A 1NW8A 2PT9A 3HA5A 3KQVA 5LQKA 3ER8A 1MHTA 3BGDA 2PGXA 4R05A 1KR5A 4PYQA 4YV2A 3ME5A 2G71A 2AN3A 1P1CA 3PVCA 2BZGA 3SMQA 5CCBA 1X1BA 7MHTA 4DCGA 4QQKA 3AXSA 2ZBQA 3FRIA 2JHAA 1EQAA 2VDVE 4P58A 3TKAA 3FTEA 3THRA 4PYJA 2IDKA 4PYIA 1VP3A 3DOUA 2E5WA 3T7RA 4LECA 1R18A 1M6YA 5HFJA 3TLJA 4CTKA 4R8SA 4GOMD 3FYDA 2NXJA 4LWPA 3SR4A 2ZW9A 3SSMA 3HCBA 4E2WA 1L1EA 3CBGA 2K4MA 2OZVA 1KPHA 1WY7A 4GEKA 4ER6A 4RVFA 4F85A 4XCXA 4RTKA 4FP9A 3LCVB 5GOZA 5HEKA 5ERGB 1NE2A 5ICCA 1NKVA 2NXEA 2ERCA 3LCCA 3LKDA 4FT2A 4YV1A 5F2NA 3EPPA 1F38A 3FUXA 3M4XA 2IH5A 4DZRA 3UJ7A 1Y8CA 3GGDA 4OX9Y 1D2HA 4RVDA 4EKGA 2AOTA 3A4TA 3OZSA 3LGAA 3B89A 1YB2A 4EKIA 4O29A 2AN4A 1L9KA 1VPTA 2PX8A 3M6WA 3CC8A 2ZIGA 2NYUA 4QVKA 1VL5A 1X1DA 5IKMA 1ZKDA 4AZVA 4E2XA 5GIOE 3I9FA 3M70A 3HCCA 3NWEA 3R0QA 1KXZA 5DWQA 1EIZA 2AZTA 3C0KA 3P9NA 3FPJA 3UA3A 4F84A 4WVLA 3EVBA 5EZSA 5U4XA 1NW3A 4R6XA 4CKEA 3HM2A 5LSAA 1UFKA 1YZHA 3KQMA 1R8XA 3UJAA 3T7TA 2EG5A 3B3FA 3DMHA 2ONYA 3HVJA 3HVKA 4CWAA 4RTPA 1DUSA 2GAFA 1QZZA 3DR5A 4BLUA 4CXMA 3UBTA 3R3HA 1ZHFA 4ISCA 3ELYA 3OU2A 1HMYA 3DTNA 1UIRA 9MHTA 1BOOA 3ELWA 5EMMA 5K0FA 2B78A 3HVIA 1R00A 1EJ6A 3H2BA 4AX8A 3UWPA 1O9GA 5EKUA 1JTFA 2OYRA 5T67A 5JUWA 2HWKA 2Y1XA 1KHHA 5HIKA 2YR0A 3Q87B 2UYHA 4DA4A 1NV9A 1G6Q1 2FPOA 2VS1A 4KWCA 4FSXA 5EQJB 3NJRA 4NECA 4CTJA 3UA4A 3BKXA 3G2OA 5GINE 3U81A 2P8JA 3MTIA 3A25A 3NDJA 3TM5A 2EFJA 3JWHA 2ZZMA 5HOQA 5MHTA 1PJZA 3GRUA 3BT7A 2IFTA 1WS6A 3OPNA 2FK8A 5K0EA 3EEYA 2BR5A 3LBYA 4GOOD 1WXWA 3KQWA 3OU6A 5FCDA 3GO4A 1SUSA 4XUCA 5LQRA 2ZWVA 1DCTA 1UWVA 2AOVA 1TPYA 3EGEA 1QAOA 4KVZA 5EIWA 4E33A 3VSEA 2O0LA 3C6KA 1G60A 5DTMA 3BUSA 2FYTA 2ZSUA 5EEGA 1AF7A 5H02A 5FTWA 2AOUA 3DLIA 2YTZA 2I7CA 3FUVA 4HSGA 1NW7A 4XUEA 4ER5A 3GRYA 1NW6A 2JHCA 4PIPA 5E8RA 5EKXA 1NV8A 4OQDA 2OBFA 4FS8A 4C4AA 1IY9A 2Z6QA 2HR1A 5DLYA 3FRHA 3R24A 5DTRA 3V97A 4BLWA 2XYVA 5CVDA 4PWYA 1JSZA 1EAMA 3HP7A 3KR0A 5CIYA 1Q0SA 1AQIA 4PGHA 3KQQA 1VIDA 4RTMA 3MTEA 4AZSA 1O9HA 4RTRA 2QRVB 2NXNA 3KQOA 3TM4A 3PX2A 5DM1A 1XDZA 3NWBA 3SX0A 3F4KA 5CCXA 1G55A 3G2PA 2PY6A 1NW5A 1D2GA 2HV9A 4LG1A 3AWIA 3X0DA 3DP7A 1WG8A 2B3TA 5EEHA 4RTOA 3AY0A 3HEMA 5CVEA 5EGSA 1R74A 2FHPA 1V39A 3EMDA 2GA9A 2ZCJA 3B7PA 3KR9A 4IWNA 5C9ZA 5KQSA 3G89A 2PX4A 2P3LA 3GRRA 3BWBA 2O07A 2KW5A 3TOSA 3BGIA 2V7EA 3G8BA 4YUVA 1KPIA 5EHIA 2V74B 3DMFA 5DX8A 4DF3A 4Y2HA 4FGZA 5E1OA 5E9WA 4GOND 5EPEA 3TKYA 3NTVA 4BP1A 2AS0A 2O05A 3GU3A 4PNEA 2VP3A 4PYOA 2YXLA 5B1SA 4PYNA 2C7OA 4PONA 3O4FA 4U7PB 1M0EA 1ZGJA 2VDWA 4AZTA 4Z2YA 2AOTB 4RTJA 3OE5A 3ER9A 2CMHA 3CJRA 2YUIA 1YF3A 1F3LA 3OZTA 2QYOA 3LPMA 3REOA 2PV0A 1RI1A 5GP1A 3P2IA 3ELDA 2BR4A 2DPMA 4EQZA 1I9GA 1ZG3A 5CM2Z 4M38A 1VBFA 2VDUE 3I64A 1SQFA 2CL5A 5K8VA 3KPJA 3UJBA 4BP3A 2G8NA 3S68A 2PBFA 4KW7A 3GNLA 3DXZA 4RTLA 5FQNA 3AXTA 3IV6A 3E05A 3HVHA 3EVFA 3VC2A 3G2QA 4QDKA 2PKWA 4PGGA 4X41A 1WXXA 1X1AA 3BKWA 1JG4A 4FR0A 3O31A 3SSNA 3DH0A 4QQNA 2FCAA 3SM3A 1WZNA 2AR0A 2ZULA 5K0BA 2EX4A 3I5UA 4RWZA 1P1BA 3NW9A 3QV2A 2P35A 1JTEA 3BXOA 5CVVA 4M7RA 2GLUA 2UYOA 1JG3A 2BM8A 2WA2A 2PXXA 5FHRA 4E30A 5FULA 5GM1A 5ICGA 3GCZA 3KPWA 8MHTA 4X60A 3LDUA 4HRAA 4DCMA 5FQOA 3LSTA 3FYCA 3IYLW 3GRZA 4FT4A 3NVKI 1XCLA 3V8VA 4HH4A 3FPFA 2ONZA 4QTUB 5DM4A 1SG9A 2AVDA 5CVJA 5T64A 3UJDA 4PYKA 3IHTA 3OFKA 1RJEA 2PXCA 5ICFA 1KP9A 4U7TB 3CGGA 3I58A 3RW9A 3T0IA 5EMLA 5K0JA 1I4WA 2IDJA 5HIIA 2IIPA 1JQDA 4IV0A 4C03A 5HZMA 3KKZA 2I62A 3G8AA 3R6TA 5KYGA 2IH4A 3HNRA 3IEIA 3OE4A 3G5LA 3K0BA 1YUBA 4B17A 3HCEA 2AN5A 3P9KA 4PCAA 2DULA 3EVAA 3JWIA 5C0OE 4EMSA 3MCZA 1FP1D 5LQUA 5M5BA 2UZ4A 5GM2A 1INLA 3TQSA 5LR6A 2B9EA 3HCFA 1VLMA 3LBFA 3M6VA 5F2OA 5EMJA 4UOEA 4OA8A 2F8LA 10MHA 2ZTHA 3FZGA 4KRGA 1ORIA 5DM0A 4HTFB 1SVUA 1TW3A 4PCLA 2H11A 1IM8A 2HTEA 4AUKA 5LQAA 5GIPE 2IBSA 2ZZNA 2P3OA 1N7IA 2ZLBA 3DXXA 4CKBA 3TFWA 3GDHA 3NVMB 3C3PA 3GXOA 1MJFA 4F86A 2OB2A 4Y30A 3ERCA 3PFGA 4H0NA 3K6RA 4GC9A 3KPVA 3WSTA 2GB4A 1EG2A 1D2CA 3MQ2A 5EHGA 2ZBPA 1YFJA 4MIKA 5HIMA 4A6DA 3FPGA 2WK1A 4JXJA 2I6GA 4K6MA 4E2ZA 1Z3CA 2ZZKA 1X1CA 4PIMA 2ESRA 3VYWA 4HGYA 5DPMA 1XDUA 3OU7A 5E9JA 1AQJA 2NP6A 2PT6A 3EVCA 1T43A 3KQSA 5DSXA 3SVZA 1TW2A 2JHPA 3ELUA 4RTNA 3Q7EA 2PXAA 5T6BA 2CWWA 3UJCA 4DMGA 5EZQA 3EVGA 2B2CA 3NDIA 4XUDA 3DXYA 1QANA 3TR6A 5E9QA 5DSTA 2YXDA 5EC8A 3RODA 4C06A 5BW4A 1FBNA 2AOUB 2OY0A 3E23A 2ZBRA 4FZVA 4RTSA 1P39A 2PJDA 3KQPA 2JJQA 5E1MA 4QTTB 4PYMA 3B3GA 5FADA 2ZIFA 3B3JA 4P7KA 2PSSA 2ADMA 3BWYA 3FPEA 3MGGA 1Q0TA 3T7SA 5DTQA 4DKJA 1L3BA 2G1PA 1JQEA 3G7UA 2ZIEA 4EVIA 3A7EA 3FUUA 2I9KA 5EG5A 4YUWA 2O57A 4E32A 1NBHA 3FPHA 2QRVA 1XDSA 1SKMA 5DXAA 1YZ3A 2PLWA 2Z6UA 3C6MA 1RI3A 2HNKA 3ANXA 3B5IA 4RSRA 2P7IA 3D2LA 4AZWA 2IGTA 3HCDA 4DQ0A 2QE6A 3DUWA 2OKCA 2O06A 3EGIA 3A27A 1G8AA 2PX2A 3LHDA 3PT9A 4ATNA 3PTAA 3M6UA 1KYZA 1OR8A 5K01A 3M33A 4M36A 5LQCA 3A26A 5CD1A 3KQYA 5P8WA 3KPUA 5EVJA 4ER0A 1B42A 4M37A 4OA5A 4QPNA 3THSA 1NBIA 3MAGA 1XJ5A 3GJYA 4MTLA 3G88A 1HNNA 5EMKA 1BC5A 3EVEA 2HMYB 1AV6A 4OQEA 5DM2A 3KHKA 5KQRA 2GS9A 5ICEA 2IH2A 1QAMA 4MHTA 3NMUF 4RV9A 2Z6AA 5DT2A 3E7PA 1VQ1A 3P2EA 3P71T 2NXCA 4KIGA 5DXJA 4HG2A 5DRTA 1JR4A 1RJFA 3BZBA 3P97A 3FTFA 3PLAE 2LD4A 2XYQA 5DX1A 3BWMA 3HCAA 5E8JA 3VC1A 5K0LA 1R6AA 3PFHA 4QDJA 5F2KA 4E31A 2P40A 4GF5A 2FK7A 5D1NA 4L7VA 5IH3A 4GBED 3P8ZA 3SGLA 3G5TA 4YUYA 1P91A 5FHQA 4C05A 1RI2A 4C04A 3R9XB 2OB1A 2P3QA 3BGVA 2H1RA 4GC5A 3FUWA 3EMBA 2ZVJA 3FUTA 3OZRA 4RTQA 3TRKA 2OPBA 5JR3A 4YMGA 3DMGA 3SXJA 4YUZA 1H1DA 3EVZA 2C7QA 4POOA 3FTDA 3UJ6A 2AOWA 2Q41A 1ZQ9A 2WA1A 3LDFA 2A14A 4MWZA 2YVLA 2PX5A 3OCJA 1KYWA 3KPYA 3P9IA 4PINA 1I1NA 4PYLA 4QVGA 1X19A 1ZGAA 5HIJA 4LWOA 5K03A 4BY9E 2C7PA 4V0QA 3AJDA 3HTXA 2VZ9A 3JWJA 4MQ4A 1KPGA 4OBXA 3TPZA 2EJTA 5LQNA 3PX3A 4DM3A 2IPXA 4X1OA 5E2BA 4ER3A 5K0GA 1G38A 1L3IA 5D1HA 2NNWB 2GH1A 2QY6A 2ZFUA 2YXEA 1R8YA 2JH8A 4HGZA 3SSOA 3C3YA 3TMAA 2CMGA 2XBMA 4CKCA 2UYCA 1FJXA 2OO3A 1XCJA 3O7WA 2JG3A 4X63A 4C08A 2NP7A 1PRYA 1FPQA 1JQ3A 3CJTA 3DLCA 2P1DA 1NT2A 2PVCA 2BR3A 3LECA 1JSXA 1XXLA 4QPPA 3KR2A 3LCUA 3LL7A 3ORHA 2P7HA 4KDCA 5FWAA 2OXTA 3LX6A 4YUXA 3BWCA
chains in the Genus database with same CATH superfamily
3EWAA 1WHSA 1FX0A 3CKMA 1K68A 13PKA 1DI0A 4V1CA 4PHHA 5DHAA 3UMMA 3AINA 2VTKA 4UFPA 2IF2A 1WHTA 3LQRA 4P7GA 3MB5A 1OYOA 3PQ8A 4W9NC 4D3YA 2CJXA 3PXCX 4NBLA 3VKGA 2Q9UA 1PE0A 4OJNA 4ACBA 1UPAA 1FVFA 1J5PA 2FPLA 3E4CA 5GY7A 3WR5A 5JQGA 3W77A 2PZAA 4BUCA 1NJFA 2VG8A 3L6CA 3TZKA 5EIBC 4K9LA 1Z56C 4UU1A 4TQAA 2A0WA 4MI1A 3TXXA 1P9RA 4X1YB 1E63A 2PANA 5T7BA 3KKEA 2O8CB 4H1HA 1M73E 2BM9A 4N7MA 2BFFB 1UOQA 2Z4SA 5TNXA 5AW2A 3VR4D 3T15A 3R8FA 4ESOA 3I2KA 1QFMA 3UY4A 4BLVA 1GN9A 1S7CA 1NUSA 4F71A 1JIQA 4Y1EA 1GNVA 4QWMA 3A9VA 4DLRA 4HDKA 1KJ8A 5M2QA 1RHUA 1DCMA 3RYHB 5GONF 4HAIA 3GFPA 1IUPA 1YS7A 2OUKA 1Y9ZA 3RS7A 2M6SA 3WIBA 1L4YA 3AM3A 4G5XA 4JUBA 3ZZMA 5MN4A 2EW8A 3WMXA 4RABA 1DBIA 1L4GA 2PG3A 3ZD7A 4JYZA 3RAEC 1QUEA 4M83A 4A6EA 4X90A 1IXKA 3B1YA 4BEWA 1O9BA 1KOJA 4Q7JB 1M2FA 2JFVA 4RXMA 1LC0A 3QEKA 3TIFA 1UOEA 1NULA 5HOEA 1L7MA 1RE1A 1Y82A 1SUWA 2W2XA 5EIBD 1ECGA 4LPKA 4BNXA 4HQ6A 1RKQA 4M9XA 2XB8A 3JZIA 3H19A 4X6YA 1DT5A 1T2UA 4H60A 3UGTA 5KOHA 2IOFA 1JUDA 1SGWA 3G0DA 4BZWA 5CW1A 4JROA 1VLJA 2D1SA 3L7NA 4XD7A 3E35A 3NHBA 1OFVA 1NW8A 1YL5A 4M1MA 4MLPA 5K5EA 1RW4A 1ODTC 2P0YA 3EG5A 4KITB 3IPYA 3E0XA 4FHZA 4TKMA 4IHJA 3TRDA 3AF1A 5GOTA 1IVYA 1J2EA 4KFUA 4IMPA 5A3QA 1L5ZA 1V41E 2JHAA 4PFKA 1ZM4A 1EQAA 3ZGXA 1QPGA 3MWEA 3KSZO 3U7IA 4XIYA 4FCVA 3IMFA 3PPIA 4V2UA 3RHFA 2C2ZA 2Q2OA 1KYIA 2WVGA 4WGGA 2OQ2A 4DSUA 4CTKA 5HQJA 3SJZA 4DR7B 5JRDS 2GJKA 4LWPA 1KNQA 1XFDA 1Q57A 2QI9C 2XOKD 5CB4A 5CG2A 2OZVA 3O8OA 3A10A 3TLZA 2OCBA 3U37A 1B4DA 3IP3A 3CSUA 3B9PA 4ED9A 4RL4A 4EYEA 1FZQA 1Q7TA 1TPZA 3UG7A 3ZOZA 5JSZB 2CLOB 4EEKA 2C5EA 5GVSA 3W34A 4L8WB 2LV8A 2WY2D 3TMKA 4PNPA 2DFPA 4I36A 3K8YA 2JASA 2G06A 2YWFA 1Y5LA 1YB2A 4NOKA 1QM5A 3VOSA 1RWKA 3ZV7A 2PJRA 1L6RA 1XEFA 4EUHA 3QVOA 3CC8A 3EVTA 1N1MA 1CUYA 3O4IA 3V2GA 5AVUA 4JP2A 1UJ4A 1MGOA 4WPGA 3X44A 3KJHA 2D8AA 1YJ8A 1G5HA 3E8XA 4DMFA 1G291 4CG2A 3ABSB 4NNJA 2HI0A 3O8QB 3NAMA 3JQGB 3UA3A 5JEDA 2LGJA 4HJXA 1QPBA 2ZJYA 3KQMA 2JGDB 1S3GA 2QAGA 4GR9A 1DRKA 4IGEA 4MW5A 3RUIA 4CWAA 3QEOA 1Z2OX 4FJ1A 5FOVA 1XFAA 2R84A 2ZDGA 1UOPA 3IQXA 3O26A 3ADKA 3GLIB 1TQ2A 3SOZA 1CQXA 5ADUS 1WA5A 2XMGA 5IEBA 1PZXA 4A5OA 2GBIA 4OM8A 4I81A 1CJTC 1DZIA 3ZGNA 1T9DA 2VJMB 3C5WP 3GD5A 3D43A 3HRKA 3KB8A 5EFOA 4TMFA 2WB2A 2DBZA 1YU6A 4J1QA 1PWYE 1SHTX 1CNEA 5T67A 5JUWA 1KHHA 5HIKA 3WVNA 3A9UA 1NV9A 2W4MA 4PV7A 2R8ZA 4UTZA 4BECA 4WFQA 3HEBA 1QLJA 4JBGA 4B3SB 4BNVA 3S2EA 4CEIA 3BKXA 1WCYA 3TSZA 4NG5A 4LSWA 3DDWA 2J5QA 4Y1RB 2KLHA 5LB2A 1EFRA 4D7AA 3WWOA 2VVTA 5K0EA 1Z6PA 1GGVA 2CBGA 1QORA 1VXOA 2HGSA 3OJWA 1D4ZA 4HS4A 1XRMA 1RAEA 5LUAA 3LXXA 5DHFA 1K6MA 3F2VA 3U9TA 1RPZA 3OLYA 1DUVG 1FX1A 3HP1A 3NHZA 4W1RA 1DCTA 3WIVA 4R1LA 4TMXA 4YRFA 3MS7A 5DMXA 4ALLA 2H4HA 3FHLA 1G60A 4JSRA 4IDHA 3WMRA 1JI0A 3LSYA 1DIHA 5KC9A 1T3HA 4JX8A 1A9PA 4DCSA 3LQ4A 1MXFA 1OKKD 4F1KA 2WU1A 4DUGA 2ZYSA 1V9LA 1FP7A 3E48A 3PHBE 3UMYA 3FX2A 2JS7A 2OFPA 2DPLA 4JJ7A 2W4QA 4N48A 2DY0A 1MJGM 4N01A 5JYBA 2A58A 2TMGA 4H6WA 4LNUA 3T4UA 4PAWA 1KR2A 4B7AA 1BX3A 4GI1A 3A9WA 3KR0A 4MIEA 4ZD6A 2J3DA 1IONA 2J9RA 1EZZA 3EXEB 3FWHA 3UGQA 2ZRGA 5KTTA 2G82A 3BXEA 2OCGA 4BJ3A 1UBLS 1K86A 4Q5IA 4DYDA 2OCXA 2G0TA 4URUR 3WNDA 4FMDB 4L4XA 2A9QA 3ABIA 3UBMA 3Q2OA 3R5KA 2OO5C 3RT9A 4YC7A 1PVOA 4N82A 4KRYA 4U9HS 4D9NA 3EQZA 3TX6A 4D56A 5FWXB 3EA4A 3AY0A 2E1PA 3GWGA 1JR3D 3M9XA 2FHPA 3PGLA 4IEIA 1N7GA 3FWZA 2CFOA 4PC2A 3ENQA 4ESVA 3AT1A 4EKEA 3A11A 2ZCJA 2BDEA 4ZI2A 1H1LA 1IHPA 3BWXA 3BERA 3OQOA 4IZIA 3KLMX 4N5HX 5IARA 2EYUA 1UK9A 4KI7A 2FQXA 2V7EA 3ESBA 4I9FA 1SU7A 3B48A 1EFPA 3ZHVA 3MT8A 1ZCJA 1FP4A 2O6LA 1GM5A 2EATA 4EHFA 2GK4A 1HMPA 3LYLA 2XTMA 2F8SA 5KNLA 3N7AA 2FZ5A 5CVCA 1N0HA 2WTNA 2VNHA 4JKYA 4U7PB 1M6WA 5HYVA 5E7JA 2NG1A 2FGKA 2QTTA 2JCYA 4HEA1 5J58A 4ND7A 1U94A 1WKBA 2X4LA 3IX7A 5ISMA 1WO8A 3OM9A 1XNHA 2FR8A 2QNBA 1NL3A 4NU5A 4A8JB 4FZJA 1D0SA 5KCMA 3V7NA 3JQ7A 3ESCA 3P2IA 3LY8A 3AHIA 3EDOA 1SUCA 4G0WA 5C1BA 1C7RA 3JASA 1AGRA 2WLSA 3I9LA 4X97A 1JJFA 3UJBA 1YNOA 1J24A 3SFZA 4J3JA 1QCZA 5BMVB 3IV6A 5BW8A 1OLSA 1TYEB 3EVFA 3ICWA 4MVJG 4QUJA 3VC2A 3HJRA 2Q9AA 2EBWA 3F9CA 4QPCA 4U7GA 3FDIA 2GGSA 1SVIA 1ZJYA 1I33A 3U7JA 2IZ7A 1E62A 4FFDA 4Z0TA 4R81A 3RSFA 4EW3A 1PDOA 1F8GA 2W8ZA 1OAOC 5K0BA 2VDNB 3I5UA 4I1PA 3DHYA 3QE3A 4IXWA 5DZSA 2ZUVA 1A9OA 2YFHA 1EVJA 4FOOA 3QTTA 5CVVA 3AEUB 3Q0IA 1Y5IA 2UYOA 2VAWA 2R44A 2WTBA 5GM1A 1J8DA 2O2CA 1Z2AA 1MV5A 3KBOA 1NWCA 1S2DA 1TCCA 1WVGA 4L85A 3GLVA 3VOBA 1EXVA 4FMPA 3EUAA 4FT4A 1DB3A 1X8XA 3C3CA 4KV9A 4BRZA 5IUNC 5DM4A 2WHQA 1XI2A 3SIWA 2WIJA 4DADA 1QIJA 1E2IA 1D2EA 1QGAA 2AMYA 2QB5A 1NTOA 4ZQHA 1V6SA 3FD8A 4HJRA 1U1EA 4L27A 4PYKA 3TUIC 1KP9A 4JEUA 3EJWA 3OC6A 1TDJA 3TQTA 3V7UA 3ZW9A 4D5EA 3WGYA 3ABOB 3L0SA 4PPFA 5A9TA 1TQ6A 2HO5A 1R0WA 1RXVA 1RYHA 3MJVA 3OOEA 4WKBA 2EJWA 3OE4A 2C04A 4RPHA 1KTVA 3TGLA 2B8EA 3MB8A 1P5FA 2OHXA 3EVAA 3G82C 5LQUA 1BIFA 5M5BA 4YVFA 3LQ2A 3Q8KA 5F9HA 3O4JA 4IIEA 3VC3A 5LR6A 2GJSA 1TUBA 2Q4BA 2Z5GA 3FE2A 3IAUA 1K2VN 4MKXA 4XCQA 3SLKA 3UFXA 5JLJA 3FYSA 2YJNA 2GM5A 1N34B 1WXDA 3O9VA 5AW4A 1EKXA 3JZDA 4KWIA 3C97A 1ISIA 2F4NA 4DARA 2G5GX 4L15A 1L1RA 3MJFA 1YJ5A 4WY8A 2OBNA 1N8NA 4O0LA 5FEUA 2VXYA 1I3LA 1LRKA 3COPA 4KC0A 5A7HA 4KGZA 2HF7A 3KPVA 3SQDA 2GCNA 3VHLB 5LC1A 2DAPA 4YACA 3PDHA 4AN4A 4TYYA 3HG7A 1UC9A 4YRJA 4EPRA 3LQFA 3GROA 5DLPA 2H48A 4PIMA 4US2R 1D6JA 1EINA 1W5FA 4CTMA 1F2DA 1T43A 2GA8A 1AQ6A 5JDCC 1TW2A 2AW3A 1IUKA 1QK4A 4KXLA 2AG6A 3X2EA 1JHMA 3FRJA 2I1VB 5LIPA 1YO6A 3ILYA 1BDHA 2VQDA 5CX1A 1FRVA 4TKVB 4TRJA 5JZMA 4J7CA 4TVSA 2JI9A 1TQHA 2YKGA 4B5KA 2EWMA 3BD7A 4OMFG 2GNOA 3H1TA 2XKKA 2F90A 1V5EA 4MVCA 2VXOA 4E5SA 4ZAGA 4JJGA 3IODA 5FADA 2EV9A 2YV4A 1AJEA 3WGHA 4DBVO 5JAPA 5TIIA 5DHTA 2CJYA 3E58A 2YJ3A 2WBLC 4ALKA 5DW3A 2QDXA 3EFOA 4TTPA 3SE7A 5LD2C 1MX5A 1K3UB 1E2NA 3DZIA 4UULA 4MS3B 1XEAA 3I39X 4M1KA 1EPUA 4UFOA 1E0JA 3OQMA 2QRVA 1KETA 4RHYA 1KI6A 3IDOA 4JD5A 5KVQA 4G23A 1D5WA 1Z88A 2HNKA 1B43A 2QL9A 4OGLA 5IYZB 3EEQA 4NBKA 1WSAA 4JJZA 4U8GA 1B0AA 2DSTA 2XZTA 3JQ8B 5FV7A 3EE6A 2EFYA 1ONNA 1F9EA 2Q5HA 4AZWA 4DEXA 3KOZA 1G8FA 1QDEA 4K9DA 4DQ0A 3CX4A 3ZOKA 1D2NA 3WAGA 3PIDA 2E89A 1GGFA 3CLSD 1C9MA 5BWOA 1P2BA 2W6ID 5CYPA 4BV8A 1I4OA 1VI6A 3EFBA 3KPUA 2HRQA 4QDXA 5EVJA 4Z3KA 4TZKA 1B1AA 4L5YA 1HDZA 4D80A 5KJ6A 1T2AA 2OHOA 4G0UA 1YRQA 5CXQA 3Q7RA 1RJ9B 2HMYB 3ESAA 3M5CA 4NYMR 2EVWX 4DA6A 2OILA 1PUJA 1XU7A 3TL3A 4B74A 1UL1X 4FR5A 1XZCA 2WW8A 4LIPD 1CUAA 3S55A 1Z06A 4CEJA 3P71T 2X8BA 3PFKA 3QUTA 4XTCS 3W7VA 1NNEA 1FSSA 2BGLA 4WJZA 1RJFA 4J2HA 2IQIA 2EJVA 1FF9A 2TRSB 2VZLA 3H8JA 4D9IA 1ESMA 2FZWA 5KNDA 2Z5FA 1TT5A 2EFEB 3GRCA 1C8LA 1L5YA 2BV3A 2JL1A 3EOAI 2ZAYA 2C3UA 1XALA 1DAKA 1YD7A 4UVHA 1GARA 4C4ZA 3CO5A 4AU1A 1N92A 2DFTA 4H6PA 5TLSA 1RI2A 1D9XA 2ZRJA 3LPDA 2ID4A 4G1FA 1DXHA 1D2MA 4KXMA 2GPBA 4C04A 1IXSB 1HC7A 5BQOA 3ZIUA 1PJTA 5KTYA 2CVFA 4FDMA 1TJYA 1HT1E 5JSFA 3FUWA 3KOMA 2UDPA 2GEFA 1Z5WA 2C1EA 2R8EA 5JD5A 2JFGA 4YS6A 3JW8A 3BRQA 4CKEB 1AS0A 3D5QA 1QE3A 2XGOA 1L8XA 1U4OA 2FMFA 2PBZA 2XJ4A 3EVZA 3Q3VA 4HF7A 3AU8A 2ZYRA 4FXPA 1U8XX 2OVBA 2ZB3A 3EDRA 1WW8A 3EUFA 4DJAA 5JVDF 2C2YA 1IL0A 1IY8A 3BL8A 1LW7A 3WDMA 3I2GA 4PZEA 2JFWA 1CJMA 2EQ5A 3DVAA 3GGOA 4WY5A 2E4XA 5LXTB 4UCXA 3S3TA 5T4FA 4XXHA 2X9NA 3FY4A 3KVRA 1G6KA 2YNMA 2H1HA 3D4BA 1J7KA 1ZM2A 4GIBA 5CITA 1G6HA 2RHWA 1X14A 1PNQA 3CWCA 5CJ2A 3CF4A 4EH1A 4FZ3A 1E6UA 1GZDA 1GNTA 3DZHA 4ZVOA 1B26A 2V4UA 1BYUA 2R86A 3D6MA 5H80A 1ISSA 3TMAA 3HR4A 2RHLA 5KI6A 1FNSA 2ZJAA 2H2FA 3ZJ4A 4DUGD 5KYWA 3IAM6 1T9GS 4IVQA 4WKCA 2JFOA 3ENZA 4BB9A 1PTJC 3F5QA 9LDBA 1IVSA 1TTPB 1UOOA 3P2MA 2ONJA 2QAGC 2H1SA 2BR3A 3MCWA 4B75A 4IJ6A 1KKLA 2Q3FA 2P7HA 2VCHA 2ZSFA 1SXJD 5TEVA 5I9LA 1IN6A 1PJ3A 1M2VA 3CWZA 1S96A 4H4CA 4U7FA 4M53A 1A4UA 4V39A 1HE1C 2GPYA 1SEVA 5FA5A 3KZNA 3WGOA 4D0GA 1WR8A 3FF4A 1E58A 1VXRA 2GBGA 3NM5A 4KAXA 3G8CA 2EC5A 4OHZA 3RBXA 3IH5A 3HE3A 3T5TA 3UJ8A 4QO8A 3VGPA 5A62A 3O5AA 1XVAA 4QT0A 3I6QA 2WF8A 1H0HA 1EFUA 4ZV9A 3A8TA 1JZSA 3ZBUA 1JG1A 2C5GA 3OX4A 3T3EA 1E0SA 3ZNQA 3MXTA 4FFSA 2X2EA 4EKYA 5LKAA 5T41A 5EWJB 4AULA 1RXUA 1E1QA 4L8LA 4F8EA 2V9ZA 5IU6A 1UJNA 3ZKAA 1Z4QA 4UTXA 1LK0A 3A7DA 4TROA 1N32B 3FGOA 3NU1A 2ZT7A 3OX3A 1D6MA 3LOUA 1N2XA 3HJCA 2X40A 1OPXA 1PNVA 2E18A 3JQFC 4U63A 4IYJA 2QVLA 5FA8A 4DC1A 1T25A 3NFYA 1JYFA 1OGJA 3LKBA 3WGVA 1M83A 1C3VA 1U7PA 4Q47A 3ETEA 2IJGX 4ALIA 5D6NA 2W6OA 4BKPA 3AEXA 2NUAA 4FNMA 3BSWA 2QZZA 2ZJ6A 4KQJA 3TJRA 4MMXB 4GVLA 4YP7A 4MPPA 1U28A 4XH9B 4ARVA 2M6LA 2YV5A 4K05A 4UQPA 1XTPA 5ILQA 2HT1A 4F5DA 1TQ4A 1MXHA 1JJ7A 1UWCA 4WKNA 1XROA 2A8YA 2QRPA 2FPGA 3P52A 4RD0A 5JD4A 3FSRA 4HMOA 3GPBA 4FFNA 4FSDA 5GQSA 4ER7A 1CJSA 4JZYA 1TUGA 4XQ0A 4FCTA 2DECA 4QOHA 2B25A 4OK6A 1Z5UA 5CPBA 3SAJA 3FB4A 3FLBA 5J2UA 4CPDA 1NUQA 1Q77A 3FAZA 1VB3A 3QFHA 4PG6A 3MHTA 2X42A 1FU7A 3STTA 3KTAA 5CA1A 1T8YA 2YH2A 4KYVA 5ALSA 4GI7A 2SNIE 3ONFA 1CRWG 1R5BA 4O4HF 2H06A 2OV4A 3EXIA 4PM4A 3ESRA 4FSHA 2YN4A 2FPPB 2FY8A 4BKMA 3DE4X 2QEQA 5F64A 4KDRA 4DA0A 6REQA 2D62A 3AHEA 3SQNA 3QPWA 5IDWA 5L3VA 1UKVY 3BGDA 2WPDD 1MHTA 1MVOA 1QVRA 2OOSA 4IDQA 3UGJA 2PX6A 3O3MB 1GDTA 3D3WA 3MWKA 1XZAA 3FRIA 4YR7A 4G0MA 2QUHA 3KXKA 3L0YA 1ZRSA 4PZYA 5A0TA 3KCNA 2I87A 2YHBA 2HUNA 3CURA 1G66A 2PIDA 3L8EA 4LK2A 1LU9A 1FRNA 4WBNF 1UKEA 4FHDA 3SSMA 3FDXA 1E1YA 2OUIA 5L9AA 1YSCA 2E4AA 2DFLA 4LTMA 4Z1OA 5ERGB 5JANA 2FR8C 5KPDA 2VTBB 1ZITA 2G5CA 4JHXA 1KI1A 1XZDA 5LYJA 4HFJA 4YV1A 2O0KA 3ONVA 4QJ3A 1CF9A 5G0TA 1KFCB 3KXPA 5K3AA 4XEHA 1MO5A 3EIOA 3VTZA 4JGGA 2QI9F 2Z5VA 1BA3A 1Q11A 3OOWA 5IVKA 1R7RA 3WTBA 3LGXA 2XNSA 3R44A 4NMMA 4YCDA 5KX5F 5TV2A 1RLIA 1OC4A 2OAP1 1PWHA 1DOZA 4B2YA 5LA6B 1PZEA 2AN4A 1Y6ZA 3Q3HA 3D6UA 5KVCA 4PO8A 4FXOA 3GAZA 5FNVB 4Y7DA 4HLCA 1HBJA 4BTLA 3MBIA 1XO1A 1QYDA 2A1UB 3QA3E 2IW1A 4RKRA 5B6PA 1UXHA 1I2MA 4K26A 3BQNB 4XPZA 1UMBA 3IBGA 1P2TA 3R1IA 4G0VA 4PAGA 2WD7A 3UATA 2ZJ1A 2BBOA 3KXIA 4M60A 4GPTA 5EZSA 2Y1LA 4F1WA 3DZDA 1SBZA 3KBBA 4FEYA 5DT9A 4BV2A 5AQEA 3WKEA 1XTSA 3RIHA 2XB9A 3D3JA 1UJMA 1YIAA 5JQGB 3OTGA 1BO6A 1SXIA 2BL4A 3IPLA 1E3WB 1HMYA 4II3A 2QR5A 3K3PA 4PO1A 3FTQA 5AK3A 4B3IA 5K0FA 5A6SB 3RS4A 2HA5A 2ZBUA 4L8FA 4RVUA 1OV6A 4HWTA 4KP7A 5F1PA 3RWMB 3UT6A 3NHRA 4X1YA 3INTA 1KDZA 1VE6A 4O5AA 5EHZA 1BW9A 1SRQA 2VNIA 5E0KB 5T6MA 2VH1A 2GXUA 1T8RA 5EQJB 3NJRA 1OT5A 3H7AA 4YRQA 2DOKA 1UZNA 1I9CA 3E7XA 4RKEA 3H1EA 1MVNA 3AESB 4M0LA 4P35A 3BE4A 1FRZA 3W4IA 4YBZA 1DC5A 5DE3A 2AC4A 3KZCA 1WS6A 3RFXA 2G7MC 2B6NA 3CG4A 2RMKA 2IUFA 2WVHA 3F2IA 1UINA 4RCZA 1E1MA 5FCDA 1SUSA 2DLDA 2NTNA 4QLAA 1XXHE 1V8FA 1TC2A 4JK3A 5ALPA 3RKRA 2AOVA 1HLDA 3N75A 4NP6A 3ZWYA 1YDMA 3RM3A 1CUSA 1SIWA 1L5HB 4KLNA 5DTMA 5ADWA 2XGMA 1RXCA 2PRYA 3CUEF 3RIXA 1IMOA 4F6RA 1FSFA 3QKSB 1B0PA 4O33A 4TOIA 1VA4A 5KOJA 2OQIA 2G9RA 2Y76A 4R9VA 1LCIA 3ISJA 3CT6A 2L18A 5FWYA 2ZBGA 1TUIA 1UK7A 3OF2A 3R3SA 3E5MA 1DKMA 3PRJA 2OLEA 4TMWA 4EO4A 2BGJA 2QAIA 4LGMA 3U2QA 5KOHB 1YKFA 4R31A 5DTRA 2BEUA 4XVRA 1QONA 1C9EA 5TPWB 2GEBA 3LLCA 5IULC 2YJ5A 3GQBA 3QVUA 3VA7A 4TVKA 2CNOA 4GKBA 1Y8ZA 5FPSA 1DX4A 3PGMA 3QM1A 3N2GA 3AFNA 2ZUEA 3FHJA 4X7MA 2GXAA 3F4KA 1DKNA 2FQQA 4MOWA 2BBTA 2COEA 3I28A 3SZOA 2PQ6A 5F4ZA 4DG5A 4EI7A 1Z4OA 3N0XA 4MV4A 5IJ9A 1FW6A 1JHYA 4TN5A 2O19A 5KSOA 1G4HA 1FS4A 3GUYA 1DC8A 2VNSA 3G49A 1XBTA 2XAAA 2XCTB 2PLAA 4D6PA 4RIGA 2IZZA 2P9HA 3IUEA 3GRRA 3I23A 3J81A 2CHVA 1IHYA 2O1SA 2W71A 3DCIA 4G4SO 1WUIS 3OJ0A 1YA6A 4RK7A 1UDRA 3AI7A 4J0CA 4DRXB 4KRFA 5C52B 4UVEA 4D4IA 2ZSKA 4UBMA 3HXTA 4XIJA 5E9WA 1OH7A 3AERB 3K1ZA 1PN3A 1SKQA 3N6XA 4GI2A 5C18A 3PFWO 2E21A 3THYB 2VP3A 1CDOA 1AMUA 1O5OA 1S5PA 5C4GB 1QYWA 1R4NB 3NXKA 4NULA 5IZCC 1U9CA 4A15A 5K8CA 1V7PC 2Z1DA 3AUFA 5C7OO 2YFKA 3OJFA 2GPSA 4BGDA 2B1QA 2AMFA 2GF9A 1SD1A 4IDBA 1AQNA 2FPXA 1ZVMA 1ECCA 2YUTA 1ZH8A 4V0NA 1J06A 1IXYA 1DTWA 4MB0A 2HDOA 2WWHA 3A2MA 2VF2A 4CQJA 5JE8A 2EWVA 1BXGB 1CU1A 1ADCA 3O8QA 2HSJA 4Y2GA 2AI1A 1JPUA 3EXG1 2BVNA 1CFJA 1UEJA 2QAGB 5LDGA 3PQFA 2PU5A 1WB6A 1NQ5A 4PGGA 1NVFA 2Y2UA 3K9NA 3ZWKA 2R7KA 4CKXA 3ZLTA 1F06A 4PEVA 1ZGHA 2D0IA 3H2JA 4ZO7A 1SU4A 3DE5X 3AILA 3WGKA 4EUSA 4BFLA 1Q7GA 2VJMA 2PD4A 3NW9A 4P3KA 3R76A 1BKDR 4G07A 3FCXA 3WYNA 1SCQA 4R8VA 5HJ7A 3FSGA 2GLUA 4CM4A 1K3FA 2WA2A 2WVAA 1TM4E 1BHQ1 3UC5A 2OK7A 4NBRA 3USES 2QOEA 4X60A 4IYRA 4ZO6A 3HXMA 2EF1A 5FQOA 1GUZA 1ONPA 3K6SA 2P2NA 3GELA 1IEVA 1OTXA 3SBXA 3V34A 4Y1RA 4PSAA 5K3CA 1E32A 3KSDO 3ITDA 4CCYB 3ROQA 1PJLA 3SWWA 3CGGA 1U8CB 1I2CA 3CH4B 5GAJA 3T0IA 1K4KA 4R8LA 5JAHA 1OIVA 4I66A 1MT3A 1VHJA 3RUPA 5YASA 1A3CA 2VYNA 3HY6A 4AMGA 2ZJ8A 1SIOA 5JOQA 1EB8A 4N12A 2X0DA 1U3GA 1PFGA 1TGYA 4BC0A 3I42A 3HCEA 1EUZA 5LZ4A 4EMSA 1E2FA 3V4SA 2J07A 2HGZA 4NCHA 3ZGOA 4YREA 2R2GA 1H8HA 4QXPA 3O8BA 1DXQA 3KG2A 4G9EA 2P0AA 4OA8A 1KY2A 3MJ4A 4FS3A 1LTHR 4CHGA 4FGJA 3V1UA 4RF4A 1IG3A 1AT1A 2G09A 2PGDA 4FDUA 2ZZNA 2W2MA 3I52A 4Y9RA 4LMBA 3PR2B 4RK5A 3HY3A 3TFWA 3A4NA 2PVPA 5AI5A 4OATA 1S0UA 4AC9A 4K9RA 1H8ED 4H0NA 4QOJA 2PMEA 3NG1A 1PL7A 2C9MA 2GPNA 1EHYA 4GC9A 1W34A 2Y0CA 4UZEA 3SZLA 4EI9A 3KVNA 3KYCA 4MVWA 4R40A 4IJKA 1M5RA 4RMGA 5E4YA 4EHAA 1U2PA 3DAPA 3FLEA 3K0KA 5C3MA 3CE6A 4ZT7A 2PHZA 2W0SA 4D0LB 2ZIZA 2PUHA 1Z3CA 4BBZA 3HLTA 5EZYF 1U28C 3B1ZA 5CHYA 1KH3A 1BHO1 1PK7A 4ICIA 2HWYA 2ID8A 5JZVA 3UWSA 2H29A 1OZAA 4AG6A 4WBXC 4WE3A 1DGQA 3S2IA 3C39A 2FFJA 2XE6A 3PI6A 6Q21A 4G8JA 1JFRA 4OP1A 4Q18A 1RHJA 4GE3A 4IIJA 4MR8A 5IG2A 4ZU6X 4MUFA 2GK3A 4BFCA 1QK5A 1UCFA 1WKVA 3UAOA 4LV6A 4PS0A 3B3GA 3G9QA 1G9SA 3FPEA 2OXRA 2QMYA 4MGZR 5ALNA 3KOWA 4JJEA 2SICE 3N5KA 2FMKA 4YPFA 2ZIEA 1ZISA 3A1WA 3R4VA 1YAJA 3MWJA 3SHOA 4FCWA 2C0CA 3KLBA 3TTYA 1CS4C 2X86A 1F3OA 1M6NA 3ORSA 4Q1BA 3VBEA 5K0TA 1GCGA 1WNFA 2BTOA 2Y9PB 1B23P 3C6MA 3B5IA 1RYYA 1KJWA 3L8ZA 3HCDA 3JAKA 4PPYA 5JNWA 3NH6A 2IU0A 3K6JA 3LC7O 1XZGA 3GEEA 4DJ5X 1UJBA 1I7DA 3H5AA 1EFAA 1OHHA 3IERA 1ZD5A 3SJBA 2AMLA 4HXGA 5L51A 2IL1A 3ANTA 1IHXA 4KE7A 1BQ4A 1EM6A 4M37A 1NP6A 1U7OA 2X3YA 1OGIA 3GFOA 4MCJA 1A8PA 1I6MA 4OAQA 1KMMA 1ZIYA 2CLFB 4UBKA 2V7QD 5B3JA 1Z6XA 1GHTA 1P73A 5C5IA 4WA8A 3U5TA 3UVEA 4MROA 2J3JA 3ZYZA 1BFKA 1BN7A 3BMQB 4Y2JA 3SF0A 4P08A 4P0TA 5I5GA 1C0IA 1TOAA 2NXCA 2WJWA 1X92A 4IH4A 4IO0A 4PQGA 4UVIA 4EWLA 2BSXA 3N1UA 2YICA 4EABA 4M2LA 1K88A 2ZS7A 2CLEB 4MV3A 3UH0A 3HL0A 4B3FX 3P0RA 3Q7QA 4HGNA 3FFXA 3URKA 4UCFA 4J1SA 1CDEA 1NBOA 2PS9A 3DO5A 1KORA 3PE3A 4GRAA 4YDHB 3CBQA 1ZZGA 3K70C 5CXXA 1I7SB 4JR1A 3SGLA 5JISA 3G5TA 1CR4A 3KE9A 4MS1B 4ENUA 1A8IA 3EIFA 1RU3A 2X22A 2ZJBA 3BD6A 4GDMA 4GECA 3LPNA 5T57A 1L5LA 4BGVA 5AQ1A 2PUFA 1CUVA 3TZ6A 4WUVA 1E2GA 2NN3C 2WAYA 3OI7A 2QJTA 2NSYA 3VTKA 5BQFA 3CB2A 3OZRA 2WJZB 4WLOA 5EN4A 4CG0A 2VHJA 4EG1A 3G2HA 3D64A 4LHXA 5JMWA 3DMGA 2BGNA 1G3UA 3G17A 4ZOCA 5DP2A 2IXTA 1WABA 4QOIA 2NQTA 2YWXA 3K8ZA 5FP0A 1M3SA 2UZIR 1H9BA 2WR8A 3UJ6A 1SHZA 4ZIRA 5BMOA 2R00A 3PJFA 3TTUA 4U6QA 3ZUPA 3AUSA 4UE2A 4PYLA 2X5JO 1U3WA 4QYMA 4KQ1A 1TUBB 1W581 4ENQA 3GVPA 1CUFA 4QNMA 1DRWA 3AHFA 4PLGA 1E7YA 1HDYA 2QXUA 1X9GA 3O92A 3U4CA 2ZRKA 3IUPA 4FZ5A 3R74A 2CDAA 4REOA 5KQGA 5KSYA 1WZ2A 3JZFA 4BMCA 1XHEA 4LGCA 1PCXA 3N2ZB 1S1CA 1WCWA 2BFBB 3CEAA 4HX9A 4IJWA 5ALUA 4BBPA 1BMFD 4LRUA 5DN9A 4HGZA 2HLDA 4WLNA 1NVUQ 1O97D 3I5MA 1UUFA 4LJYA 1KA9H 1THGA 2CN1A 2GK6A 2JDID 3RVBA 3UJ3X 4P3YA 3ZXSA 3VJRA 1V96A 5FPHA 1PRYA 1Y4SA 3NX4A 5FPPA 1TA0A 2X0KA 1MQAA 3F6PA 4Q9JA 4V0RA 3DFKA 4KQCA 4OIFA 1QHGA 5ADHA 521PA 4TRNA 5ALMA 1QU3A 2Y27A 4PVDA 4ZHQA 4KR3A 4M1WA 3W78A 3K92A 2IV7A 5FR2A 2XVAA 2BTQA 3RU2A 2PUCA 3L1UA 4BOYA 5BOSB 4HDKB 4H1UA 1ZL0A 3U9LA 1PFYA 3VR0A 2H65A 2BRUC 3P5BA 2XR1A 3KTDA 5B37A 1XMQB 3ZDBA 3DOFA 3W2FA 5CDUA 4DLNA 3WOVA 2HU5A 2MU1A 2PIAA 3SJUA 4EHLA 5F76A 3V6LA 3ZCVA 1OU4A 3VM6A 5FLXA 1DTEA 4OUDB 1KOGA 4LFAB 3DPSA 1S4MA 1QRSA 3WGUA 1LBQA 2QY9A 3BE5A 3EUEA 1N7JA 5TEWA 3LNTA 1C81A 1VJTA 1O03A 5EMHA 4BASA 3BIWA 1NSTA 3LUPA 4D43A 3OSUA 1X39A 1K06A 4KNYA 2VK8A 1A71A 2HBRA 3KDSE 2VPPA 2D5AA 2QORA 2RHBA 3TZLA 5KO2A 1L2TA 1WETA 3IQFA 3IE0A 2GRAA 1FRQA 1M8KA 2LE0A 3HA7A 3KU1A 3NEJA 2WHYA 1NPTO 1WY5A 1M9NA 1GFIA 3DKPA 4GMFA 4H08A 4RDXA 2Z83A 1DLJA 1X77A 3MT0A 1T2FA 4X6LA 1DADA 2WOOA 1I3MA 2YWEA 2LTAA 2R3SA 3V2HA 1OBHA 2TECE 3MELA 4MULA 1RJ9A 2IITA 3IJRA 1L7BA 1GEGA 5EE1A 3DAYA 1PGJA 3P0EA 4KMRA 1C3XA 4JUAA 3QOYA 4ARZB 4X8OA 4LNAA 1T5IA 1FSGA 5G0SA 2QMZA 3I30X 3TUJC 4P82A 1DJQA 3HVUA 5J5AA 5TPZD 1TT5B 2GPWA 4ID9A 2J9GA 3N28A 4JLMA 4R6WA 4QLBA 1VZ3A 2GZSA 2QD1A 4JAVC 4KHZA 4OPMA 3GEIA 3D6JA 1WMBA 2ON6A 3ASYA 3PF8A 1DEAA 4EPTA 1XDBA 3EIEA 4QELA 3K4PA 2PBRA 3L0OA 4LVOA 2PX3A 1QYXA 1NMSA 4X85A 5LDDC 3UJ9A 5KWVA 5DKFA 4RPGA 1F17A 1E59A 4WL0A 1EYZA 1JGTA 3ZU3A 4HK4A 3SN6A 3F6SA 5I4BA 1RQGA 2VTDA 4PLFA 1Q20A 4CT5A 2QZ9A 1A7UA 1SZDA 2Y1OA 2R96A 3L92A 5HFNA 1NGSA 4OQMA 3DFUA 4FILA 4M88A 5EYPB 2OCPA 4R1UA 1QJ4A 2PXHA 3G2IA 3N6VA 4ZRMA 1SG6A 1U5CA 1A7AA 3D3NA 2X8JB 4QU9A 5JNLA 1QE5A 2FJPA 3KSRA 4Z9FA 1CF4A 4C7OA 3AETA 4B4DA 1RIFA 4YRIA 3EBOA 1Y9JA 1QRUA 1QG6A 4ZMRA 5AVYA 2VJDA 1Y6RA 3GARA 1U0SY 4YH1A 3RUCA 2CV0A 1VBKA 2OG1A 4RZHA 1X7HA 3ASUA 2HWWA 3PDJA 4XB6B 3AYXB 1KQFA 3TLYA 3ZHZA 2JJ1A 4TKUA 3PPXA 3NGXA 2CHGA 1K8QA 1IOVA 1DIRA 1NKVA 1ADGA 3GCGA 4DYVA 1YKGA 3F46A 3FNQA 4N7JA 4QUDA 3U3OA 4AMUA 3NCTA 2VT6A 1NXOA 4DZTA 3STVA 4BQNA 3DLAA 4NJMA 2QSZA 1PKXA 3CNOA 1XWWA 2ZJ7A 4MVJD 4CV3A 1Q2XA 1UBFA 2QUBA 2VEDA 3FCYA 4V38A 4KPFC 5JADA 1VI2A 2QV0A 3EH2A 4N7RA 1FDTA 4EKNB 2OT3B 3MTJA 1R6DA 5ALDA 4CEHB 1OLUA 1ODFA 1T5SA 2FETA 3PNLA 2PA0A 4BC1A 1FMFA 4M8LA 1PX2A 4ZDKA 1PFWA 1U3TA 3OAAA 4HDRA 5AM4A 3EPRA 4HQOA 1MHPA 1G6OA 1ZMRA 5I7OA 1A72A 2AUTA 2VRWA 4RMNA 3TK1A 2PLFA 3CT4A 3GT4A 1BDMA 3LLSA 3E7FA 4LF5B 3QVGB 5E6UB 2CBXA 3TCXB 3OBBA 3NBKA 3JQAD 4GZ5A 2PZEA 2BIFA 3BIFA 2NU8B 5B1HA 4HEHA 5KUTA 2X23A 2DR3A 1HQDA 1T6ZA 2Q1UA 4ENWA 3KDAA 2W2LA 3DFIA 3PFNA 1ZJJA 3S28A 2DETA 2OYCA 2J4FA 3PPVA 1FYVA 1TMYA 2CD9A 1BA2A 2QIPA 3G9UA 3JYQA 1PW7A 4MRMB 4R1NA 2XVYA 3QFTA 4FJ0A 3KALA 3VR3D 3PQ3A 1BN6A 3D54D 4HBGA 4DABA 4CKCB 4LRYA 4MZDA 4B85A 3P2YA 1KGSA 1L7QA 4NZZA 4ENSA 2PSJA 3UA4A 5DI3A 1VYHA 5FB3A 3E0QA 3IV7A 5CAEB 8OHMA 1EP3B 1P7WA 1GD1O 1NXTA 5HM8A 5LPNA 5NLLA 1WHSB 3K6KA 4ZGBA 2JEZA 4R1OA 3W5HA 1FYFA 3S2ZA 1K6JA 2RHJA 3FMGA 4A26A 2F1IA 4HDOB 4C6SA 1PAUA 1THTA 2IP4A 4NVRA 3SX2A 3T3IA 1RRMA 3WRWA 2GHQA 3GB9A 5T3YA 5KWIA 5AK4A 5IRCD 1JEDA 3S1LA 4HLUC 4PX2A 1QKKA 2QM8A 1IM5A 2W6MA 3M6LA 2FX2A 1T3GA 2AOUA 3Q5EA 1C29B 4G9GA 1ZD9A 3FUVA 1RXEA 4YJGB 1Y7PA 1MR3F 2DE0X 1BNCA 3NQ41 1JWLA 1G8KA 4KN5A 1VGQA 1J99A 1XA4A 3V8PA 1C30B 1MJ5A 2VHZA 3EVNA 3KTAB 4OJQA 3D5TA 3EF1A 5F77A 5JWRA 4ZVRA 3SHTA 3MXOA 1Z29A 3OM1A 3F67A 3TRIA 4EMUA 3ENNA 3LLVA 1JSZA 3IEUA 4PWYA 4PXYA 1NUHA 4ZAFA 3ECAA 4PGHA 4ZEWA 5AIBA 4LFBB 1N2ZA 2ZT6A 2QZPA 2ZSEA 1D4AA 4X3CA 2NXNA 4PRKA 4RFSA 1UXKA 5AHWA 4HH1A 3TM4A 4WN3A 3L8MA 3SDBA 3ZE0B 5CYGA 3L8YA 4X66B 1K8RA 1XRJA 2ZUDA 3OG9A 5G3YA 3KYIB 2WIKA 2O2EA 3UF0A 1E9BA 3EMDA 1TA4A 1V39A 2E4VA 4RF3A 3W7AA 4DR5B 2BMWA 1AN9A 1YXMA 3SYTA 5C1PA 1ZGBA 4ZT2A 2YHIB 1PFVA 3ILSA 1JXOA 1PR2A 4C88A 1EBUA 2L19A 2V55B 1G63A 3G8BA 1O0CA 2YDXA 1ZRMA 5A3SA 4CMAA 3DC7A 3H17A 5KB3A 3TYXA 4GKJB 1CEXA 2Q6IA 2AS0A 4NAVA 2GEDA 2WKQA 4YYZA 1QTNA 4M8KA 2E0IA 1OZHA 3TZHA 4FINA 4DLPA 5KSWB 1Z7WA 1ZVVA 2VIIA 4PE5B 3LUJA 1GA1A 3W1WA 2XDYA 4FDAA 3GXBA 1E8NA 2P2DA 1D1TA 4HB3A 3RHTA 4REQA 3V8EA 3AKZA 3A1DA 1W0KD 4G37A 3V8NA 3HKBA 1AKQA 2B8NA 1H9CA 2E4YA 1AKUA 4UTVA 4HDQB 5B3JC 3PHHA 4EQZA 4IHJB 2EFCB 4AFNA 3ZU2A 3ZNNA 2A7XA 3P96A 4KX3A 1GPNA 3TX2A 5KYTA 1PVVA 1TJ4A 3IS3A 3A4YA 3RAPR 4FGKA 1K66A 2GYVA 2UUPA 3B20A 4M7WA 3DXZA 4CBVA 4F12A 3J80A 2WILA 4Q9LA 4J49A 4UM9B 1D6NA 2FMTA 3U4HA 3QELB 3VH4A 1ZR2A 1O4VA 2JBWA 4O4HA 3UMSA 4MYDA 4PLTA 4I9NA 5JMPA 2XTJA 2C0QA 4U5XA 1WQ4A 3I04A 4OXIA 3EDCA 1XPRA 5F35A 1G20B 2A7QA 1QK3A 4JBHA 4N3GA 3N8GA 1N9GA 4ZAWA 2BFCA 2CFIA 4EUNA 2XDQB 2OESA 4OCZA 4IXMA 3QLVC 1N1EA 3QRWA 4D4JA 5KNDH 1QUFA 4KKXB 4OX9B 3DB1A 2PXXA 3O3OB 4PR3A 1LDNA 1WPXA 3PSAA 2YMLA 3DKIA 4MP6A 1R6TA 1Z13A 4ZRDA 3GCZA 3UT0A 4NFHA 5ULLA 3CWQA 1ZFNA 3L0DA 4XA8A 1JSRA 3IYLW 5ALHA 2ORWA 1VJGA 4U0KA 4EUKA 2DT5A 2HA2A 1UKAA 2IDMA 5E4TA 2XSZA 2FZKA 4NSNA 4B83A 5I8ZA 2ZUFA 1KY5A 2FEKA 3CR8A 1G5PA 3DPIA 1T5TA 4QU5A 1RJEA 1O5IA 1NVTA 3E9NA 3SZRA 1FTWA 3P9QA 2NTYC 3IXQA 4HPXB 4MW2A 1UADA 2BRUA 4E3WA 1KJQA 1L5HA 4A7PA 2BFEB 2QG6A 1OLXA 3HNRA 4E94A 4I8IA 1YH3A 2CC2A 3PC2A 1EX1A 5MGBA 2X9GA 2V8OA 3T9EA 4INPA 3DMDA 4JT8A 1IK4A 2ICAA 2MSNA 3FPBA 1RIIA 1SBCA 2YJGA 4R7ZA 1K7EB 1HO3A 2WZDA 4ETWA 1OREA 3DBOB 1ORIA 2P75A 3AOGA 4WNYA 3LP8A 3SKXA 5AHOA 1A9QA 2VP5A 2UXBB 2NT3A 3A1NA 4AUKA 3A3YA 4C76A 5FLEX 3OJXA 5TQVA 5CT4A 5TPWA 1SO8A 3GFFA 3MWFA 2X6TA 5LBIA 3ZQJA 4K9QA 2Y99A 5BXQC 3IR7A 1LD3A 1OW3B 1X3SA 1Z5VA 3H5IA 3ODGA 4ME6A 4OFWA 3EPKA 3I4CA 1Z4PX 4DR2B 1SD2A 1DEKA 3BSYA 4IOMA 3GLIE 1DAFA 1GLGA 4D9KA 2Q6KA 4DANA 5SYNA 1TO1E 4I4TF 4LDZA 3AEQA 1Z12A 3IKLA 2AHRA 2I6UA 2QMEA 4QC2A 4KR0A 1WOYA 2G1JA 2CFSA 3QG5A 5LWHA 2NO6A 2QGFA 3WYFA 4QE3A 4BO5A 4E6EA 1Q1AA 2BI4A 5IDYA 1R4ZA 2D54A 2FDRA 2QLMA 3JQFA 2WT4A 3IUJA 4D6XA 4PZAA 1HOXA 5JCXA 3D0QA 5HW0A 1ZVJA 3A6KA 5AH0A 5EIHA 1J23A 4BNYA 2F62A 4FBMA 3PGVA 2WHEA 2Y0EA 3MGAA 1GYQA 1MMFB 1DC6A 5BMVF 5FI5A 4KBGA 3IP8A 3LXUX 2GCEA 3AKDA 1XDSA 2W2LD 4L9WA 4MA0A 4N39A 4URFA 4ESHA 3RC8A 3STXA 1NYLA 2I3DA 1TECE 5DOVA 1DQYA 3W1VA 2R00C 4A3SA 4ENRA 3ETJA 2WKSA 3GRAA 1U81A 4BX3A 3WLSA 4AJPA 4GZLA 3RO7A 4YUAA 1ZK0A 4IQ0A 3AG6A 3ZWNA 3F6BX 4O4JF 1P6QA 3W5DA 2R25B 3DF7A 5B7NA 1EAYA 3RH0A 4PSDA 1E89A 1U6KA 5ECGC 1NXVA 1NU6A 1PT5A 1JQAA 2G25A 2J7PD 4MH0R 1JH8A 1GNQA 2WQ6A 3ZWBA 3MMPA 3O8NA 5DM2A 3NOQA 4GSKA 5HZHA 4W4TA 4MYUA 1DCFA 2Q9CA 3HZOA 4UEQA 4AIIA 2OK8A 3A6HA 3OQIB 3D1JA 3ZWQA 1SBIA 2IU4A 4UXIA 5JROA 1Q15A 1U0LA 3EEFA 4P5EA 5I4KA 3FTFA 1QMPA 2VJPA 3U4DA 3L43A 2CV2A 4EB6B 3K94A 5J3JA 3J81k 4P93A 3QQPA 1HYBA 1KAHA 5LU8A 4J6FA 3KT3A 3ZZUA 4DNFA 3DAGA 4EO9A 3K9HA 3L01A 5HNKA 1U2TA 2OZEA 1JDTA 3O8DA 3Q3IA 3QF7A 4UVDA 5FBWB 4A8JA 3W4JA 3DCYA 2FUNB 4FMDF 3R9XB 3CUTA 1XPOA 2YOFA 1Q22A 3B52X 4ZYUA 1JBEA 5IH7A 1MB4A 5AI9A 1B2RA 1XDDA 4X20A 4D82A 5CNIA 5K6RA 1V6AA 5DGCA 2ZM5A 3H9CA 4PTYA 2FH5B 1OILA 1V3UA 3U0BA 2QRZA 2BKUA 3U13A 3H3JA 3LDFA 2DUMA 3B12A 2A14A 2RGCA 1ULBA 2AKAB 3VYTB 4AG5A 4PINA 2FSVC 3H11A 1P72A 3KSUA 1JB1A 1TYCA 5JWOA 2YFYA 2BGTA 3EWIA 4KX5A 4OP2A 4WCDA 3AQIA 2H1FA 1SXHA 4XQ9A 2WJ3A 4D92A 2EZTA 3NAQA 1DOAA 1X3LA 2NNWB 2QY6A 2FEMA 2WUFA 3O0DA 3M34A 2JGFA 4AM8A 2ZSHA 5IJ0A 3AEZA 1LC3A 2O6HA 1I0ZA 4I46A 3L93A 1KOLA 2CLKB 1ODIA 1VPEA 1CR2A 3BH7A 4JASB 3R9KA 2G08A 1G7TA 3VNUA 3PDIB 1MF7A 4PSCA 2GR9A 3TTXA 5CNKA 2PUBA 1SBNE 5CR9A 2C61A 1ITZA 3WK6A 1KH2A 1Y4ZA 3SI7A 3X1YA 4FWBA 1JSXA 2PAAA 1CYDA 4C6RA 4YUXA 1FUIA 2XQJA 4DLXA 5FAKA 4F46A 2PSHA 4Q7KA 4FONA 4MMYB 3OA2A 3PRKE 3FIUA 3IP5A 5DVZA 1BEEA 2NW6A 4LDNA 2J0QA 1GIAA 3QXXA 4I1UA 1QAQA 2BI7A 1C2TA 2WJGA 4JUCA 4M1SA 3D02A 1EVZA 1R3UA 1XQ6A 2NVUA 4W9NA 1DPFA 1V4BA 4HUQA 3OCXA 3GIWA 4NWIA 4M6WB 3IBCA 4BX2A 3FGNA 1TKAA 1H2AS 2CK3A 3BPSA 4MWTA 1H8EA 3PNYA 2P9BA 1CZHA 1RWOA 1S1MA 3A05A 3KHSA 4CIAA 1IOZA 4MLDA 1I13A 5E1DA 2OXCA 2UYQA 1OVMA 1A2BA 1J90A 3CA8A 3D2BA 4QYTA 2O2HA 4CG1A 3OTQA 3MFQA 3DMTA 4ZCSA 2WHPB 3OTWA 4C30A 4E2YA 2DUUA 1M2HA 5KTSA 4WADA 3P0IA 1J9ZA 2OMEA 2Y1GA 4P2BA 1ZBQA 3D4NA 1MENA 2DUWA 3ESQA 4H77A 2F00A 3I1FA 1US8B 1ZNZA 1ZCBA 3C43A 3DTVD 4ZTBA 4RE6A 2EGUA 3EMKA 3S29A 1WM1A 2ZDQA 2IZ0A 2HFKA 5ESRA 4E09A 5LQJA 4KIFA 4BFVA 5E2AA 3TOVA 3UO8B 1ZHHA 1FK8A 1T0UA 3RC1A 1QWOA 5DOZA 1W93A 3LAWA 2IY7A 5EOVA 1LGYA 1Q5PA 1P9NA 2B6HA 2WF7A 4JGBA 3T3DA 4W5QA 4R2HA 3M89A 1CIJA 3EIHA 2JZOA 3VZRA 3L8FA 3G5UA 4IMJB 4NDAA 4EX7A 3RU3A 2N1MA 2CXUA 3X1XA 3ID6C 3BMQA 3KWMA 2AHOA 2W00A 3L82B 2MOKA 4P83A 3OEHD 5BQPA 3T3NA 4JN6B 1SOVA 4EFMA 5H82A 1GQOA 2J09A 3JS5A 2R65A 1A5BB 2M1ZA 2WF6A 4OKSA 3GEBA 4E11A 2NM0A 3FHTA 4CV0A 1Z18A 3DE7X 3QKTA 3QOWA 2HXYA 3TG2A 1XCPA 1B3RA 4XE5A 2Q1YA 1USIA 2J4DA 1TXGA 3ETLA 1CJVC 4S1WA 1AA9A 1GGMA 1G3RA 3IB6A 4U2DA 4MS1A 1TF5A 5KHLB 1QIDA 4YAJA 2VQEB 1C0LA 4FYVA 3ZLVA 1G2PA 2Q1TA 2QSYA 4ROTA 1AQYA 1SUPA 1PFKA 1WIWA 1RNLA 2C82A 1MC4A 1T34A 1JS1X 3GEPA 4PLWA 3LBAA 4CIVA 4DSNA 4ECAA 2XWBF 5AM1A 2VQSA 2GUGA 3FFWA 4G6ZA 2V54A 4LJ5A 4Q00A 2DBVO 3SG0A 1NJ8A 5DNAA 3O8CA 4RDCA 4P58A 3TKAA 1ZU5A 2IYZA 3GLHB 4H27A 2GNPA 4JCCA 2OZLA 3TL2A 3N70A 3OLXA 3KKQA 3PYMA 4I6GA 3QLVA 3RRJA 6CHYA 4HZGA 4ER6A 1KPHA 1W73A 1KO4A 4KXQA 4OSOA 3T94A 3TVTA 3MA0A 1NHGA 1E64A 4RKYA 2K2WA 5HEKA 2JLAA 2X1HA 3NWOA 1Q16A 3KKKA 2WFMA 4PXSA 5C81A 3VKFA 1XZQA 1JF8A 2IHKA 3R7LA 1WKCA 4HR7A 3MGBA 3OF3A 5FEMA 4Q37A 1PFQA 2YNMD 5JWHA 3H5WA 3GGDA 3VV3A 2H07A 1TCUA 2FP4A 5FFMA 1QJCA 1F1BA 3B9BA 3LGAA 2OV8A 2HDNB 5D3QA 4DC9A 3OUUA 4COOA 2A9FA 3TIVA 1O3YA 5JS7A 1NFFA 1JFVA 1NXQA 4CKWA 3B6IA 4ZHQB 2WRZA 3BMOB 3KYJB 2Q5IA 4A8PA 1M5TA 1DBPA 2PR7A 3KFVA 1QFXA 2JAHA 4KAFA 3GPIA 4URZR 2QZSA 4KGVA 1JE0A 1G3IA 1MU0A 1GPWB 1XJCA 1M0TA 1T36B 5GZ6A 5BOSA 3HVRA 2PPVA 2CHFA 4PC6A 5T4HA 2H8GA 1BFUA 1KJ9A 1Q1BA 1YZHA 3PA8A 2HA0A 4K9PA 1WULS 2IXEA 3NYQA 3ND5A 1ZHFA 4OLBA 1KHTA 2XD4A 2YVAA 4MR9A 4KQKA 1LQTA 4JUIA 1DBVO 4NCAA 3H2BA 2PMFA 4OUDA 4DVJA 1JNXX 4G0QA 4U3JA 2Y1XA 1TK9A 5I7UA 4C4RA 4KU4A 2QVBA 5KJEA 2HSWA 3NTRA 3ITKA 3K0HA 4PSKA 2YJTD 3UJNA 5K8UA 4AJJA 5GINE 3B6JA 3PUZA 3WZ2A 2OO7A 3ZDCA 4TX1A 5JV5A 3ZEIA 1T9KA 4DLYA 3PEFA 2KE5A 2IFTA 1I80A 3OPNA 3OMWA 3GF4A 2AFHA 4DGSA 1BJKA 4OLHA 1IRIA 1MDBA 4HX5A 4LC9A 2VHYA 3EWSA 4RGQA 3W9BA 5L8VA 1SXPA 2REBA 4QHYA 1E2UA 2YVUA 3V00A 4DS3A 4AO7A 4GYWA 1A5SB 4RPKA 1HV8A 2XCRB 1AE1A 3OJCA 5G1OA 4P6VF 1Y4AE 2ZSUA 1AF7A 1DZ3A 5DIFA 3M9WA 1UXJA 2ZB7A 1H2FA 1N4DA 1MIHA 2I7CA 3UAWA 1N6KA 5CNMA 2QX6A 4ER5A 5DU2A 5LWQA 1YZVA 4S1PA 4RAOA 4MW1A 2JFFA 4K9NA 5E8RA 2VAMA 1HRKA 2Q45A 1N5DA 1MB2A 1Y8QA 2KS6A 2NZ8A 3WRXA 1BX0A 1E6WA 4URXR 5L7TA 1Q0PA 2B1JA 1CZKA 1VSVA 2EKDA 2E7ZA 2XYVA 2XYHA 4O1MA 5ENZA 2F8TA 2QGNA 5GV8A 3THXB 2FDCA 3IAHA 2Z9CA 1O9HA 2F48A 2JC3A 2C5FA 3K8QA 4LTNA 3OIFA 3M1LA 4MX8A 3ZDEA 3EFHA 1C7QA 3ZY4A 5BSKA 1RLOA 4O2LA 5EJ7A 3H9EO 2UZ0A 3OE7D 1R10A 3OLWA 4GL4A 2XNHA 4JR2A 2N9UA 4WACA 1MGPA 4Y9DA 2P6UA 16PKA 3ULKA 4D41A 1WSWA 4BKUA 2IEZA 3H5TA 1MTZA 2GLTA 4FYKA 1IJKA 2AX3A 3PQ7A 3DE3X 2BGIA 3IP9A 3ABZA 4OXNA 3KR9A 4JEHA 5K3OA 1VLHA 4QYIA 1U9ZA 2R6CA 3RROA 4Q4LA 2WZBA 2KW5A 2Y66A 3DVQX 5TQ2B 1FXWF 4AJHA 4HNHA 1SCJA 1ZXLA 3RG2A 1YVEI 3NYWA 1XTBA 2RKBA 2VPZA 3B3QA 3SXUA 1DQSA 4FFBB 3R23A 4R51A 3BHNA 1E7QA 1SC4A 2YIDA 4GRIA 3JATB 4N9QA 5DWVA 3SQLA 4ARAA 3CLSC 2RC5A 2XUAA 3FJYA 3K1JA 1PR5A 1TCBA 3MJTA 4E7PA 3U0VA 4PNEA 1GFSA 1ZOSA 2NAFA 3TGPA 5CT5A 4CLHA 1KY4A 4BLPA 5LFAA 1RRGA 4QOGA 3WA7A 4Q9IA 4DEYA 2XNJA 4KE9A 1PSWA 4O4JB 1N2SA 3VYRB 4KQWA 3PR3A 3BTVA 1O7JA 1G42A 5HGXA 1YF3A 4GH5A 4KQHA 4RIHA 5G1PA 1KEEA 4ZO8A 2V7PA 3KT6A 2BBWA 4AP9A 5KNDD 1ZIXA 4O4LF 4ZXFA 2BR4A 1G1MA 5LD2B 1UKYA 1L7NA 1FCJA 3D6FA 1Z07A 4MGEA 1WDLA 3VFDA 1LLQA 5H16A 2ZXEA 3C5CA 3D1LA 1KYXA 5CW2A 2W11A 5BY2A 4F6CA 2IXGA 1EG7A 2O3RA 1YBAA 2HK9A 5J59A 2P9TA 2V4MA 5E6UA 3C4JA 1W4ZA 3FCUB 1UC5B 5IWCA 3N0TA 5C5CA 2WUVA 4MTCA 1IOLA 1GITA 3LW7A 4PPNA 2Y68A 6NULA 3AI1A 3QY9A 4TQUS 4Z54A 1CP3A 2LWIA 5AVXA 4DL9A 2VTBA 1JTEA 4MRMA 4RMIA 2VT3A 2IDZA 4UBNA 3G8YA 4IHQA 5AJVB 3ZHXA 4BHTA 4KQEA 2IHNA 4C4YA 2G17A 1XKTA 1B2LA 5JZBA 1P9WA 4HRAA 4JBLA 3T5GA 5DI3B 4YIHA 4G0PA 1IPHA 5G40A 1Z62A 1AKTA 1NFRA 2WTMA 4IIDA 2EU8A 3KO8A 1L7AA 1ZGCA 1ZUNA 2RIPA 3JQBA 4D02A 2GBLC 2GERA 5KNCH 3PDUA 2OO5A 3UJDA 3C15C 3WQQA 1AZSC 4BWYA 4BVFA 3E9RA 1NA5A 5HIAA 3TB6A 1OF1A 2JJ2D 5REQA 4RS4A 2XADA 1P1HA 4BJ6A 3NRCA 5EIEA 1VHDA 3AIOA 3FH0A 2VK1A 2SCUA 3KEGA 3SJCA 2OAGA 4MEBA 2CY0A 3R6TA 1A9XA 3NV7A 3VSDA 5H8WA 2Z98A 2JHGA 2PZMA 3TS1A 3WIUA 3U5ZB 1QP7A 3B13B 3LUKA 3WP1B 5ITWA 1JU9A 1Q1ZA 1SR8A 2VTVA 1TKRA 2VOJA 1D6SA 5EMJA 3VZDA 4WXYB 2DTXA 4GPIB 3UGKA 2QBYA 2F8LA 3ZE8A 4XD2A 1T5LA 4X71A 5DM0A 1W25A 4FOPA 3RJ5A 3MRXA 1MH9A 1D1SA 1JFSA 3T6KA 3V8QA 4YHHB 5KKCA 2L2QA 4HZUA 1JVBA 4QG7A 1CHNA 1YA8A 4YECA 2C92A 3GXOA 1GADO 3UOAB 1EUQA 4P4SA 3T1NA 1V1MA 4ZT6A 2OHFA 3AESA 1F0YA 5CURA 2R7AA 1EDDA 4B47A 2H5JA 3HO6A 5CA1F 5JFGA 2PKQO 3PFCA 4Y2SA 2CT8A 4A16A 3EFEA 4OHOA 3W6ZA 1OZ0A 3LDHA 1LK7A 3I9NA 2Q0HA 3ORYA 4ZEOA 4I50F 3GVHA 2I4IA 3SR0A 1UT6A 1JVNA 2YHIA 1XZPA 4ZDJA 4MJ3A 2O3SA 4BO9A 3KZKA 1ZONA 3N87A 2O3QA 5TT1A 1QANA 1ZOLA 4ZCTA 5BV0A 4YIKA 5TMPA 4F6RB 3AF5A 4I14A 1UP4A 4OGKA 3BE6A 4BQEA 1QU2A 1E0DA 3BEOA 1W4CA 4S1OA 3FYHA 4Q15A 2JJMA 3BWYA 2ADMA 3LRPA 4D97A 2RHMA 4EVSA 4DR3B 3FCSB 4TMZA 2BCEA 4JB0A 1DBSA 2UXCB 3ZDAA 4J0GA 4INAA 3TQIA 2QTBA 3HCRA 3BCRA 2BEUB 1UK8A 3AEKA 3NH9A 1QH1A 4OUKX 4JVSB 4BFTA 3DNPA 3UK0A 3H9BA 4DIKA 4HQKA 1JHQA 3R40A 3M1AA 1OXMA 2FQ1A 1XZMA 4AF8A 1DDIA 2GBPA 3ANXA 1WUYA 2AXNA 3LL4A 3UM9A 3ZWXA 1I3CA 1RXSA 3D2LA 3HYSA 1Q1NA 2D1RA 4UNIA 4IGAA 1KQOA 2O06A 4AXBA 4FB5A 1JLRA 3UHOA 1HQCA 4Q3OA 1GVNB 4JJFA 4IDGA 2RSLA 4EHIA 3QEMA 2VXCA 4F91B 2J30A 3HABA 3TMYA 3NRJA 3EQ2A 1KEPA 3ST7A 4GW3A 1H23A 5BYAA 3IQWA 1C7ZA 2ZEJA 3MWEB 1D03A 2F1HA 3BWEA 3R7DA 2WINI 2WPDA 3TTWA 2JAQA 1T8SA 3C5EA 3AWDA 5I3CA 1PR9A 4JELA 2D3WA 3W3AH 2ZPAA 4JYAB 2B8JA 4MWSA 2H2GA 4BYMA 2V0NA 3O8OB 2ZJ5A 4OQ4A 4EARA 1T9BA 5KEIA 4UATA 2VYQA 3WB2A 2XXAA 1ESDA 1ZUIA 1RLTA 5JSUA 1E7MA 3M4YA 5JSZA 2P40A 1RPAA 3RRBA 1C80A 4CL2A 4E5NA 1PGNA 1U1CA 3L1IA 2WWGA 1FFBA 5FTLA 1VKOA 1G5RA 1JDBB 3LCJA 2H4ZA 4C05A 4CMGA 2IY8A 3DQZA 3VH3A 5AD1A 2WTXA 1QGYA 2BMAA 3R6DA 2GAJA 2E6KA 1YFKA 4XARA 5L4LA 2C4WA 3M9LA 4GMXA 1ZD1A 3QX9A 2HPHA 4BYGA 1P3JA 3LFTA 4FFLA 4ZZ3A 1TYAE 2VTEA 1HORA 3G02A 3S40A 2BFEA 1T9AA 5ER6A 2FWPA 3L1HA 2BOVA 4PG5A 1RFLA 3RRZA 3DEFA 1M2GA 2NZ2A 4ND8A 1WPQA 2PX5A 3LZCA 5HFAA 3JQ9A 3HFGA 4KDEA 5D3MB 1DAPA 4BY9E 5JRZA 4V0QA 4DGQA 1XTQA 2O8EA 3ONEA 4L9AA 2R6AA 4WCFA 3UXEA 2KX7A 2YNMC 4DCPA 3WO0A 1G8MA 3DPUA 4ETMA 2DY1A 1TRKA 4NEQA 4FOSA 3AC0A 1U63A 2JKZA 3PXGA 4AL4A 2IUYA 2J1LA 3T9CA 4RGVA 2JVIA 1I7PA 1P7YA 3U48A 3BA6A 1ZNWA 5BSRA 5A1TA 3RYCA 2HJSA 2NP7A 3TEFA 4R1TA 3VRHA 2AD1A 1GPUA 3FLAA 1PZHA 3W3AA 1I1QB 1FDIA 2W6NA 4HHEA 3VO2A 3FLMA 5HUJA 5DYTA 2ECPA 1YB6A 4D8UA 3VSCA 3LF1A 4P9NA 2QRKA 1DRVA 2X6RA 3IDQA 2C58A 4OGFA 1W96A 1P61B 3WDKA 4EHNA 1DAGA 3D3KA 3LGSA 4CMEA 4PHCA 5I3ZA 3ZVRA 3PS9A 4DBLC 2PWPA 4F93B 2I7TA 2Z9BA 2OBMA 3SD7A 4P4TA 2Q4RA 3X2SA 4NOJA 1PS9A 2OEPA 4XDHA 5C4MA 2FSGA 3WG9A 5KTRA 5H59A 4D46A 4P7JA 1VPWA 4TXMA 2CLMB 2DB3A 2WE7A 3NPAA 1CDDA 5DHSA 1YDFA 1B8NA 2G9VA 2F3SA 2HF8A 4HFRA 5CUQA 5A2QA 4XYMA 4NBWA 2PSFA 1XC7A 2QKYA 3T5DA 2NSJA 3VOTA 4BVLA 2AF4C 2Q50A 2H16A 2OR3A 2X0JA 3LF2A 1JG2A 5DP1A 1NBME 5M7EA 3D8SA 1OU0A 2JAPA 1T1JA 3R6LA 1WCV1 5HWSA 2NYVA 1RI5A 2PZJA 2WF9A 1SCIA 3KYCB 5FL3A 5BUZA 3KHUA 2ZVQX 5LOVA 1NBAA 2Q8QA 1MH1A 2B94A 1M10A 1UP7A 2WDZA 3M7IA 4NYIR 4MRAA 3SP1A 4S04A 3LT0A 1JEAA 2VJCA 4IBOA 4YRPA 621PA 1PQ4A 4IIBA 4LC1A 4B8YA 4D96A 1H2ZA 1UPCA 1DE0A 4MVJI 1G8SA 2HK7A 1CPYA 3CNBA 3NDPA 2QRUA 3SEZA 2R4UA 5IDQA 4MB6A 3UCFA 2OG2A 4GZMA 3ZZ0A 1EUCB 3ZY3A 1CR0A 3FBTA 4EL0A 3WRXC 3F9RA 2YV3A 5U1PA 3JZAA 3T3OA 2SHKA 1K97A 2V97A 1QH8B 4GXNA 1RD4A 3HJGA 5IS2A 2BUAA 2FR1A 2BYTA 3B53X 5LDHA 3BOSA 3F7TA 1DL5A 1T4MA 3MERA 1KF0A 1OWOA 2B99A 1FP4B 2YIJA 9LDTA 1YB4A 4IP0A 2DPXA 4BFSA 1G5TA 3UWDA 3BJIC 4X6UA 4EPYA 2X3UA 4GGOA 3ADOA 4G1BA 1K89A 3UIEA 1CUUA 4HWRA 5H9WA 2QM3A 5PNTA 4CLXA 5KYYA 4RZIA 1V4NA 2II6A 2MSDB 3ZDRA 3HR8A 2RAPA 2WFZA 1QQBA 4ZCLA 4D0SA 3H84A 5CCBA 2NUPA 2W83A 7MHTA 1J00A 1EE1A 4L3OA 1SUEA 4FLMA 3MD0A 1NURA 4G1VA 2Z58A 2WWXA 1ZEMA 2Z6VA 4RPLA 5BMVA 2NO4A 3AH8A 1XUOA 1ZA1A 2FEXA 1OLSB 2FNAA 4O8ZA 3T06B 4E51A 4CLRA 3FNEA 2WQ7A 2WU8A 3WLEA 3A2KA 3H6KA 5AVTA 1ZJ4A 3ZI7A 5BWBA 5K1ZA 3TLBA 1E3MA 5DFAA 1L1EA 1ZQ1A 3OBIA 1V3QE 3R7WA 1RAHA 2EGGA 2ZJZA 1KZ4A 4CT0A 2QRQA 3BXGA 4FP9A 1BDIA 3W6PA 4WN9B 4POAA 4AKIA 1NT4A 3GH1A 3W2IA 3EQ7A 2Z4RA 5K4GA 3AEUA 4CIDA 4OHMA 2E48A 4OAPA 4LOAA 5LA6F 2OBBA 4OX9Y 2QW8A 1OI3A 4WFIA 1VRCA 4HVTA 4MV6A 1X7ZB 1M1NA 1MC8A 3B89A 3ROZA 4ZI3A 2EEZA 3OIYA 1KAQA 2C95A 5HMLA 4MARA 2VJQA 4XSVA 5AM3A 4A36A 3C7CB 5A7GA 1EGQA 4Z3OA 2JLYA 2Q5JA 4E2XA 4JBNA 1EQUA 4M86A 3PD1A 1S2OA 1C7EA 4UXHA 3AL3A 3O2JA 3W05A 2AZTA 2QT0A 1XQVA 2CLSA 4B44A 5MGNA 4X3OA 1NBMA 2H0AA 1RAFA 3GW8A 1MRZA 2CXHA 1IEXA 3CF2A 1YQQA 3DD1A 4LV5B 1UFKA 2X3FA 3OEYA 1VM6A 4N49A 3QJ5A 3TQFA 3T7TA 4W5HA 3QU5A 3EDMA 4RTPA 1KYTA 1X7XB 4N6NA 3CLUD 4HH3C 3UHFA 4N5NA 2BM1A 2ZCUA 4J0IA 4Y2VA 2VP2A 5JDIA 1XMVA 2ZWOA 3IOEA 4K03A 1C8VB 2B78A 2WSBA 1JDPA 4P3OA 4CLEA 1LJUA 1HR0B 3VH2A 1GKYA 3PHCA 3QWFA 2KM1A 3M6MD 4P84A 3UMRA 2I3GA 3CM0A 1SA0B 1SCKA 3E5HA 4XDZA 2O3JA 3A32A 3RUHA 3WLNA 1EA7A 4LK3A 4TL7A 3L4EA 4DW8A 4IMRA 1JQBA 1W0JA 2WM9B 1Z4NA 2WSSD 3A9TA 4FSXA 2W42A 3Q2IA 4NH4A 2ZAOA 4JLKA 5AKIA 4BU0A 2D5LA 4KH1A 3FNRA 3AP3A 3A25A 3WK8A 4Q48A 3WB0A 5CVTA 2ZZMA 4ZAZA 5HOQA 3DZKA 4Y8VA 4N5IX 3BT7A 4LHVA 3AUKA 2ID7A 3EEYA 2NU7B 2FSUA 2P2GA 4JB3A 5LBUA 3EXHC 4Q1AA 3LQKA 3BS4A 2C2WA 2QROA 1IMJA 1NNSA 1HG0A 1UWVA 4KQ9A 2PEYA 4DQXA 1RKUA 1OOEA 1G16A 1U02A 4U2GA 2PH5A 5K20A 2EIXA 2O0LA 3C6KA 3CLVA 2CV1A 2HBZA 5BUQA 2CYAA 3DLIA 2OLKA 4TWIA 4L3VA 1YIDA 4LWQA 5LBTA 1DTSA 2C94A 2Q5FA