2IDMA

2.00 a structure of t87i/y106w phosphono-chey
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
127
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title The structures of T87I phosphono-CheY and T87I/Y106W phosphono-CheY help to explain their binding affinities to the FliM and CheZ peptides.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 40
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2idmA00
4P1ZA 1MB3A 4XAQA 1KGSA 3H6HA 2PL1A 4HNSA 5TPZD 5IEBA 3OM1A 3CG4A 5IUKC 3T6KA 4DQDA 5FBHA 3KKEA 2L19A 3LUKA 1EWVA 4JB2A 4WWHA 2W42A 2QSJA 1YIOA 3EQ2A 3KTOA 1DG9A 2H3HA 4MLCA 3DZDA 3T95A 3MMNA 3GBPA 1D1QA 4FE4A 2LPMA 4RS3A 3M6MD 3HV2A 4Z4CA 3RVOA 1JX6A 2A9PA 5JNRA 5D2CA 1ZH4A 5TQ2A 2IYNA 4ZYLA 1YS6A 3I5AA 5PNTA 3QEMB 2L18A 3H5WA 3H5VA 1L5YA 3H1EA 3I09A 4YLEA 2IPLA 2JVJA 1C0EA 2WY2D 4KNYA 1A2OA 1W9HA 3HUUA 1DP4A 2A9RA 3EAFA 4N03A 3TO5A 3N0XA 3OLYA 1TMYA 4KREA 4RKQA 2IPAB 4Q6BA 4ZMRA 1J56A 5KC8A 4ZJPA 2JRLA 4G0YA 1SXHA 1JL3A 1SXGA 3A0RB 2A9QA 5TPWB 3Q7SA 3T38A 4UHKA 1USIA 5TPZA 5KI6A 1NY5A 2V0NA 4N41A 2TMYA 3SAJA 1SD5A 1GLGA 3OO0A 4MR7B 4KQ9A 2P4UA 1USKA 1M2EA 4ETMA 4MR8B 3SQNA 3I45A 3MYYA 3T8YA 4MRMA 1ZDMA 2HSGA 3NNNA 3KCNA 1BDIA 1JFVA 1MIHA 1SXIA 1ISRA 1GUDA 4YWHA 5KWSA 4FB4A 3HVRA 1YTUA 2E4ZA 3ROFA 1RPJA 2RDMA 2FQYA 5EWMA 5TQ0A 5TQ0B 3Q9SA 4IF4A 3CHYA 4MS4A 1R8JA 4EYGA 1E6KA 1JFTA 5IUJC 2N9UA 3CRNA 3QEKA 3O75A 3EULA 1Z25A 3EGCA 3CG0A 5IBQA 3TX6A 4S05A 5HKOA 2FSPA 3MA0A 4LDAA 5JNTA 1ZVVA 5IC5A 4H3HB 3ILHA 2M1ZA 1JBEA 2JBAA 3RVKA 3URMA 1ZGGA 3MM4A 2LIVA 4QPJC 5DCLA 3M9XA 4F11A 4L4UA 1CEYA 2FEPA 3QELB 4MGEA 2PL9A 4ETNA 3F7NA 4M88A 1TLFA 2WMYA 1EFAA 1P6QA 4PE5B 5CHYA 4EY3A 1YVUA 1FQWA 1JFSA 4EYQA 3BRQA 1JH9A 1QO0A 1F51E 2MSWA 4DADA 5B3JA 3KLNA 4W5QA 4D74A 4IMIB 4Q6WA 4CBVA 1RNLA 1E6LA 3A10A 3H5LA 1U04A 3SM9A 2WJAA 4G0MA 2YHBA 5HSGA 2QZJA 4MQFA 3CLKA 1MB0A 4Y9TA 5CNMA 2JBAB 3LUGA 3OLXA 1AB5A 4WZZA 5GOTA 4LX8A 4F06A 2MYUA 3A0UA 2ZWMA 2R48A 3CNBA 5JS1A 4EVRA 1D1PA 2GKGA 2WRZA 2GX6A 2NZUG 3K4HA 1KRWA 2QV0A 4WUTA 1CHNA 2LBPA 3HEBA 3O1JC 4RKRA 3MF4A 5JNVA 4KFCA 1EHCA 2F8TA 3HJFA 1M5UA 2VUHB 3OO1A 3L49A 3G1WA 1TM2A 3KG2A 3P9YA 2PUFA 1ZAYA 4YRZA 3LUHA 4WT7A 1W25A 1QO0D 3QLTA 3HK2A 1QQAA 3GV0A 4N76A 3D8UA 1JWLA 4EYOA 3E61A 1QNLA 4RK7A 3A3KA 3GA5A 3BREA 1DBQA 3C6QA 3H1GA 3DBIA 4YO7A 2PUDA 4G0OA 4MQFB 5EWLB 4Z4IA 2JB9A 3CU5A 5JS2A 3O1HB 2MSKA 1PNRA 4LRQA 4RK1A 4MAAA 5EWJA 1PEAA 5TQJA 1ZN2A 1ISSA 4XASA 4YP9A 1BDJA 4NCAA 3E3MA 4YR7A 4W5RA 2H0AA 3Q7RA 1VRVA 1BDHA 3OLWA 1NXVA 4RK5A 1PUXA 2MYTA 1ZESA 3S99A 5BRAA 2QVGA 5E3JA 1DCFA 3Q15C 4Z9AA 4Z4HA 1YK0A 3C3MA 3DGEC 1U2PA 3EQZA 4N47A 1XWWA 4Z0NA 3DLHA 5T3YA 4MPTA 1DBPA 3OMWA 3RVMA 2R4QA 3SY8A 4RY9A 4JAVC 4O1HA 1U8TA 1UDRA 1M2FA 4LE0A 4WXEA 1QPZA 3TD9A 4Z4EA 1BAPA 1MAVA 3I42A 4Z4GA 4FE7A 4TLMB 2O20A 2OENG 3FFXA 3HZHA 3OQOA 1L5ZA 1Z12A 3IPCA 5GQSA 4D6YA 2AYZA 1ABEA 1QP0A 3O1IC 1RZRD 2I6FA 4G0QA 2MSLA 2FEKA 6ABPA 1ABFA 2IDMA 1QP4A 3CZCA 1GUBA 3HCWA 3Q41A 4MLDA 3OM0A 2PUEA 2NUBA 3QX9A 3N8IA 1NXWA 1DCMA 1VKRA 3QLUA 2FN9A 3LKBA 3DGFC 4PEVA 3SG0A 2FMIA 5JNSA 4TLLB 4S04A 3D02A 3IDOA 3QLUC 1P6UA 3QX8A 4DN6A 1JHZA 1LBHA 2CWDA 3C97A 4YGXB 5DLEA 2NT3A 3O2JA 3QLVA 3HSYA 1JYFA 3RQIA 3TMYA 3UUGA 3H5TA 3ROTA 4YV7A 4EYKA 1WETA 2ID9A 3ILYA 4MS3A 2FEWB 4MS1A 3UKJA 3UK0A 4E7OA 1Z2EA 3RVSA 1RXIA 1M5TA 5TPWA 2LP4Y 4Z4FA 3F6CA 1LBIA 4XFKA 3OLZA 1FFGA 2IPNA 2JVIA 4Z99A 2FN8A 4KMRA 1GCAA 2FKAA 4RZSA 5FWYA 5IUNC 2FMHA 3IP9A 4XLTA 4KV7A 2FQWA 4JA2A 4LE2A 1KMIY 4G0PA 4KK4A 1JDPA 3NHMA 4NCBA 4RXTA 5CNJA 4G97A 2BGGA 2FW0A 5DTEA 2PKXA 2FMFA 4TN5A 4O1IA 5IX8A 4OLAA 3DLBA 1JLKA 4RK0A 5JNWA 3JPWA 3N0WA 3LUFA 1MVOA 5JNUA 3LFTA 4RDCA 3QLVC 2HQRA 3EDCA 4RK4A 5C5CA 1URPA 1DJMA 1APBA 1JYEA 2QU7A 2GI4A 2MYNA 2PUAA 1K68A 3MIZA 3GRCA 3O74A 2Q5CA 5IULC 2XDYA 4L85A 3KLOA 2HQOA 3JPYA 1T34A 1TVMA 1EAYA 3JS5A 5IEJA 2AYXA 1JF8A 4KQCA 4F8JA 5KC9A 1ZHHA 2E4YA 4KZKA 3OQNA 2PJUA 3MQ4A 4NICA 1D2AA 3JY6A 4OLBA 1FFWA 4OTZA 3RVNA 2HQBA 4ML3A 1RXEA 3VNBA 2VK2A 5BR1A 1DRJA 4W5OA 4OATA 1B00A 4B09A 1GCGA 1NXXA 3HS3A 1Z18A 2RJOA 1VPWA 3GL9A 3BILA 5KQLA 3RVQA 4IILA 2E4WA 3IP6A 5T7BA 2R25B 3H5OA 5EWJB 3LUDA 7ABPA 4W5NA 2QW1A 3QK7A 1Z16A 4EVSA 1YMVA 2PMCA 1ZGZA 1RZRA 4N0QA 2OQRA 5KQGA 4YCSA 1P2FA 1U0SY 3LTEA 1Z13A 5DGCA 1A04A 3FFTA 3GYBA 2PAFA 1OXKB 3FFWA 3HDVA 4MQEB 2VYCA 2E4VA 2VUIB 2JCGA 1FFSA 1XHEA 3H1FA 4RSMA 3KJXA 3NBMA 2R47A 4H3KB 1LJUA 3C3KA 4MRMB 4N0PA 3LOPA 4NV3A 8ABPA 1FSPA 4MR8A 3CFYA 2MYPA 4ETIA 3B2NA 3TB6A 3CZ5A 3FMVA 3Q7TA 1NXSA 4KRFA 4ZPJA 5CNIA 3BBLA 1I3CA 2IPMA 4KK3A 3N6VA 4MS4B 4QYWA 4TMYA 1Z15A 4PZ0A 2RJNA 2GBPA 3FDFA 1DCKA 2WB4A 4RK6A 3LUCA 2A9OA 3RVLA 1KRXA 2FTKE 2QXYA 2L17A 4NQRA 1CYEA 1C4WA 2ZAYA 2B4AA 1K66A 3CTPA 5F64A 4MR7A 4MR9B 1IIBA 3M9WA 1EWTA 3EODA 2F8SA 3K9CA 2L2QA 4JOQA 1JDNA 1YK1A 4XARA 2J48A 4RXUA 5HQJA 5KQPA 1ZITA 4ZMSA 1NTRA 2LUOA 4W5TA 4KPYA 4IGAA 3JVDA 4JASB 1VLZA 2NT4A 1YS7A 2GWRA 3HXMA 1DRKA 5ED4A 2IOYA 5FBKA 3FGZA 1BVHA 3NNDA 3LMKA 2E4UA 1HEYA 5ABPA 1ZH2A 1NXOA 4G86A 2QVCA 4PYRA 4KVFA 4OBBA 4MR9A 3LKVA 1S8NA 3HDGA 4RV5A 4Z9BA 1Z17A 1NXPA 5BQ3A 1QKKA 4HYEA 2FQXA 5BRJA 1NXTA 1TJYA 5EWMB 4RU1A 4MQEA 3F6PA 3QELA 4RY0A 4PICA 6CHYA 3N53A 2QR3A 2CD7A 4EUKA 5KQMA 4RXMA 1E2BA 3SNKA 3W9SA 2PLNA 1BA2A 2ID7A 3GWGA 2HPHA 4HNRA 4F3TA 2HJ9A 3QEMA 5DKFA 4UHJA 2WWVD 2IKSA 3F73A 2FLKA 2M98A 1AB6A 5B3JC 3R0JA 5FWXB 4RWEA 1YMUA 4JP1A 3VNAA 5C5EA 3HUTA 2JVKA 3KYIB 3G85A 4Q7EA 4QYMA 2B1JA 2CHFA 2FVYA 2RGYA 3RH0A 1Z26A 2PE5A 3EJWA 5HM6A 2PUGA 3N0RA 1EWKA 3HO1A 1PNTA 3KSMA 1QQBA 2CHEA 4MS3B 4F12A 1H9CA 2JK1A 1F4VA 2DRIA 3NHZA 4P98A 1USGA 4LE1A 3RVPA 3OQMA 2WJWA 4G0XA 3LUJA 1E6MA 2KYRA 3NNSA 4RY8A 4LZLA 1PHRA 5I4CA 1LJLA 3L6UA 1U2QA 1DC7A 1DC8A 9ABPA 1D4ZA 3CKMA 4IRXA 1DBWA 2PUCA 5TE9A 4HNQA 1OXBB 3H75A 3IPAA 2FXIA 2YHAA 3RVJA 4EVQA 2E4XA 2P9HA 3IP5A 5FWYB 4YS6A 3LUAA 1XHFA 4D6XA 4OG2A 3O2QB 4E7PA 2X7XA 3IP7A 3KS9A 1QMPA 3JVIA 5FWXA 3O2SB 4XXHA 3OLVA 4WXMA 3H6GA 1Z2DA 1D5WA 4G0ZA 1SRRA 3HM9A 2FMKA 3GBVA 2PUBA 3OMXA 3BRSA 3KYJB 4MYRA 3RVRA 4QICA 4GPAA 1ZY2A 4EGSA 3N75A 2NZVG 4GNRA 3C3WA 5EWLA 5CNKA 3O21A 1Y1LA 4LDZA 1QP7A 2FLWA 1DZ3A 3CS3A 3JTEA 4IMJB 4MS1B 4H60A 1LK0A 4O5AA 1PEYA 3H5IA 3GT7A 1NATA 3KHTA 5TQ2B 1P8AA 1A0OA 4JB0A
chains in the Genus database with same CATH superfamily
1PT8A 1WTCA 3IXLA 5IAGA 3TNJA 1MOZA 5KVAA 3H6HA 4M0FA 3C6BA 2H59A 3G7SA 1O5OA 3NOVA 4HNSA 1M0EA 1QBGA 4QQKA 4M0EA 5U9CA 1R4AA 3T6KA 1RE1A 4XB6B 3W6PA 3GFRA 3O93A 4CETA 4BTEA 5DNUA 2G77B 1T6YA 1XMVA 5HZHA 4JMLA 1GLVA 5JSHA 1RC8A 2Q3MA 5LP6A 3VNRA 1KFCB 2XB4A 4ZQIA 3RROA 4TTRA 4AICA 4EKNB 1FW6A 3VJRA 4TZTA 2IODA 1GTSA 4TZKA 3OF2A 2PT5A 3R7AA 3M6MD 3WA7A 4AKGA 1T8TA 3LYHA 1ULUA 5AM4A 4BO4A 1RRMA 3OZTA 3V4ZA 1PE0A 2AX3A 2IYNA 3QV1A 4NU6A 4R8MA 5HM8A 2O7RA 1EH5A 1JJBA 2A6PA 3L7AA 4U39A 1C8LA 3H1EA 5CVJA 3GFGA 3ZOKA 5HCUA 5LQJA 1C4XA 1B2LA 1PEDA 4EJ0A 1GPH1 4CFYA 1A2OA 4OEHA 2OC9A 4Z5XA 4L9SA 4GZMA 4BNLA 3OLYA 2VCEA 1OE0A 2D2XA 4C7JA 3NWBA 5F73A 4GI1A 2GN1A 5KC8A 4JGGA 3C3DA 1VBFA 3FCXA 3W9UA 5KQSA 2FPGA 1VA4A 2I22A 3ZDBA 4FNGA 1C8VB 3SYLA 2FSHA 2P75A 3BSYA 4XFJA 3OPXA 4WZAA 1WSBA 3X1XA 1NYTA 1QYVA 2HRZA 2AOUA 5LIPA 4F9TA 2WIJA 1T1EA 2X41A 2XUJA 1EPUA 1F2VA 2NVWA 3HN7A 4FFPA 4HDNA 4HYYA 4UASA 3WB1A 5JZSA 3MMZA 3A9SA 4HGZA 5CIYA 1WW8A 1EZ1A 1I4WA 4REQA 4BGVA 1SFRA 2RGEA 5B4VA 4G8DA 1ZBDA 2CJXA 3CZAA 3PNQA 1CY7A 1MIHA 1DJNA 1XDDA 2ZANA 5DDIP 3ADKA 4S12A 5E6UA 2DX7A 1WY5A 4AYTA 2XCQA 4N01A 4G5GA 5DI9A 5G4LA 1YU9A 5KX5B 4HVLA 3L4KA 2O6LA 3EGXA 3W8FA 4WZBB 3M1IA 3EMDA 4DIKA 2JAPA 3D6AA 1T1RA 1XTIA 3RIGA 1DJQA 5L3RA 5CD1A 2C5EA 3UUFA 2NU9A 4ZN6A 2NLOA 1BH6A 1XMXA 2P69A 4IEIA 2Y1XA 3AF0A 5K2OA 4KO8A 2J0SA 3WTCA 1FFYA 1VMKA 3QFHA 3RC9A 2BFNA 3PFHA 5J23A 3ZWWA 3RANA 1CEYA 2OP0A 3WMWA 1CERA 1EQAA 3IMGA 4FMDB 4TT3A 2VYVA 2BFFA 4Q9AA 1XF9A 1IZ0A 2HXSA 4HP8A 2PDAA 2GXUA 1MP0A 4KSBA 5M5BA 3A1NA 1OBVA 3NG1A 5HKLA 4A0QA 2QF7A 4FE3A 4WACA 1JEJA 3E9QA 3MBIA 4IHJB 2GERA 4P2BA 2PRZA 3ELDA 3H5LA 2C1ZA 1RXVA 4X85A 3UJ6A 2C9OA 2XF2A 3CLKA 3RTGA 1A9OA 1A9RA 2I7VA 3IOMA 1QAMA 2P4SA 2PLAA 3TNFA 5F7XA 1QOPB 5KTKA 3R6TA 3WIVA 1SXPA 1PV4A 4DRXB 4CIAA 5FOUA 3DD1A 1UWVA 2PX4A 1G5HA 3A0UA 1BCRB 5HF8A 2B7BA 5JS1A 1GTG1 4RVFA 2JCBA 4YCLA 1OPRA 5BV7A 2GKGA 5M04A 4IJQA 1CRPA 3K4HA 2WU0A 4UUBA 4JYBA 5EE0A 2GXAA 1ODJA 3JD2A 1XPUA 3KRTA 4PG8A 1KYIA 2ZAGA 1Q7EA 4TXJA 1Y6GA 4EL5A 3SEZA 1UBFA 1ZA2A 1VYUA 2JRCA 1WBDA 2BTEA 2UXCB 3IAHA 2ZWOA 2X5OA 3SEQA 3UH0A 2VAXA 3C1OA 1J0CA 3AEKB 4I1PA 3O92A 4B2IA 2EL9A 2R3SA 1Z6AA 2YYAA 2CNWD 3W6NA 1QHFA 3CNEA 2AMYA 4DDMA 2B7CA 3HM2A 1YFJA 4J0DA 4EL0A 4EO9A 4PXYA 4RVUA 3THXB 4JXZA 4HDRA 3CJTA 3KDPA 1E2GA 4US2R 5JY1A 1ZOSA 4QGGA 1GRQA 1FNBA 1J2YA 1RZ3A 3KXLA 2PUDA 4FBGA 4G0OA 3T35A 2V1UA 4P3YA 3H18A 3NMUF 4LQDA 4YDRA 1CTQA 4XLLA 3OESA 3IR7A 2HRRA 3I53A 1PSDA 4ETWA 5EWJA 4OUDB 4WBXC 3WGOA 4LYFA 3D7MA 4IHKA 4I0WB 4YB8A 2MJLA 3F8WA 2G04A 4RCYA 5ITWA 5JMPA 4ZI3A 1E3SA 4Z3DA 2ZTVA 1HEUA 1B76A 4Y1EA 1G5IA 3DHWC 3MHPA 2FP4B 4S1PA 1QIMA 4BZPA 5F52A 5I5EA 1X15A 3E7DA 1YZFA 3PX3A 3QA3E 2REQB 4O59O 2RHMA 1FTNA 2VHEA 2X1VA 2B2NA 4ZQGA 1M2KA 4DCMA 2BCJQ 4GOLD 1BX0A 3EXG1 4Z0PA 4XEUA 5DCWA 1L5KA 1W6RA 3SY8A 1QF7A 1Y8RA 2JFWA 4JC4A 1FP7A 3QI7A 1GPDG 1DRWA 1QUEA 4GQAA 3VPCA 2Y76A 1YDMA 1YB7A 2CUTA 3GXOA 5IT4A 1PBNA 2LRHA 4P5PA 3TLXA 5IT0A 5A0TA 1L4LA 4HXGA 4Z8YA 1XEXA 4ALKA 1J1ZA 1NBAA 2HA3A 1QIDA 2QP3A 4A2WA 4N7BA 1ABFA 2BKXA 1TTHA 3EIFA 3HCWA 3OM9A 4KV9A 4KGDA 1K7FB 2HD4A 4MV6A 4R2HA 4ZV9A 5IT9A 4HYTA 3DDSA 5DYWA 1H9BA 5CDGA 1CQJB 3TLGB 3B6MA 1OD6A 5JTTA 1YI0A 2KWIA 3QX8A 3C3EA 4FQ7A 5ARDA 4LZWA 3SJAA 1HI9A 1LTHR 4K6OA 1H66A 4KAAA 3WWEA 1PNVA 2CDAA 3DF7A 1WDTA 2YYYA 3ISTA 4LSGA 2SHKA 4TXHA 2C2BA 2R1VA 2XTJA 4KXQA 3A1VA 3UATA 3E2MA 1OREA 1WG8A 1Z3CA 4DA8A 3IAS1 3CLSD 2W2LD 5TPWA 3ELBA 1XK6A 3PLRA 1LBIA 4XFKA 2PPVA 2Z8XA 4Z99A 1DU4A 4UU0A 1PWZA 3FUWA 3IQZA 2V3CC 1TW3A 3R09A 1P6XA 1RS0A 2CJPA 2HFJA 4YALA 2FMHA 4JL8A 5LU9A 2FQWA 1L8QA 1V5FA 3EMKA 3GI1A 3LCCA 1V1JA 2JJYA 3LLUA 2FP4A 4NZNA 3LO5A 2GLUA 4I50A 5LQSA 4E22A 3QEAZ 2W8ZA 1U8AA 3H13A 4ALLA 1HDCA 2C96A 3IAS6 2XCOA 3M6UA 4X97A 3FSGA 1XVAA 3WICA 2IHKA 3GJ4A 2FUCA 4B80A 4BJ1A 1KE2A 4FDVA 1FYFA 2B0CA 4D99A 1Y6RA 1XL0A 4TTIA 1WS6A 2C3UA 3JPWA 3GFBA 3N0WA 4IH9A 4DV4B 5BVGB 1VL6A 5BNFA 2L82A 1R6UA 2R6FA 3QLVC 1CJTC 4Q4HA 4KEAA 4NV1A 3WKDA 3R9KA 1V3TA 5DWDA 3THXA 4PHGA 3MMXA 3I6QA 4FFDA 2WJ3A 5ESWA 3IV9A 4AO6A 4R8LA 1IM2A 1FOEB 4A2QA 4IDEA 3KM0A 4Y9DA 3ESRA 5IULC 3WDSA 2O5EA 1H6CA 3P2KA 4D5EA 3VZQA 4PSKA 1F2UB 2RHWA 3K8ZA 3DA8A 4IV8A 1LW7A 1JHRA 3JS5A 1YCDA 3H1AA 3MUOA 3VNUA 3KEFA 4B2YA 3NAZA 1T3LA 2JASA 4B7CA 2FRXA 5IVDA 2VIIA 3OQNA 3V4RA 2IXDA 4WD3A 1PJ2A 1ULZA 2QX4A 3DMPA 5E4FA 1FC0A 4AAYA 4GR4A 3M6IA 3NHJA 1L8LA 3GGCA 3V4FA 1ZGJA 1W49A 1Q7BA 1HL3A 1I7PA 1NJ2A 4LK3A 4URZR 1NXXA 1Y3CE 2WQZA 4UVEA 4EJ6A 1UPTA 1VPWA 2NAPA 4TV9F 2R5FA 3PPVA 1D2MA 3JWEA 4MTCA 1NP3A 4S1NA 1LDNA 5KZMB 2HN9A 3MG9A 2IHTA 1KBOA 1R5BA 2DHCA 1CEEA 3QX3A 1CJUC 4NZPA 3KKZA 5IS2A 1QOZA 4C2UA 5EHNA 3ROXA 3IOEA 1A2BA 1UM9B 2MHCA 5F5LA 4DY4A 1QYCA 2PXHA 1SQ0A 2CCGA 2PKCA 5HJ5A 2QRMA 1IEQA 2O57A 2RH4A 3GYBA 2PAFA 3ZIDA 3FUXA 5FDFA 1KSJA 1DDGA 1TFRA 1ULSA 4GM4A 4H6VA 4RJIA 4U2FA 4YRTA 2GZSA 3AHEA 3UHFA 3NUQA 3ZE9A 2R47A 4R2WA 4JYZA 4RO0A 3ZCXA 5E4YA 5HNKA 1UK6A 2R6HA 4ZC8A 2RB4A 1KI2A 3GNTA 1A27A 4HZUB 1YOVA 2Z6VA 5CM9C 4V0RA 3LZDA 4OHVA 3WYGA 3HNOA 2O7NA 5AVOA 4K0KB 3AH8A 4Y6OA 1JBQA 2D54A 1LQ2A 4JJ8A 1OLXA 3UHJA 2B92A 4UCXA 2Q4EA 3EQ8A 3K16A 1N3LA 2GK4A 3MC1A 1P1RA 1UUFA 3NASA 4LYHA 3QIVA 1F4PA 2GBPA 3FDFA 1ND5A 2V7PA 2XUGA 3PEEA 4Y3UA 3SYNA 5FHRA 3I1YA 4RWZA 2QXYA 3EAGA 5AW1A 5A05A 1BJTA 4FK8A 3L18A 3GJXC 4OI2A 3G0OA 1E0AA 2WD9A 2FN7A 2O1XA 3UH1A 3EODA 1XTJA 3MLEA 3DEFA 2CFOA 4J1SA 1G9SA 2QROA 4Q7QA 3WRYA 3Q11A 1RW4A 3I6ZA 3TBHA 1PTJA 1E7YA 2WHEA 3EGEA 4K40A 1G64A 3N5KA 2C7VA 2E18A 2IW1A 3F9CA 5EPEA 3AF2A 5ED4A 4P84A 5FBKA 2ACWA 3RE1A 4EZBA 1U9CA 3LPNA 1TX4B 4I55F 4ZVOA 4FHCA 2VP6A 4UCFA 1P73A 1QAOA 1JXMA 3GT3A 1C9JA 4M8NE 2DBZA 4P4SB 4FMCB 4DLRA 1XRMA 5KUTA 3LHIA 1L2TA 2EATA 3K32A 1KGDA 3K3PA 3OSUA 3VHLB 4NENA 5CM8B 4P7JA 4G4GA 2E21A 4QOGA 3B5IA 3P32A 5EKXA 4FMCF 3VJLA 4V0NA 3MRSA 2FQXA 1G17A 1TM5E 1QG6A 1SK8A 1TJPB 3C5HA 3I9NA 4JHXA 2VP4A 3F6PA 3NUZA 5FLKA 4B45A 3GJRA 3T7AA 5EHGA 1UQRA 4N54A 2R8XA 4ZYZA 4YJGB 4Q01A 2CHQA 3TW0A 2OOSA 3IPLA 3UB3A 1P4AA 1C3VA 2EL7A 3GWGA 2HYDA 3ZS8A 3VBEA 3IQIX 5FA8A 1OF1A 1WB4A 4MWEA 2IUUA 1SHJA 2WWVD 3LQ4A 2IKSA 3UXEA 5JSZB 3WB0A 4N4AA 4G09A 4AZVA 4QU9A 3WK7A 4RIHA 3O8BA 1FMJA 1JTEA 3DEYX 1NURA 1QDUA 1HMYA 1BQEA 4IDAA 1ABBA 2C2ZA 1V41E 1ZU5A 2V7QD 5FTJA 5F35A 5FWAA 4B73A 5HOQA 4IJKA 2NXCA 1RSZA 1AA9A 2H2AA 2WW8A 4H1VA 4IMRA 3KJNA 4OM7A 4PIMA 3USCS 4B35A 1KI9A 1THMA 3AOEC 4N8SA 5AW3A 1XJ5A 3ROEA 3GCZA 1WXHA 1NNUA 2CHFA 4CM6A 3GZNA 1DQNA 4CF4A 2WSMA 2WV7A 3L0DA 4X1KB 2QHXA 5BXQC 3WRXC 1C7QA 1OBFO 3A6ZA 3LBNA 2CHEA 3NHBA 1V6AA 5EZYA 4KRGA 2G3YA 4GWKA 2I3GA 4TTJA 4D9FA 3FOAA 4LE1A 3M82A 1Z5PA 1IXZA 1OILA 2HSEA 4QJ5A 4U1RA 2QYTA 3B6KA 4MP6A 5EAIA 1ADGA 3A1WA 3DLAA 1ZVJA 4IH1A 4F60A 3VJMA 4P81A 4Y0AA 1U2QA 1KS2A 2O3QA 4HQRA 4XD7A 4B7ZA 4D9JA 1XQ9A 4AJ1A 3CKMA 5JMWA 1IOWA 4PFKA 5LA6F 2Q4OA 4RGQA 4TRMA 5GVSA 4RF5A 1G4AE 3FPFA 2P3LA 2YH2A 4YS6A 4PPNA 2EJCA 8OHMA 4GC5A 2IHZA 3WNZA 3TCXB 5H8WA 4BQQA 3WGMA 4ZICA 1HYGA 2X7XA 2KBFA 4K6KA 1CW2B 1T25A 4A8JB 4CZ2A 1AD2A 1MD9A 1Y4DE 2PZEA 3BORA 3OLVA 4CQLA 1T8PA 3DUFA 3HBAA 4JBWA 2RKOA 5LB4A 1WDWB 4LNAA 2RGNC 2ROQA 3A28A 3G79A 2ST1A 3P4UA 5EERA 4S24A 2A0YA 4R9SA 4EVIA 3V33A 5FOXA 4QXAA 3WAJA 5C18A 2W7TA 1A98A 4HWOA 2OK8A 1JV2B 3WJ2A 1IHDA 1JVSA 3ICOA 2YHIA 5FP0A 1UBUS 2BY4A 4L7QA 4UUNA 1G8HA 2M6LA 1N6PA 2HNAA 3P71T 2BLNA 2MR5A 2R5NA 4L5AA 2C97A 4OAQA 1U7ZA 4PYOA 5F33A 4MV0A 3H5IA 3TI9A 1YZYA 3F6YA 5I7WA 1WRBA 1F9AA 4J8PA 5GP1A 4EQZA 2ZETA 3HXPA 1A3CA 4F2GA 4F92B 5JZ9A 3EZLA 2BVNA 4PXAA 4TZ6A 1DIRA 2Y0CA 1XAIA 4BNKA 4W99A 2QZSA 3INTA 5F2OA 2ZIVB 2O3TA 1A4IA 3QE4A 2BMAA 3N2YA 2X1MA 1L5HA 1PCXA 2E82A 2CJWB 2DAPA 4BGUA 5ARCA 4KR3A 1COWD 1JPUA 2XHZA 1TMGE 2GFQA 3U3JA 3TQIA 4NCIA 2QVYX 4LXTA 3ADOA 3LW8A 4JJAA 2X58A 1GKLA 1BS2A 3C3XA 3FX2A 3NHKA 4K2AA 3V3TA 3EB9A 4BKQA 4YUWA 5D6NA 1A97A 2F7SA 3OTHA 2ZBVA 2V58A 1XVTA 4JP5A 1XRQA 4KXUA 1KIMA 1R8SA 5D2CA 3V8EA 3MUFA 4M53A 4WY5A 4ZA2A 3V7WA 3R2JA 1G9XA 2L18A 4FHEA 4B9AA 4ZFNA 3E1SA 2NO4A 4LJ6A 1Q0HA 3KT6A 1RI3A 1X14A 1ZCAA 3GDWA 5AHRA 8GPBA 2WD8A 4E2FA 1JQJC 2FWNA 2QN7A 4P08A 3B13B 3TOVA 2XZDA 1H23A 5ALDA 4CM3A 1X92A 2YWCA 2QRUA 4E0BA 2DLCX 1CNEA 2ZBQA 1SXHA 2FZVA 1V5EA 1I3KA 4UFPA 4ND1A 1P5FA 4L95C 1Q15A 2WJPA 5AKKA 5TPZA 4Y2JA 4AP6A 2CLEB 1SHZA 1YB1A 1RJFA 2VZEA 1QHIA 3HB4X 4P6VF 4IIFA 3BQNB 3SAJA 2WVGA 3WKAA 3ZV3A 1ZVMA 1ZH8A 4NYIQ 3R7FA 1VGRA 4M89A 4DMHA 3T94A 4BO1A 4BFLA 3L8MA 3R0ZA 1YZUA 2N3ZA 1DUVG 4C7KA 2Q4RA 4LXYA 4ZVMA 1FU8A 1I8TA 4FB4A 3HVRA 4MHTA 1M2OA 3TD2A 4JGBA 2IC5A 1ZICA 3SQLA 3DR3A 4H59A 2J3LA 2OFXA 4RADA 5FBWB 3WZ2A 3WL6A 4CHGA 4C0LA 3JR7A 4PLWA 3AIOA 2GD0A 1QQTA 4M76B 3ZCQA 3EVFA 2BEVA 4DGQA 3KKMA 2FRDC 3R6DA 2HWYA 1HZJA 4ZI7B 2BAGA 4GZLA 3BCSA 1U8YA 1Q0SA 1UDBA 2H17A 2ZYVX 4NU5A 2NYAA 5AHKA 1XU9A 1SY7A 4I5GA 2JAQA 4UJ5A 3RVBA 2FWPA 3SZGA 3J80A 1QKIA 3GZ4A 3F7NA 4E2XA 3A6HA 1XAHA 2I80A 2GBIA 3B6IA 4EY3A 1KQ3A 4YLYA 4XCXA 5FX2A 1L1EA 4CMHA 2Q2QA 4RBNA 2B2CA 4QAQA 5MDHA 5JZMA 2FY8A 1YUNA 1F51E 1HFWA 3AL3A 4FILA 4HRYA 2DP4E 2BISA 4EPYA 2AN5A 3UWPA 2C03A 5CH3A 1S6YA 3KV3O 1PZGA 2MINA 4UNNA 2JLXA 2BM0A 2YR0A 3KR9A 3ZK9A 4MQFA 2X7JA 3GXBA 4EG6A 4P93A 4WK6A 4AROA 1ZISA 1KAQA 2PGLA 3KB6A 4ECAA 4B3SB 1LBSA 4EMBA 4LZJA 1RWWA 1IUOA 1XAGA 1G8KA 1PHPA 5B1SA 3Q5DA 3ROPA 3ZC3A 4CM4A 5TF4A 4RLFA 1HPLA 2QQ5A 5J9FA 5HTOA 1HTTA 2ZWMA 3DEIA 1FTWA 1TUGA 2JHGA 1W0JA 3TSZA 4DYVA 5DMXA 1D1PA 1DAFA 3HY6A 4H0NA 2X0DA 1KRWA 3UFXB 1NVKA 1LF0A 1OIVA 4J94A 3O1JC 3GJQA 4P7FA 3AHDA 2GYVA 2WWFA 3HJTA 4BO0A 5K3OA 3GZJA 3G8BA 1EFPA 1S2LA 5D3ZA 3UGTA 4IZHA 3VR4A 1QQ7A 1K2WA 1SHTX 2FI1A 2JLWA 2Z56A 5KCMA 5CA1F 5JPIA 5EHXA 1EHYA 3ME5A 3Q3IA 3QLTA 4WVLA 3HK2A 3GV0A 1E9FA 1MDFA 2QLLA 2C4WA 4C89A 1N5OX 4JOSA 1K4YA 4DMRA 3I3SR 5K0EA 4PNEA 3KXPA 5MN6A 2WEKA 2NVOA 3RHSA 4BMYA 2QUZA 2WA1A 3KBBA 3NTUA 5EWLB 4CTOA 1NAHA 1D0VA 1BC5A 1DI0A 1F6WA 1PJQA 1R6AA 2VOEA 1FXUA 4QODA 2OV6A 3WJ1A 5SZKB 5CYFA 4JI0B 3ZDQA 4REOA 2TMGA 3AFGA 2R8YA 2WFZA 3N7AA 4GPBA 1U94A 4E5DA 5CTJA 2H0AA 4V1CB 5IG2A 4KKXB 1KZYC 3EVAA 3TZQA 3VR3A 1SWVA 3A11A 1U6KA 2F59A 2XQJA 3RS3A 4B4KA 1EZZA 4O4HB 1E5LA 1X7YB 2HWUA 1Q3TA 2QY9A 4R1UA 4DNPA 4NP6A 1JHOA 4ROTA 1N2CB 3SIWA 1CXZA 3EQZA 1FF9A 1KJ8A 1XWWA 1T3GA 2JDID 5TVGA 2GK6A 4AZSA 3SM3A 1Q16A 3MNFA 3U40A 4EGFA 5KKCA 4DB2A 7MHTA 2ONZA 3H16A 1RTKA 2VSQA 3KB8A 5TT1A 5HIKA 4FVTA 3UWOA 5EP3A 3W05A 5E6RA 1AM4D 2RGXA 2ZVJA 2OENG 3GVCA 3LA6A 3V7FA 2F4VB 1XRNA 4NDAA 1YVDA 2G6TA 1I80A 5D01A 1G5TA 1XDBA 4AJ2A 4UDNA 1SB9A 4W1RA 2EYQA 4H27A 5AKLA 5LQMA 3V9AA 3T3GA 2GEJA 1NMEA 1NXWA 1DCMA 2I7DA 3BMXA 2FN9A 2GF0A 1MO6A 1U9ZA 2FPPA 3SCZA 3RUEA 3N3AC 5A6VA 1Q6ZA 4YP7A 2B5VA 3DTVB 4WCFC 4LOKA 1IRXA 5E2IA 3W2IA 3E7PA 3I6BA 3EGOA 3FY4A 1XSEA 3R9WA 4LMPA 3IIEA 5LDDC 4HTFA 5E7IA 4OXIA 2GMWA 2ID9A 4OOEA 3TDKA 3CWCA 4DDUA 4BUZA 4KWEA 3RBVA 4Y2VA 4YMHA 4MI6A 1P7WA 3ZWQA 4UXHA 4AWXA 4NI5A 5HKKA 1U3UA 3IHTA 5CJPA 2JVIA 4INOA 5BN5B 5FI3A 3BSWA 2SNIE 1KO1A 5G0UA 1N6LA 4HH1A 4TSRA 3TS1A 2WWWA 1LX7A 4GP7A 2JATA 1WHTB 2OL4A 3MMSA 5CIQA 3RC8A 1SVNA 3WGTA 3KYCA 4LPKA 4CTJA 1RFGE 4UMFA 4O2BB 3R7LA 2EBWA 2UVQA 5LP6C 1IU9A 4D3DA 4MUHA 3CURA 1PAUA 4RHTA 2AW5A 2IP2A 3DPIA 4NNJA 2XB9A 2A1TS 1E4EA 1JEOA 2CXQA 2WT9A 2PH5A 2XYQA 1W19A 2V6JA 4O2AA 3K9BA 2J3QA 3NGMA 2JCXA 4QXOA 4CCWA 2FW6A 4ERXA 2FPWA 1D1SA 2PZLA 2TYSB 2H1CA 2VLIA 2YIDA 3AY3A 3OQVA 4U9UA 4JI5B 3BFXA 3LFTA 4ZJZA 1NRJB 1PNOA 2HQRA 1II0A 2I2DA 2O0MA 3S1AB 3K9WA 2XJ9A 1ZOPA 2IK8A 3K35A 4K9MA 1GNTA 1N9GA 2PUAA 3T7CA 3HKBB 2Q3LA 4Q4AB 4D92A 4ENQA 4KVGA 1IXRC 2I6SA 4RD1A 5CB8A 3G2OA 4M83A 3UW1A 1MVNA 3BGVA 3JW8A 4QGHA 1CC1S 3O0TA 2FZEA 1ENOA 1AN0A 4GMKA 3N86A 2JARA 3ZIUA 1EDBA 2HUNA 3KDAA 4KQCA 4LVCA 3NWEA 4NL4H 1GZUA 4X8MA 2EBHX 1YOBA 3BHMA 2NSYA 1U7OA 2ZYTX 1E62A 3T3EA 4HUJA 1Q1EA 3I28A 3WX0A 2B4TO 1J97A 3WLRA 4F1JA 4FCVA 1RXEA 1KK0A 4OIFA 4DSZA 3HXTA 2WU8A 4J6EA 3BJIC 5FUBA 1TF5A 1E32A 1XJQA 2WD7A 2AXQA 4UZEA 1ADBA 1IHUA 3KELA 4Y1RA 5DGTA 5BYAA 4P7GA 3TLEA 5J3JA 3H97A 2B1IA 4XRGA 4PLPA 5EE9A 3PJFA 5DM60 4R1PA 1TA9A 2RB5A 1NW7A 5K3DA 3EE6A 1FLVA 3IQXA 1KOLA 2Q5QA 1Z7EA 3OOHA 1P3JA 3KD2A 3ODPA 3ZU4A 4BEJA 4EBFA 3SS9X 4DA9A 5L6MB 5B58C 4D4IA 2VZ9A 1POWA 3DW3X 4MW7A 3TW4A 4PU0A 2C20A 4Y1GA 1UK7A 2RG1A 1OA0A 2W2PA 1S89A 1SEPA 1T36B 4D4KA 5I7SA 1QXSA 2OHHA 2ZYGA 4PZEA 5CRIA 2OHVA 4AXXA 5LQUA 1IPEA 2ZAMA 4GGOA 4KWIA 1YB6A 4JLVA 1LS1A 4XWKA 1E1NA 2YZ2A 3VR5H 4FDLA 1HE8B 2EBUA 4HZUA 5ALXA 4YRSA 4E5KA 3AYXB 2PVSA 3VVCA 4QPPA 1NNSA 3RAPR 1NXSA 3KL2A 3TE7A 4MX8A 3RRXA 3DE4X 4ZPJA 1VIVA 2YC4C 2B69A 1BYIA 3MXOA 4LQ4A 4ROSA 5HJ2A 5AUNB 2WTAA 4JUIA 3ITEA 4MDHA 4ZO7A 4YMGA 1NKSA 2GXSA 3MWKA 4MS4B 1K86A 4UOQA 2F17A 3FBTA 2IY9A 3WLSA 4QOSA 3HBLA 1EIZA 4LGVA 5A02A 3E8MA 1GA6A 2ZT6A 4P4NA 5FLYA 4RUKA 3VR6D 2C7QA 3V1KA 1UR5A 1YQQA 1ODKA 2CYBA 2OBFA 1RABA 2OAGA 4IQ8A 2ZSDA 4OLFA 3E9MA 4V2IA 4EDHA 2XRYA 5CCDA 3TIIA 2FF5A 3ROKA 5F64A 5DJ5A 4E32A 5CX4A 1R8YA 4D46A 5DYGA 5E7MA 4TWRA 5HTKA 1V47A 2FUNB 3OJ0A 1IE3A 1NF9A 3STVA 3WO0A 2A1UA 4LECA 4ZO9A 1XKTA 5F5XA 1Z5NA 3D5EA 4A26A 3QFSA 4P3KA 4IGIA 2HT6A 4KPYA 2H5JA 2C99A 4IKOA 4PO1A 1E79A 2I0FA 1M1NA 1QCZA 1YC2A 4BVLA 3CW9A 5K3EA 1A5BB 4ZVRA 1X70A 2IOYA 2RCYA 3FGZA 1T43A 5C1IA 2BKLA 1QK4A 3M1YA 4GP6A 4GLJA 3KAQA 2YJZA 1NXOA 1S2GA 2WZQA 5GIOE 4OU5A 1JTVA 1N2HA 3EFHA 4OUKX 5B6IA 1OOEA 4CHTA 2ONKA 4BGDA 2FPMA 1AK1A 1SCBA 2NV0A 3LY7A 2ZR8A 5K1ZA 4ARIA 4XPZA 2RKBA 2WM8A 4FWIB 3UOAB 2DWUA 2VWPA 3FKSA 4ID3A 1D09A 2VZ8A 3FKSD 1XFAA 1DARA 3IBCA 3KHSA 4QDJA 1PW5A 2HF7A 3A14A 4E31A 4O2BA 2WSSD 3WP1B 4EY8A 1KFBB 5HZKA 2P0EA 3PUYA 4HEQA 5FUWA 1ZLYA 2IIVA 3GJSA 1IULA 4I4TA 5JAHA 3F46A 2Q3JA 2HPHA 2WBLC 1JEQA 2OO5A 3IVRA 4ZI7A 1JSXA 2VQSA 1QIHA 5K0FA 5FI0B 1SBTA 3ZHXA 4QM6A 1UH5A 5KNDD 2XBLA 2CD9A 3SXUA 1L3IA 3PFWO 4EPWA 5JRZA 4O5OA 3ETLA 5EPUA 3ENNA 3KU1A 3R0JA 2R1UA 3ETGA 3FCUB 3ON5A 2VPTA 3J7TA 1B15A 3SWWA 4G9GA 2DMRA 4OMUA 1QU3A 1J5PA 2JA1A 2R8ZA 2JVKA 3IAM1 1MABB 4LK2A 2L0XA 1RYNA 3C3BA 3CH5A 2C94A 1VHJA 1CDDA 4J0IA 3PIIA 2VSXA 3QKUA 1V7ZA 2ODEA 2R7AA 4EHBA 3KU4A 1E77A 1EDDA 2WVHA 3EJWA 3FAZA 1SCDA 2YQZA 5DBHX 5EXTA 2PUGA 3C7DB 3Q10A 4COOA 1RLJA 1U3GA 1WMAA 3KZNA 4HFMA 4CIYA 4QJBA 3VU1A 4XTCS 3L7LA 3PXAA 4FGUA 2X5JO 3AUUA 3RJTA 4RETA 4C04A 3LTNC 4MTLA 3LUJA 2ZI6A 1M9NA 3L6CA 1DC6A 5L3QB 2V6GA 5CR9A 4C43A 2OHFA 2YXPX 5CFNA 1XQVA 3KKKA 3MCVA 4DLUA 1CQIA 4FPXA 4KPUA 3RASA 2ZR9A 2NPOA 4W5JA 5DCUA 3DL0A 3VZRA 9ABPA 4A16A 2JFHA 5BNTA 1DBWA 4LBYA 2QUBA 3ZY6A 1G63A 3LCVB 4NNPA 1RQPA 2DQZA 4JXJA 4GX1A 2Z5VA 3BA6A 1ZXXA 5B7NA 3RREA 1P4HA 2HBZA 4OA8A 2BFCB 4ZQEA 2OXRA 4D6XA 3KFXA 2CXHA 4OG2A 3OHMA 5BW8A 4K03A 4Q05A 2QTAA 2IEYA 4RZXA 2R2AA 2V4ZA 1JR2A 5C35A 3ZVLA 4IIHA 3SHVA 3UAVA 2JLYA 1HFEL 3JZFA 5B58T 1BX1A 1MRNA 1T4DA 1Z2PX 2JIZA 4FJ1A 5B2EA 5TLSA 1ODTC 2GTIA 2LGJA 2GPTA 2QXTA 2WP0A 3NFYA 4MYRA 3CZQA 2AUMA 4LIPD 3CEHA 1RLTA 3N75A 4HEJA 5EWLA 1P3DA 2JPDA 3BWMA 1Y1LA 2HRQA 2H16A 4MMYB 1K8RA 4O5AA 2P6UA 5G3YA 1J8MF 1NATA 3Q0EA 4QRIA 5L3ZA 1N4AA 1S9DA 1U1DA 4PCUA 2AWNA 1Z68A 4GE3A 4ZARA 4BWFB 1MB3A 1TZKA 2OAEA 3FHLA 1LC3A 2W58A 2ZPUA 3OCXA 3EPRA 4NAHA 5F1YA 3VVMA 5ICGA 3Q5EA 2H4ZA 1J99A 3FH0A 1CRLA 3RKUA 1CZUA 3ZU3A 2JANA 1W88B 3TLAA 2A92A 2YWRA 2O1WA 1KO8A 2VXOA 3A1DA 3QVKA 4LJ5A 3THSA 4MGZR 2M6RA 4MLCA 5DWQA 1FDSA 5IKXA 1G3UA 2VA9A 2ZBGA 5LSAA 3GAZA 4FE4A 1VE6A 4KPUB 1R9GA 5JE8A 1ILEA 4AULA 4Q03A 3TTVA 4OQPA 4WBNA 5AJYA 1V16B 1SOUA 4S1VA 3U31A 4ABYA 1D2GA 3I12A 3PGXA 3O8QB 1RJDA 4KBFA 2WYOA 4P5EA 1I30A 1NX9A 1PG2A 1TVCA 3GH3A 3KQHA 3OQHA 2C54A 2CEAA 1C0EA 5BN4B 1PL6A 3AY6A 5CYOA 1PZXA 1CZOA 5EKTA 3VSDA 2IOHA 2ORVA 3BIWA 1DPGA 4EAQA 3MBOA 4C29A 4CKYA 3EXG2 4CXMA 1JLMA 1HDYA 1QOQB 1VJGA 4WFIA 5ESDA 1QG0A 3IBYA 2HX1A 3Q7SA 4HH0A 3T38A 3QLEA 2CVHA 4UHKA 5AJTA 3CZ4A 2HJHA 2AN9A 3PUVA 3Q98A 1O5TA 3R3UA 4KR7A 1ZM9A 1L7QA 4M46A 1L1QA 1UZNA 2NO6A 4FLEA 4PZ9A 5AOVA 5T4EA 3STHA 4AYWA 1IAVA 3I92A 4C7XA 1GO2A 5BSEA 5H4GA 2XXAB 3E05A 3SBDA 3HO8A 3AHGA 1USKA 2AV6A 2RHRA 1S5PA 1M2EA 2Q9UA 3B60A 3SS7X 4MUGA 1N8KA 1MX5A 1EAMA 3T8YA 4DC1A 1B43A 4WKNA 4WKOA 1RKUA 4BL5A 3OPYA 4WOCA 3BZWA 4LV8B 1Y8CA 4D3ZA 5EKDA 2P7HA 4Y2XA 4CM1A 1RMQA 5JD3A 4EARA 5L4LA 4IF4A 4MS4A 3Q7PA 3CLSC 1YE8A 2O2GA 3HQ4O 5CMLA 3VPBA 2N9UA 3DWFA 3IALA 5G1PA 1FBTA 1J5EB 3F4KA 2VNKA 3PVCA 3EGCA 1C9KA 4PNZA 1O9BA 4CT5A 1IQUA 1TL7C 2QRJA 5AW6A 2HU2A 2SKEA 4HFJA 4JQCA 3UAGA 5JSQA 2VK4A 3D6MA 2I2AA 2JJ2A 1OCEA 3C85A 1J8FA 3W78A 1KSFX 3COSA 2WZBA 3QEBZ 2IE0A 2Z95A 4DEYA 4YAIA 1DWQA 4YCNA 2FEPA 3O8NA 2PD6A 1O97D 1CLUA 1DJOA 2QJRA 4PE5B 1X8LA 1VKZA 3CYFA 3FB1A 4IV5A 3RBAA 4QDKA 4FR5A 4WKBA 4XGNA 3HXQA 1RKQA 1I2DA 2HCTA 2O2HA 2A88A 1W2GA 1YFZA 5TARA 2XE8A 1RNLA 1GZ3A 2YFHA 2I6GA 3Q1KA 2VK8A 2IYVA 1AS0A 3FCEA 3FMIA 4G0MA 2GRJA 3WBFA 5EIFA 2QZJA 3WS7A 1E3DA 1WEHA 1ZJ6A 2BHNA 2GPBA 4KOAA 3OT4A 1ESDA 2GJ4A 2N75A 1AN9A 5KNBH 4BUCA 1PWYE 5CH8A 1XVVA 1N5JA 1ZRSA 5EP2A 2R6JA 3NHUA 1UKZA 1JVBA 1ZUNA 3UAXA 1AKTA 4YAKA 5K05A 3R7NA 2MSDB 4Y18A 2Q27A 3UYKA 1K7CA 3H2JA 3CBQA 4IO0A 5F5NA 3HWWA 3HHEA 3TUIC 4CKWA 1N6IA 1RMYA 3MJ4A 5JVDF 2FHSA 1SEVA 1CSEE 2ZRDA 2IJGX 1H8ED 2R96A 1HK7A 3PWSA 4UFOA 2IV3A 1OWOA 3G1TA 3TXYA 1Z0FA 4A03A 1DL5A 1HT1E 3HCBA 4Y2UA 3L49A 1BROA 3V7UA 1YCHA 3W5SA 4B8YA 2PUFA 5DLDA 3QUTA 1KDPA 3THYA 1IVSA 1I13A 4X54A 1PVDA 1ZUIA 5LZ8A 3B9QA 4WXHA 3FJ1A 1Z8DA 4N76A 2V5UA 3QG1A 3T9EA 2IZ1A 1YKGA 2BEUA 3PHIA 2C4VA 4NX2A 1N1GA 3QZUA 2AD1A 3EXHA 4H6WA 4L2IB 4DOMA 3UTDA 1YA6A 1WMFA 2OCPA 3E7WA 4LYAA 3EG5A 4ZRMA 3COPA 4OAOA 3SGLA 1M6EX 3C6QA 2PQ6A 3H1GA 3PC6A 4M38A 3LJKA 4WNAA 3SMQA 4XX0B 2XYRA 2BDTA 1RWBA 4IQ4A 5FNVA 5KJFA 5C0OE 4M1WA 3HP7A 4AQYB 3EAQA 2G1KA 4ON9A 2XVYA 1RWMA 1KQOA 4A15A 3EXIB 2QU8A 1J25A 3UICA 4U9HS 1CHDA 1ZX1A 1PP4A 2C4MA 1VRVA 1XDWA 2BCGY 3FFAA 1ELOA 1NBIA 4EA7A 4JFAA 3GRFA 2EW1A 4XSGA 2IELA 2YJ6A 2IZ0A 4YECA 5B4TA 4EX6A 4ZTUB 3GEDA 3PXGA 4EY7A 1V45E 4CG2A 3QVUA 1D2EA 3JQBA 4F93B 3EGIA 2HKIA 1CBUA 2H54A 3GEBA 5T3YA 5AKIA 4M55A 2C4HA 3S5JA 1LDMA 2FLVA 3TLMA 3VO9A 4RVNA 1UDRA 2V59A 1U0HC 4DA6A 4MLZA 5DZSA 2DSNA 4HSEA 5EE5B 4H4DA 2DCMA 3HCEA 2MCFA 3KSZO 2ANCA 4ZDJA 3HLTA 4PR3A 1I36A 1R6XA 3W5UA 4K6CA 1DOAA 2ZCVA 4FNMA 4N0DA 1MEJA 2VNHA 3W2HA 3WYEA 4QOJA 4CT4B 2QQFA 4RNDB 3FKQA 3SVTA 4PBRA 2KPOA 1IPFA 1GUBA 1OYYA 4GICA 5FJJA 1OVGA 5BMVB 5J4LA 5JQGA 3RT7A 5T41A 4PVCA 4R3NA 5GM2A 2W00A 3FWKA 4IBOA 3O2JA 4HNGA 4DZZA 3AHJA 2IBMA 1EFVB 4ZREA 2DHEA 5AM5A 2QWXA 2P7IA 4NZZA 2OCDA 3DDZX 5LJLA 2HC9A 2JFVA 3GLIB 3UK0A 4E7OA 1Y7TA 3UPUA 2FZCA 5HF6A 2NU7A 2RHBA 1IQ0A 4YV0A 4TWBA 1UEXC 1U0TA 2OK7A 3TVYA 2YC2C 2IPNA 2HO5A 3DDCA 5K0NA 4MEBA 3E03A 1KOGA 1OXTA 3PSHA 1FDVA 4YJGA 3K70C 4CLDA 5B3KA 1JR3E 4PAMA 4KQJA 1UXJA 1H65A 4BKOA 3RTBA 1ONOA 3PTZA 5ADHA 3PIDA 1ZKDA 2G1AA 1JFLA 1KI1A 3GJTA 3VHXA 4JD5A 2R9VA 1HNNA 1YZKA 4YLGA 4BAZA 4EB8A 1DEXA 3WQHA 3HUEA 1UJCA 2FW0A 2WI8A 2Y4NA 5CYPA 1FNSA 2FUG1 3ONVA 4ZC1A 5IHXA 4MCJA 3CUWA 3HDYA 4JVOA 4CM8B 2GK3A 1RKXA 3NVAA 3SF0A 5EY5B 4UUAA 2BGTA 1N5LA 3IVGA 2XLBA 4GUDA 3B78A 1U0LA 5BSFA 2QRVB 2Y67A 2GNOA 3ETEA 3FUCA 3D81A 1RAFA 3QJYA 5A06A 3QF7A 3IVXA 1G8FA 4C0HA 2J07A 1YASA 2R00A 3ZXSA 2IXTA 2R68A 4MHOA 1TAGA 1Z5UA 4GKVA 4N49A 4G8BA 5AWFC 3SQMA 2ZGVA 1DKUA 2J7PD 1QF6A 1KOJA 4AKSA 4AZ3A 4JV5B 2FP3A 5IEJA 2J7PA 3ROGA 4G0UA 3LCJA 5DIFA 5A9TA 4ZO4A 1A7JA 2BUAA 1YRYE 1R4MB 4RLQA 1XDGA 2VDJA 4RMGA 1A4XA 1BMDA 1K6IA 1QHYA 2BD0A 2CB9A 1FFWA 5ES3A 5AK3A 4E6EA 1AQ6A 2EDAA 2WAAA 3I6YA 5FFFA 4YTEA 1V37A 5CA0F 4LHWA 2VK2A 4MVJA 2QIPA 1BWRA 3ZWYA 4BE7B 1CQWA 3FTCA 1N2XA 4IKEA 2FRVA 5ALGA 4BGIA 5ADVA 3KEOA 3PUKA 1K7SN 1SUIA 3L4JA 3GC6A 2P77A 4TROA 4WK2B 3S28A 2G9UA 1A95A 3H4MA 4OYRA 2RJOA 5LOVA 1TKRA 2REOA 2ORWA 1NOKA 3S2IA 3ZNOA 2P6OA 3V34A 2JLAA 2VF2A 5F51A 4BEWA 4QTTB 5A3QA 4RFSA 1PU2A 3DE7X 3E48A 4YY3B 5CLHA 1XPRA 1N2SA 3FVTA 1JRLA 3QU2A 3SF8B 2JFGA 3FOEC 1SOVA 4WFQA 2Y1EA 3X2FA 4D4HA 2VC2B 3B38A 4DUYB 1Y5NA 1P2FA 3SIPA 3TSWA 4IDNA 1ETUA 4R1SA 1Z4JA 2DJ5A 2KLHA 2ZXFA 4PWYA 5HBRA 3IE1A 3QSYA 2GESA 4RSMA 3D6NB 4HH4A 2IHNA 5I9LA 1RWXA 2H5IA 3P2IA 3TB4A 3TZ6A 4NYIR 3U4CA 1JMVA 4N0PA 2ATIA 3BL5A 3O7MA 5KVVA 2H1IA 2V7GA 4PLYA 1OGJA 4MR8A 4ZTZB 4RNCA 1XWFA 3EC2A 4BNXA 1T1GA 1BKYA 3CZ5A 5FQOA 2WV9A 4PYLA 2HUPA 1LK5A 2FX5A 1ECGA 3HY4A 3FCOA 4LXGA 1FSSA 1Z0ZA 2VDNB 5CLGA 1I3NA 1LPMA 3PWTA 4KX5A 2WTBA 1AMNA 3COZA 4QYWA 2UU9B 3PEYA 3L02A 4LXIA 3JASA 1Q0ZA 4KFTA 4U7TB 5D8DA 3SXPA 1TEXA 1ZRHA 2RHOA 3K5WA 1H3NA 2C5GA 4IIYA 3FSEA 3U1TA 2OKGA 3WK5A 4BOYA 2WABA 3DMYA 4YJ2A 3FVQA 3L8DA 1TDJA 2QMOA 2Z1DA 2ZAYA 1NNI1 2JA2A 2YBEA 5H3HA 4F96A 5BWLA 4C6RA 3FRJA 4DT1B 1M5RA 1M2VB 2VTDA 1GNPA 3K9CA 1YK1A 1LNSA 4WRRA 3AHHA 4RXUA 4DLSA 4RTSA 1RYEA 5EEHA 4P4TA 1EUCA 1MO5A 1A71A 4H7EA 4V0QA 3UAWA 4EJFA 1Q0QA 3NAMA 2RBGA 1XE3A 1T13A 1VI6A 1IJBA 2C57A 2CMHA 4LS3A 1TZMA 2I1WA 2P2CA 1HEIA 2ZIXB 4GPTA 2ZR0A 4FEAA 4ZEXA 4BATA 4ER7A 4YAUA 1XKQA 1LLUA 2Q4TA 1JJAA 5JUWA 4EHHA 1EINA 2H4JA 4E1BA 5B55A 4UM9D 4EKDA 3LXXA 4IS2A 1WHSA 1WOMA 3CE6A 2J0EA 3LKVA 4WEOA 4Q9JA 1XLUA 3FNHA 2Q1SA 2WAOA 4HQFA 1D1TA 4GP9A 5HR5A 4DY6A 3T4EA 3AVOA 4MGKR 3IUSA 2LNDA 2ZLBA 4I6JA 4OIMA 4JZYA 5EQTA 2IU0A 2AEEA 3AVTA 1NXPA 1G0NA 4FFMA 3I9OA 3KQVA 4C4PA 4JKIA 3NGXA 3TVDA 3VAAA 5ICSA 4LOLA 521PA 5KPDA 2LW7A 4Y6PA 4IINA 4INZA 5KJ1A 1I7DA 2ZBEA 2GCNA 3R9IA 1OBCA 3UA4A 2XGGA 2H92A 2WG0A 1DJLA 2YZNA 4EI2A 5DM2A 3MELA 2I87A 3EUWA 5SYAA 1YCFA 3X1YA 3CZPA 3RYCB 1TNDA 1AB6A 3PT9A 4JZKA 3VFDA 1RC0A 1KI4A 1H6DA 1WCWA 3DCYA 2FR1A 4JH0A 4EW6A 3L6BA 5C1BA 1G38A 4M9QA 3TQSA 4NR0A 3ZD9A 4TUYB 2W9XA 3ZGXA 3TD6A 2XVMA 1T10A 5FTLA 4PC7A 3A3OA 1U8EA 3O4HA 3OD5A 5BP7A 5FNZA 2EGUA 3HWRA 1U0OC 1CQJA 1O4WA 3OM8A 1RP7A 4EKIA 4HATA 3RNOA 3W7VA 1CP2A 4TUYF 2Q8NA 1F0NA 4EA8A 5IT5A 4OMCA 1MNAA 3DULA 4CUKA 4BLTA 1DG1G 3AMVA 1Y6FA 5J63A 4JC8A 2P11A 4B6OA 3P2EA 4MS3B 4WY2A 2UUAB 4I5IA 4E15A 4K05A 4ZHQB 3S0JA 4D9IA 3QVVA 4LYEA 4P54A 4C0BA 5IPFA 2NG1A 3NC4A 1GIAA 2A7QA 4TT8A 5BSWA 5DRTA 2J7KA 4QHTA 2CDNA 3PT5A 5KKAA 3E5MA 3K0FA 4OJMX 3WLKX 2V96A 4JT4A 4N0EA 3N74A 4J0KA 1I6MA 1BZYA 4IXMA 2AUNA 5DGIA 3QQ5A 5K3FB 4P2GA 3QJ5A 2PUCA 3QBDA 1Q7GA 3LYLA 3IFSA 4G1MB 3DXXA 4MGIR 5KYYB 1AXEA 1H5UA 3M6WA 1ZU4A 2FJ0A 6Q21A 4Z54A 4QHYA 3TLYA 2GASA 3JX9A 3U7IA 2CDBA 1EEXB 1W1WA 3ABOB 4OHBA 2XODA 5DOVA 2EKDA 4AIRA 1HY3A 1IZYA 4BKUA 2ZROA 3OCZA 2Q5HA 3AOEA 4HVTA 1XUOA 1PWEA 3HM9A 3U80A 3CH6A 2VXBA 5DNEA 3J81k 2O8EA 3BIOA 4Q16A 4PXSA 3E9YA 3UCXA 3OOYA 4L9AA 2QEQA 1KNXA 4GPAA 1BIFA 2X0IA 1ESMA 4GBED 5DN6D 4OQMA 2EZ9A 1RR6A 1TEVA 2W6JD 2ZJ3A 4TTQA 1J70A 1X8KA 1VSUA 2PA3A 3O21A 1DV2A 5ALFA 3TGPA 2HU5A 3E3NA 5EXDA 4FW8A 4WK0B 3RCBA 4BX2A 1AGNA 2C88A 1XQWA 4B34A 2QX7A 2G0TA 4CQJA 2CZCA 3OKCA 3HXOA 2HTEA 3TCKA 2NVBA 2EX1A 3QKSA 4PGHA 5CIWA 3EGDA 2V8OA 4F5ZA 5CAEA 1V3UA 1LH0A 2ZSJA 1MV8A 1X7DA 2I03A 3BWDD 3L06A 1UK9A 3LDHA 5EE3A 2Y27A 3Q6MA 1LX6A 1YS2X 2NTNA 5KTTA 3NHSA 2W2QA 3CF0A 3IODA 2GN2A 2O14A 2X8BA 1RAIA 5IJWA 2PR2A 1DAMA 1XBTA 2RHLA 3T7SA 1F20A 1UANA 3FPEA 1RKBA 2WILA 3PC2A 3R5KA 4QSHA 1JEEA 4YP0A 2WP8J 4QX6A 4W5HA 2X6RA 3OZVA 1AXGA 5D3QA 3R75A 6YASA 2H07A 1UF9A 4DBLE 2Q6IA 2AT1A 5EZYB 1YV9A 1TZ2A 2VFAA 4L72A 2P9ZA 1LQUA 3PPXA 4M49A 3G5LA 1ORTA 1ZH4A 3B89A 4IL5A 3BPSA 2V97A 3KJFA 5G0WA 4CNQA 2X6QA 3HKEA 2XUDA 3C4JA 1NV8A 5KJCA 3KQKA 1C3XA 5C53B 3ZHUA 3EBLA 2QV7A 2ECKA 4IVNA 5I9SA 2HFKA 3NORA 4YRJA 3L1HA 1X7XB 3Q85A 4ZAXA 4HVCA 3A0RB 5TPWB 1PT7A 2X9GA 4EB3A 3ZK7A 1WZ2A 2EP5A 1QVVA 3WAKA 2PMBA 1EHIA 2QVXX 5LQNA 4ZKEA 1USIA 2CBXA 2ZRFA 3OECA 4OY3A 5KMGB 1ORDA 4X7BA 5KBYA 6AT1A 1PSZA 4JNCA 3DV0B 4LDRA 1QLJA 3LDAA 4HLUA 1GL6A 3HJBA 1G4HA 1ENYA 4MR7B 5CBPB 4GMDA 3WNVA 4E70A 4JCOA 1UWKA 3SQNA 3R0IA 3LS2A 1P5ZB 1NUUA 2GD6A 2X0KA 4WCVA 4WZBA 5BQ5A 3B8EA 1YUMA 3A1SA 4ID9A 1SKMA 2IYRA 2VI5A 1M8JA 2AFHB 2ZRKA 3CLTD 4WGFA 1DIOB 4OX9Y 1NVWQ 3MTBA 3OJEA 2WU3A 2QN3A 4FYHA 3D3NA 4BNJA 2C2OA 2OTCA 1K5GA 1GPLA 1NMSA 1OFHA 3ZKAA 3HGTA 1MC4A 2ZJOA 2AI1A 4K0RA 5IBQA 5EJEA 3IR6A 4NONA 1FP6A 3KQNA 3MA0A 4UTNA 5I9NA 4UTRA 5JNTA 4TZ0A 1XV5A 3L1KA 2MTBA 2Z43A 2PKYX 1MH9A 3A9CA 3QXGA 2OXEA 1KDYA 4DJ5X 1V2GA 3ED1A 4GL4A 4NMHA 3F5QA 2I91A 3FWYA 3T15A 2X40A 4R0NA 1V5GA 3G0GA 5IU6A 5L7WA 1OFGA 1U2DC 4GRAA 5IFKA 3DKIA 1JALA 2C2HA 3HU5A 3KQPA 3OWHA 4FLFA 4ADSG 5I8WA 1DXQA 1U2GA 2PT6A 4LXQA 2W6IA 3NJ8A 4JCCA 4MEAA 3ZI4A 1IVNA 1HT3A 1RLIA 1HURA 5GMOA 4H7JA 3WDLA 4FIDA 1QAQA 2G82A 3IQDB 4M8IA 1XA0A 4WLUA 1MB0A 1A4RA 3DZKA 3H7IA 3KLMX 3OLXA 5CNMA 2EX4A 3H9GA 1OSNA 3IIIA 4R0VA 2LCIA 4ZO6A 1C5KA 5KDDA 4CL3A 2YOFA 1KVUA 4IDBA 1MV5A 1RYFA 1K5PA 3MPOA 4Q9DA 5JXHA 4KQWA 3QMWA 1WSAA 2TS1A 4PC1A 4GXQA 3LM8A 1W1UA 2CXRA 4P34A 2O23A 4E30A 3QXSA 4IGKA 3DBHA 5AK4A 3VTFA 1G291 1KJZA 2SICE 1LPOA 5AKZA 5TR9A 3TOZA 3BWXA 5UKDA 2QJTA 5GAJA 2CE7A 2NTEA 3JARB 2CNNA 5HOEA 1GAXA 2MINB 1SVLA 3KT3A 3LBHA 4ZYYA 1NUPA 2VYVD 2PGXA 3OPQA 5CGZA 4TVOA 3UHPA 3VZBA 1EUZA 2FF7A 5FUQA 4V2UA 3Q0TA 1Q1ZA 1O3YA 2Q99A 2XCLA 3I0MA 2Y6UA 3MXTA 1EXMA 3KYBA 3AR4A 3S1SA 4QOIA 1DWUA 1MOPA 3A3KA 4C5BA 4Q00A 4DHEA 1EWRA 4IYRA 4BMCA 5CJ2A 2BR3A 2ZQZA 4ZOLB 3GEPA 4YO7A 1H1DA 4J16C 1BG6A 2ONJA 4TV8F 1XFDA 5I3CA 3KBOA 4CNBA 3UQZA 2FPRA 4LRQA 4ECEA 3SQOA 5D1HA 3K6JA 4AJHA 2G09A 2HMSA 4DE5A 1V95A 1K8QA 1Q1NA 1FXSA 1N2CE 1DX6A 1EUDB 1SIBE 4K2HA 3WZLA 3X44A 1KAMA 3L05A 3LT4A 4DZTA 4DR7B 2ZZNA 1AUOA 1M75A 1ZVQA 4QBFA 4DCVA 4EYEA 5CDSA 2O2DA 1OYOA 4X6UA 1ISGA 3C3MA 3LYUA 4ZQFA 1NVTA 5BUCA 1E3IA 4X45A 2NYRA 1PZMA 4PSVA 1JSCA 2BFPA 3UAOA 2DTDA 2EFDB 1GR1A 4R51A 4D4GA 1BO6A 4E07A 2R11A 1TD9A 3ADBA 4HJRA 4C4TA 3HN2A 1KDVA 1YI1A 2VDKB 3DZJA 5CCEA 1Z4PX 1SXQA 5DYYA 3FYHA 1PWXA 4AIIA 1N0HA 1UXOA 1G16A 3O3MB 4MCHA 3T5AA 4F6CA 3PUWA 3QJGA 5D5HA 4QT0A 3D5QA 1W4ZA 3F8SA 1EP3B 3E7FA 3KVRA 3WLAA 3GCDA 3RUIA 5D1NA 1ZEJA 4V24A 3T1NA 4DIDA 2EOAA 4LJYA 4NEHB 4NJMB 3N28A 5F9MA 3UWDA 3W7AA 4BAGA 1QP4A 2GHQA 2PUEA 4AJLA 1DX4A 3BDAA 3LKBA 4H16A 3IDFA 3SKYA 2BR5A 3MGKA 2YZ7A 4MB0A 2PMKA 3QLUC 1QYXA 2I2BA 1VBNA 3UUGA 4EB6A 5FPHA 1JYFA 1J06A 1ZGAA 2OLEA 2Z2YA 3BS4A 4GKBA 1L5NA 2FZLA 1XHLA 4DM3A 4G1FA 4U2CA 3WLQA 2VKTA 2H9IA 5FWNA 3Q7QA 1JR4A 5LL6P 3JU3A 5FA6A 2WIFA 5F21A 4CMBA 1L4BA 5JCXA 1RQ2A 4ESOA 3W34A 1MT0A 4DV3B 1DMSA 2PSHA 5BNIA 5BV8A 1QVWA 4NBVA 3FD8A 3V80A 5IUNC 5IBPA 3IP9A 4C14A 3LRXA 3ZR4B 1Z2OX 2X2FA 4RMHA 3V8QA 1E2LA 1R0SA 1WZCA 4BBZA 3OEEA 4AMYA 3VR5D 2OQIA 4BRSA 4QUHA 3SHFA 3ER9A 2BFEB 1PR3A 3FZEA 2PCLA 1XIVA 2QJFA 1JLLB 3ID6C 3IT0A 3OA0A 4EEXA 1FS4A 1KORA 2R4UA 1N2JA 2REXB 4ITUA 2FAXA 4YHHB 3U3DA 4FZ3A 2C04A 2LV8A 2PKXA 3CV3A 3ESCA 4FCWA 3VHXB 4QTXA 5AK0A 3IR5A 3A6LA 3JQPA 4JBYA 3H9UA 4B6SA 3UJNA 5D7BA 1B8UA 1KE1A 1IWPB 3AFNA 3N1UA 1H2EA 1J21A 5GJCA 3PF9A 1I7SB 4WESB 3MFQA 3C5WP 1R15A 4PM4A 5FTNA 3TAHA 4BB6A 4KN5A 3GRCA 3QPVA 3T54A 2PS9A 3AKEA 3UBMA 1XI2A 4DDKA 2ZAOA 2ZQYA 4F91B 3NKLA 3RYCA 3L7KA 3DHYA 2PKQP 1DHTA 1L4KA 2GHTA 2PX5A 3G7UA 1OWMA 1U3FA 3GUYA 3OWXA 1BDBA 1LB1B 3VO8A 4C0JA 5A4KA 3TQQA 1KEWA 3DE0X 4QOHA 5JLAA 3JSAA 3B8HA 2V54A 1L4GA 1W9MA 4EI9A 2ZB4A 4NBRA 1O2DA 1PJAA 2PN1A 5FNVF 2ZVPX 3AL2A 2GEFA 4A8TA 1F60A 4KI0A 5EXSA 1O94C 3HFJA 2F4NA 1TGVA 3GGDA 3HNPA 1VL1A 2JI9A 4Q3KA 2OQ2A 4UCQA 4BWVA 1RHRA 3O3CA 4NHOA 3UJBA 1G7CA 3Q3CA 4OLHA 1Y82A 1YRQA 4I9UA 4WBSA 1TJNA 4U6NA 5JD5A 4TM7A 5JO0A 2E4AA 2E5WA 4M0KA 2QLBA 1AF4A 2VWHA 4KJZA 3TX2A 4QC2A 4PZDA 2XTNA 1RFLA 2EEZA 3VPFA 4G9EA 4LBVA 1SQFA 1ZGZA 3FHOA 1E3QA 4MVJE 1EFKA 2D1FA 1JXQA 3LTEA 1QH0A 5ALIA 4HAXA 4HV4A 1ID8A 2E4VA 2X9NA 3TUJC 2XNSA 5JJCA 5EXXA 2C9MA 2VAWA 4HB4A 3L1JA 4ZWNA 3G8CA 1CETA 2HCJB 2WTMA 3BKWA 3I1IA 3IUBA 1NMQA 4CE6A 4YFYA 2RAPA 3QVWA 3NC0C 4X6XA 3PXBA 2MYPA 4HDCA 1ZUWA 4ETIA 3SVLA 2QXUA 4JODA 1PFVA 4GNKA 4RKFA 5BSRA 3FLBA 3FMVA 3AR7A 5IHPA 1IH8A 1PR5A 5KYNA 2JI6A 2FSSA 4NBNA 3DZ8A 1YZ3A 2FG7C 3OX1A 5CXUA 5CD9A 1V25A 1D2HA 1X7GA 2GDJA 1P77A 3OU2A 2J09A 4N5LA 4TRRA 2AZXA 3U4IA 2CLLB 4FFNA 3CX7A 4XIFA 4INJA 3HB5X 3COYA 3DB2A 5JDIC 2JGDB 3TPZA 3VYTB 2H8GA 1GGHA 4CMKA 2ZKIA 3B1ZA 4IVPA 2VYFA 3PSAA 3QHPA 1IVYA 3GN1A 3OKPA 1U28C 2Y1LA 3TLJA 2ES4A 3DNFA 3V2GA 3W5IA 1D03A 2G36A 4DJDC 4LJ8A 1VFNA 4UAGA 1NAIA 2ASVA 4K8RB 3ZEAA 1X7WB 2PSJA 2Y66A 3HYSA 4HN9A 3DTVD 2PMEA 1J42A 4LZAA 3I61A 2CGEA 2FUKA 3KDSE 2HAEA 1E2MA 3FYTA 4UMDA 4CFZA 4ARAA 4HT3B 4EMUA 2K4MA 4UBNA 1F7VA 2UYOA 3CO5A 4JYCA 3U3OA 4OBBA 1O8CA 1NUHA 4Y6GB 3SEAA 3GA7A 4MWCA 2QRZA 4ZD6A 2RMKA 3BH6A 3GD5A 4B79A 4BFVA 5FF9A 3WGKA 4F2DA 3CF4G 3AFIA 4ZZ0A 4EYSA 2O8VA 3DXFA 4Y2PA 1O03A 4UKDA 3UG6A 1WQ1R 5BRJA 4FX2A 3QELA 2EW8A 4RY0A 3GPDG 5KQMA 1EM6A 4RXMA 4X60A 3GJ7A 2G8LA 3DAOA 4TRNA 3WB9A 2XRMA 2M32A 3A8TA 4FIZA 2K87A 4JJ6A 2C2YA 1Y9EA 2ILVA 4KO3S 4OK6A 4RVOA 4BCDA 1H2FA 3DV0A 1P2UA 1W5FA 1DKOA 2OXCA 3CW8X 3H3JA 3JQBC 2GT1A 1U4OA 3QEMA 2YYZA 4HK4A 4TQUS 4XB2A 3SC4A 1NF3A 4EFNA 3Q2OA 1J39A 3A04A 3A4IA 1W0KD 2OKCA 2OGUA 2GBCA 4QFDA 3G2QA 2XQIA 4UU7A 4ZANA 4DLLA 4ZKDA 7MDHA 3DFKA 1ZMXA 3USES 2Y0EA 3TDNA 3UMMA 4EF4A 2IP1A 1HC7A 2RAUA 4ARCA 1KKMA 3ABSB 1GSOA 3S3TA 1GTL1 1YBMA 3KR2A 4RESA 4NRDA 4XWYA 2UZAA 3DJYA 3KFVA 1KXZA 5ALMA 2B37A 4TRJA 2FDCA 4R6WA 1CQPA 3UHAA 4AO8A 1GCIA 5HM6A 1VCNA 1GUAA 1FUEA 4FQ8A 1MORA 3R0QA 4FLMA 1TYEB 2O5RA 5BUQA 1OVMA 1QQBA 3G7NA 5FQNA 3BRWD 3NTLA 5IFLA 3QVTA 1LSOA 2ZSAA 3EUAA 5ICCA 1X1SA 4GOMD 1Q3HA 1X9IA 1WXFA 1XZAA 2IIPA 2WKWA 3DMTC 2PRIA 1UKVY 3OFNA 1S1MA 4PYMA 1BD3A 2K2WA 1ES9A 4L5CA 2ARKA 3PXEA 3UW3A 2XWQA 3FJYA 3DSRA 3C8DA 3F47A 2G9NA 3TZLA 2W4MA 4LZOA 4QUKA 1QFMA 4BNIA 3F6BX 4FNOA 3U4DA 3VNSA 1CIVA 4GF5A 4NJMA 4BDTA 4EI8A 3ENKA 4KQXA 3H75A 4WFKA 5DEOA 3TEJA 4B2PA 4MWBA 3U3XA 4BDSA 2W6OA 3RTDA 2IYZA 5FL7A 1F3LA 1Y8QB 2O8NA 4TMXA 2PZAA 3O2QB 2NWQA 2PZFA 1B6GA 1SBCA 1YUBA 4IF6A 4IJWA 1XVUA 3A4YA 5L7TA 4I4IA 1CDZA 2COKA 3PC7A 1K75A 1CY2A 4O2RA 3G8YA 3PVZA 4PZYA 4I1UA 5AVUA 4QOFA 2UVPB 2DM6A 5DSTA 3D4IA 3IB3A 1Q57A 3O90A 1GHTA 1O77A 3OMXA 5DBOA 5KNLA 3FTEA 4JR1A 5LMZA 4Z1MA 5G53C 3S29A 3A37A 1G18A 3KTAA 2YIMA 3OIWA 2EAUA 4WINA 4EKEA 2DQKA 1B8PA 1Q20A 4KAJA 2B4YA 2BEJA 3CTMA 3K0HA 4DILA 4G8CA 3N2LA 4C88A 4C9BA 4CL8A 3ZE8A 3GT7A 2LD4A 3AUTA 2X0FA 4L4ZA 4TQ9A 1EUDA 3DO8A 4IPTA 4K88A 4S1OA 5AVSA 2BN4A 1A0OA 2D2EA 2IZ6A 5F76A 2WMDA 1DQYA 2R00C 4B82A 3AEUB 1ECLA 1ZK2A 3I9JA 1QJ4A 4CLOA 1EIWA 1PT6A 1QH8A 1LFAA 1DAHA 2C82A 3BL8A 4AY4A 4B2LA 1JR6A 3GO4A 5GV7A 3L7IA 1P4RA 4IIEA 1B3RA 3IVCA 3M70A 1E4VA 1ML3A 4HLUC 5EI5A 1DG9A 1VIYA 3A27A 4Q3OA 5F2NA 1QO7A 5EP4A 1Q6YA 1R37A 1UBKS 4G5SA 3MMNA 4EEKA 1G5FA 5KTMA 1V8PA 4Z2YA 1UQTA 2QR2A 3PNSA 2A9PA 2HA5A 1YS6A 2GSDA 2R1TA 1H3EA 1JYSA 3QEMB 1TIKA 4HLQB 2EQAA 4ICIA 4IDFA 2QPAA 4QOEA 2EQBA 2JVJA 2JIOA 2WM2A 3AFMA 3NI2A 3NTQA 4UEOA 1CR6A 3BFJA 3BD6A 2FZKA 1GDTA 1XDSA 2XECA 2ZYDA 1YONA 1J56A 1ESNA 4ZRNA 4W8GA 4DR2B 3S68A 4BMXA 1ISPA 3F4BA 5G4KB 3T7KA 5JC1A 1N2CA 4UM5A 1WXXA 5LLSA 1J0AA 3I3OA 1Z34A 4JJEA 4TXNA 5ER6A 3VR2D 5KWVA 1SXJD 3HYRA 2IZZA 5K0CA 1JFRA 2QZPA 5EGNA 4HGYA 1GFIA 2GO7A 3PGJA 3PHLA 3IV7A 2QQ0A 4CLEA 3QE2A 1GZ4A 4OCZA 1Y7PA 3RAGA 1GLGA 3U9SA 4BO9A 1JQ5A 2ZDQA 3K15A 5J1TB 1EK1A 1E0KA 2E37A 2EC5A 3DVSX 2CLMB 1JS1X 1CIPA 2GCOA 5AM3A 3SKVA 2J32A 2PLFA 3V97A 1LU9A 4PY2A 4K26A 1JIIA 1XROA 3KK0A 1B42A 4RIIA 1Q92A 3CJQA 2J5KA 1ISRA 4YWHA 4ND4A 4OQNA 3HB9A 5M3BA 3T0GA 3TOCA 3AVYA 3HJRA 4YCBA 2E4ZA 1P0CA 4QECA 1SR8A 1SAYA 3O3OB 3ZQ4A 1A8UA 4CQMD 3RSCA 5HFAA 2ZREA 2OHIA 1JFTA 2IGBA 1M1UA 3OU6A 4N39A 3BJEA 1T5OA 2DHRA 3PG5A 1FSZA 2WF7A 4UPVA 4X6LA 3TX6A 1NJGA 4ZVPA 2PYIA 1BE1A 4D02A 2E49A 3NRCA 4LDAA 1ZVVA 2AE1A 2GTHA 1TA0A 2W2TA 2VL7A 2XE6A 3D0KA 4PGMA 1QLHA 4IAOA 3LY5A 1OFTA 3X0DA 2VRCA 4QPJC 1ZG3A 4UOZA 1EKXA 2JLVA 2BMJA 1VSTA 1AKRA 1FFXB 3QMPA 4EJSB 4AYXA 5FUMA 2NZYA 3Q9UA 4YRRA 1JI3A 2J9FB 1SUAA 1FQWA 2ISCA 4HFNA 5L40A 1C14A 1GYPA 3P1JA 3U5ZB 5GOZA 2IZ7A 2GAOA 1QQ5A 4I55A 3W9YA 2A9VA 2OBNA 2CUNA 4J2OA 3BD9A 4XIIA 4W5QA 1PO7A 5HK8A 3GFVA 3OKAA 1OH7A 3LH5A 4QFMA 1YBVA 1BHQ1 1D6MA 2OPBA 3KV1A 4EECA 4E33A 3HU1A 4DMUB 4Y9TA 4N8DA 4Q1BA 5GOTA 1LXCA 2DFDA 1TUBA 3FNBA 1O6CA 4LX8A 4UARA 4XWGA 2GD1O 1IHYA 3WDKA 3CPHA 2VHUA 1Z08A 1V3VA 1D0SA 3EF3A 1IMJA 1UPCA 1SKBA 4J0GA 1YULA 4HDKA 4YJ2B 5C4GB 3FTFA 3Q3VA 4EVRA 3VGJA 4GT1A 3GPLA 1K7YA 3T9DA 1YQGA 4F7DA 3TG2A 1A76A 5EIBD 3JASB 4C4OA 5B57C 3T0IA 3HEBA 3GCXA 4DMKA 3CUTA 1DKLA 3MF4A 3WWOA 4BBJA 1T1SA 4D57A 4KFCA 3N7UA 4RSGA 4M0DA 2Z2IA 2VDRB 3O7WA 4TLDA 2I6XA 1TCAA 1TK9A 3QE9Y 2IKQA 3ONEA 5AXBA 5BQPA 2WG2A 1JEAA 1TUEA 2QL6A 5AOBA 3A3NA 1B23P 3FCSB 3GUCA 1S1CA 3DO5A 2FW8A 4GFDA 2HJGA 2EFGA 2QB5A 1K08A 4B44A 3D8UA 1M7BA 3ROQA 4EFKA 4KFRA 1XZFA 1IEXA 2H65A 3E5RA 3HCAA 1KDZA 4IXDA 2AQ8A 4O29A 5SY4A 4ER0A 3L8CA 1DC4A 5FPSA 2GNPA 4ZOBA 4ZOCA 1XRJA 2J3HA 2QBYB 1YE3A 2GBLA 2D5IA 1IXSB 2W4QA 4I8IA 4Q9NA 2X23A 5F3WB 3BK1A 1USUA 1ZCBA 4EG0A 1WXDA 2ZIWB 4X1OA 1KEEA 5BUZA 1ZJYA 3U9TA 3TEMA 4DZRA 2OAQ1 1G8SA 1R5NA 4W5RA 3DVRX 1AZSC 3D6UA 3U7RA 1BH2A 3DMFA 1IQRA 2MYTA 5KVQA 4CKBA 5C8ZA 1VSQA 2XUFA 3OKFA 1P33A 2D5CA 1VC2A 4C08A 2A1TR 1SQ5A 5BVGA 1HNXB 3KXDA 3P96A 1E2IA 4ONEA 2PSEA 2QP4A 4YRPA 2GPSA 4KE7A 3ZQJA 4ENVA 1A7AA 2BEKA 3W79A 1V1MB 1JDSA 1TU3A 4PG6A 2IIQA 2JCSA 2XGOA 4MVYA 1Y5LA 2GPAA 2FPIB 3BWBA 3HC7A 4O1HA 3ECCA 1L0BA 1T9ZA 2ZTUA 3FOCA 1W34A 4QQ8A 1GUFA 3UC5A 5K99A 1EVZA 4Z4GA 1I4DD 4GZ6A 1RM4A 4OVKA 3O4VA 4QGAA 1N57A 3CUUA 2IV7A 3W8EA 3LV8A 2AUTA 1PUJA 4FJ0A 2WMNB 4HWPA 5I7RA 4J0QA 3ZHBA 1VJ0A 6ABPA 5FBQB 5AQ1A 2RE8A 2GWHA 4PG7A 1ZGCA 4LC1A 1VBMA 2QD3A 2HSWA 3BD7A 4WAUA 1YFLA 3G6KA 1ENPA 1JWAB 2W6ID 4HADA 4F8EA 4TLLB 1N4DA 1FZTA 3E4DA 1REQA 3ZNNA 5A6SA 2IV2X 1MAWA 3ANYB 3R6LA 4ZAYA 2IBSA 2ODTX 4AJNA 1TEHA 1QGZA 3EOAI 3ROTA 4LW8A 4O4IA 1UL1X 5JADA 1AMOA 1JQDA 1ANKA 1Z4OA 1YJQA 3QV2A 3OF5A 2QTFA 4CU2A 3EEFA 4N1AA 4O2LA 1DKPA 5G40A 3ND8A 4ZZIA 2DKOA 1YB5A 4NFSA 4WADA 3AVWA 1JMKC 3ETNA 3ILVA 1SU8A 4LRUA 5GJVC 3GMSA 1WZNA 2JAUA 3SR3A 1KHTA 4G3XA 1EG2A 2JI8A 3LE8A 3NLLA 4CKBB 1Z0KA 1XTTA 3GHYA 5A9SB 3TQHA 2FW7A 2CBZA 3HKDB 3OJXA 4IS3A 3OZEA 2V6IA 4B5LA 3O8OA 1QR2A 4D5GA 1YQEA 2IUEA 3SZOA 4LRSB 2XVZA 4N7MA 3TQOA 2PXXA 4F71A 1OT3A 2J3MA 2V55B 5GGYA 2R6GA 2LXNA 3V4VB 4BQEA 3A32A 4LWOA 1C7FA 4OOFA 3GEHA 1RWNA 4BZWA 5G1NA 1Q91A 3BXGA 1MT3A 2XTMA 3PUIA 1XZJA 4IWYA 4RK4A 4C0AC 2WJHA 2P65A 2CVPA 5IVHA 1APBA 5LR6A 1ZUD1 1NPYA 2Q07A 2R6CA 2MYNA 1E6UA 3D4LA 3NHWA 3M33A 4OQDA 4W9NC 3TYXA 4Z2AA 2NP7A 1U98A 2GR9A 4O8ZA 5ENVA 1GZ7A 1UC4B 1NRIA 3GLFB 3OSZA 3SX2A 2QVLA 4FHFA