2IT1A

Structure of ph0203 protein from pyrococcus horikoshii
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
362
Chain Sequence
MVEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDRNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFLGNPPMNFVEAKVEDGKLVITEKSKLPIPKQYVEIVKETGITEVIIGFRPHDAEIVKGEGEGIVGEVYSFEPLGREQIVTVSVNDSIVKVFAPEGEHFSFGEKVTIKVKEELLVLFDKKTEKALEFSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 362aa long hypothetical maltose/maltodextrin transport ATP-b
publication title Structure of PH0203 protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
total genus 98
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2it1A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2it1A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2it1A01
3T34A 5HCIA 2BV3A 3FHWA 3B9PA 2D06A 3UG6A 2FXQA 2R93G 1E2VA 3CX8A 2ZJZA 1LNZA 3HYTA 3SYKA 4AYXA 4DV4Q 1BIFA 1L7VC 4XIGS 4B6EA 5E3HA 3QKUA 3OTOQ 3OIWA 2EXDA 4JI3Q 3DMNA 1MO5A 4L4UA 2JLUA 5FOSA 1SXJB 3M7NA 1LY1A 1H8HD 4DSTA 1Q44A 4BXXH 3A1VA 3LD9A 4XD7D 1HR0W 2GWHA 4OK6A 4D81A 3AVYA 1T5EA 3N6RA 1XFAA 4QGAA 3AVVA 1YRAA 2KI5A 2VHQA 5C44H 2J3EA 3OIUA 1SVIA 5H70A 2BM0A 2JE6I 3BJIC 4F91B 1VQBA 1LS1A 3S2DH 5GVSA 2CVHA 3BB1A 4DV0Q 4IDHA 2WIBA 3BZKA 2P5SA 1IW7D 4LPSA 2VP2A 1JE5A 3A5ZB 5DLQE 2NZHA 3UDFA 1KGDA 2H7VA 3FMIA 1HV8A 3F2BA 3X1DA 4LBZA 3PEWA 4DSOA 2JLZA 1G5RA 1BS1A 4BEBA 1GSIA 1XDBA 4JI8L 5GJBA 2R7FA 1G3UA 2OSBA 1QRAA 1AZTA 3KFXA 5DI3B 4RZXA 2F1MA 4X64Q 1NLZA 5HKKA 2J59A 3KB2A 2J7PA 3B6EA 1MIUA 1CIPA 1EFRA 5JWRA 2DCUA 2VH5R 4NH0A 1B9NA 1XMOQ 2KCMA 5EQTA 4ITRC 4BFSA 1II8B 2YC4C 2ATWA 1E2PA 5KO2A 2PQAA 3FDIA 3AVXA 1HCZA 5FUYA 3NC0C 5J47A 4JVNA 3MWLA 4WAUA 1ZINA 1PUJA 3TQCA 3RVBA 4A8JC 4DIEA 2AKAB 4NCKA 1L0WA 3ZZ0A 2FFAA 5IT5A 3U61B 2IYXA 4DNIA 2DPXA 2E1RA 2WJHA 1Q1ZA 4HAWA 4DSUA 4BZQA 1QG2A 4MDFA 2EJMA 2L15A 1CTQA 3MMPA 2ZI7A 2ATXA 1HE8B 2GK7A 4R4CA 1CR2A 1NP6A 1EXMA 1GKYA 3B5JA 1X3EA 4HUQB 1CFMA 1AQYA 1W4BA 2W83A 1ZC4A 4F4CA 4M1MA 1N5LA 2PT5A 1Y63A 2QPOA 1KDRA 3SYNA 1GL6A 1OFHA 2GEUA 2CCJA 2GJKA 3SU8A 4RFVA 4J15A 4OGQC 2JIZD 2DHRA 4V0NA 5DN6D 1U9IA 3S1AA 1A1VA 2VUMH 4QHSA 2GXSA 2A5FA 3OIVA 1XJ0A 1Q1QA 2UZIR 2XNDA 2N42A 4R4OA 5GJCA 1E1RD 1JEDA 5BWMA 5J4LA 2VP4A 5A5GA 2VS1A 2RGGA 2PX3A 4G5RA 4UXIA 1Z0FA 2GCOB 4Q4LA 2JIZA 1IL2A 2BVNA 4IOMA 1VQMA 1Z7TA 3F2DA 1XNRQ 4POAA 5AJ3Q 4PAOA 1U0HC 3CPFA 3ZYCA 3QOFA 4FI3C 4PR0A 2NQ2C 1EIYB 1DGSA 2ZI9A 4ON9A 2IXFA 3WHLA 3ZGXA 4DRZA 4G7ZC 2FFQA 3JZAA 2LKDA 2H8KA 2NVQH 2WWHA 2OFWA 3VU9B 1RPZA 1T3HA 4DBLC 3OHMA 4PQFA 5AR1A 4A3CG 1UEIA 4LSGA 1MKYA 2FGKA 4BFTA 1P2TA 2VLIA 3MG9A 1D9XA 4DKAC 3OAAD 4KVAA 2PLRA 2HIXA 121PA 4C0HA 3FFAA 1PVOA 5JI2E 3NWJA 3K1JA 1SFOH 1P7CA 3QEJA 4IFDI 2OUKA 4C0JA 3U50C 4JBJA 4Q9KA 1VYTA 4UXJA 4JSYA 4B3CA 3ERSX 3GTJH 1V8QA 5C0XG 4AYBE 1JI0A 2JEAI 3Q8DA 3M4OH 2QA5A 3AVQA 4MKGA 4B43A 2Z6KC 5IP7G 5DO9A 3T5GA 4DV5L 5JEEA 1YU9A 3FMFA 2G1JA 2ORWA 4KO8A 3W5IA 2ZEJA 2O8DB 5HKKD 1G17A 1Q1BA 1YZTA 2R9VA 2V7QA 1DOAA 1WCMG 4ZDKA 5B30A 3SI7A 3KJGA 5F98A 3K0FB 3GEEA 1XJVA 2F3TA 4GP6A 3EPJA 2N8NA 1JNYA 1VPLA 3HR8A 4FXPA 1YJ9A 1DAHA 2BE5D 2NG1A 1UAAA 4A75A 1KD1C 4Q4HA 4A3CH 1US8A 1SVOA 5LMNQ 2W2VA 4B3XA 3LAWA 1KIMA 4P32A 1KI7A 4MKFA 2JLWA 2MFIA 5SZKB 2OFOA 5F3WB 3LW7A 4ESHA 1NRJB 1NTGA 3RC8A 4EFMA 5DYIA 1K8OA 2KBEA 3HGBA 4A3GG 1M2OB 1VQLA 2IYQA 3A37A 5FL7A 1ESMA 1W7AA 2W6ID 4RCZA 5CDFA 4OX9L 3W6NA 1XB2A 4MGIR 3RS7A 1BKDR 3HU2A 1K8AC 4ARZB 3VR3A 4JLNA 5E7MA 3HU1A 5FTLA 1HZAA 1P61B 3CQZH 2YTYA 3VDYA 2DWPA 3BE4A 2IYZA 1K5GA 4Q02A 1IBRA 1C7YA 3BJUA 2WSSD 4MRVA 2W6IA 2BBOA 3MRSA 4DKXA 4GOPA 1N8RC 2FEOA 5BXQC 4DV4L 3T06B 2CWPA 1QDEA 4LJZC 2HCBA 1K9MC 4QFMA 5L3QB 2Q2TA 1XEFA 5K8TA 3CC4A 2CE2X 2IUSA 4TL9A 2ZVPX 5IK2D 4V02A 4RD4A 4KN4C 4HAZA 5EP4A 1W1WA 2WWXA 1ZW6A 5LB4A 1EYGA 1N6PA 4ZI3A 1JECA 2WIAA 5IYDG 4Y52H 4CRWB 2OCBA 3GLIE 4CGZA 1QZXA 1RC8A 4A3IH 1EX6A 4OWWB 1JR3E 2PMDA 1IN5A 2QY9A 621PA 3CR7A 2ERXA 2YVUA 1M74A 1GNRA 3VX4A 4BZPA 3D6TB 1Z3IX 4AKIA 1KI2A 2ZTDA 4R1JA 4POGA 4OL0A 3GLGE 4HIMA 2UZ3A 1J70A 3BORA 3NEJA 2PPBC 3R8CA 1NJIC 2C9OA 4DV1Q 3CCEA 3WNBA 3Q8XB 1CJUC 1CLUA 2VY3A 4OKSA 3QIAA 2RAPA 1G6PA 2WOJA 3GJ5A 3I92A 4HI0E 2G77B 3GFTA 1VIYA 5IE8A 1WB9A 3B13B 1Z6HA 4IOAA 4V0OA 4D80A 3GTOH 1VDZA 4IFDH 1Y1WG 4IPHA 1CR4A 2FG5A 2WJYA 3NDBB 1V1QA 2ZTSA 2F1IA 2XXAB 2X1VA 4AYWA 4DR4Q 1W44A 1MKHA 2DUDA 3FKIH 1G19A 2HV8A 3VA7A 1IN4A 5FLMH 3SBDA 1ETUA 3CXCA 2ZU0C 2OILA 1KC8C 3PR1A 3ZZTA 4CEIB 5JJKA 4AYBG 4YC7A 4DEYA 1KI9A 3THWB 1M7BA 4DR7Q 3BFXA 2O5IC 1E0AA 4LFAQ 4JI0Q 3PXGA 4EFLA 1W2GA 3NHAA 3EXAA 3UDGA 3MXUA 4JC0A 1VQ7A 5JEAH 3EZFA 4MYHA 1DARA 2JJ1A 1GUNA 3HKZG 4X8LA 1FL9A 2FH5B 3U3RA 3X1YA 2JLYA 4LW1A 2DNCA 3ND9A 2OG2A 2ZRAA 3AH8A 3NBXX 4TQAA 3HOZH 4BEJA 2P6UA 3WMEA 5E7NA 2ZM6L 2PEZA 4WZ6A 2ONJA 4NZYA 3U60B 4YWLA 5B57C 4OQLA 1QVGA 2ZJPA 3LQQA 3L0SA 2J5XA 3DOEA 3IIMA 1Z83A 1GZSA 4YLGA 1EGAA 1OJLA 1XJQA 1E2NA 5TMPA 4LF6L 2NPIA 4UNPA 4QXAA 2QENA 2ORVA 5J4YA 2HT6A 2YHSA 3GLGB 4TYYA 1TADA 1NVXQ 3CX6A 2BKEA 3QXCA 2A5DA 2NN6G 4UNNA 1O87A 5IK2A 2J41A 4YHHQ 1IW7C 1QUQA 5JZVA 1FPMA 1QHNA 2A5YB 1RJ9B 2DY1A 1CTMA 1PYBA 2ZJ2A 5HE8A 2AFIE 4O3MA 4GOXA 4IJMA 4R71A 3L7ZC 1NI3A 4BFXA 2IL1A 1EFRD 3G71A 1SE8A 1BH2A 4HLQB 4JSTA 1FJGQ 1NY5A 1XP8A 2W2XA 2ZROA 2ZU6A 1FGUA 4BA1I 2LXJA 2J46A 4BY1G 1SVKA 4Q7LA 1D2EA 5CJPA 1N2CE 1YE8A 2V54A 4L5BA 4Q1EA 5IF9A 3U7FB 4KU4A 4OI1A 3MWJA 4HDOB 2CL0X 4OHYA 4OHVA 5FPTA 4B6FA 2A68C 1IYUA 3CBQA 1UPTA 3R9IA 1RE0A 3EARA 3ZZUA 2DB3A 1PYSB 2F6RA 2XOKD 3QKTA 2RHMA 3TVTA 3SZRA 3BRWD 1RYHA 2GVZC 1PA6A 5FPKA 2IS2A 4KKUA 2MO1A 2BMDA 2OHFA 3U9SA 2G9NA 3TNFA 4DDWA 3B78A 5LDDC 3CCUA 1PMRA 3F1ZA 2WKRA 4XSHA 3D8BA 1UJ2A 2UXDQ 1EWIA 4DUYL 3TRFA 2FPKA 2FV8A 2QRNA 3DOFA 3LY5A 3BFKA 2D3WA 3NVAA 2QA4A 1TF2A 4JG2A 1DVRA 2V3CC 2CKZB 2R6CA 4JI7Q 3FGNA 3K70B 3KDSE 2ZJBA 4PHGA 3LNCA 1Y1VG 2NMVA 4JS0A 2GK6A 1HZCA 4DB2A 1CJVC 2QG6A 2D2CC 1WYDA 5DI9A 4B3BA 4ZCIA 1XEXA 5J4KA 4DAYB 4BY7G 2GXQA 3L43A 1Z8FA 2RF4A 4V0LA 3KJOA 2FU5C 3EPHA 3PUVA 4B32A 3CC2A 2J9RA 2B8WA 4RCYA 1W36D 3EASA 3QPUA 4XJXA 1PUIA 1Y8NB 4A8JB 2QAJA 5DGXA 1F2TB 5CB8A 2A2ZA 2J45A 2GBLC 3Q9LA 1KIXA 2DNEA 5FTJA 1I94L 1L4UA 3GJ7A 1N6NA 3LFUA 4BLTA 3SYLA 1ZU5A 3WHKA 1M34E 4LFCQ 3RR5A 1BOFA 1Z6GA 2HDNB 3BIFA 5E4FA 1K6MA 1DAEA 3GD7A 4EJSC 3SGIA 1TUIA 4QHTA 3GLFB 3THXA 4LRWA 1J5EQ 4UY8C 2QP9X 2JGNA 2B8FA 1W4RA 4JYAQ 3K09C 3QF4A 3S15H 2JA5G 2ORIA 4IHQA 4WOPA 5A0FA 1GO3E 1OIWA 2W58A 4II7A 3M4QA 2BDTA 3CMAA 1XMQQ 1K73C 2NVXH 2EFCB 2G3YA 3J81i 4Q48A 4AQYQ 4HJ8A 5L3SA 2HT1A 4GKKQ 1KHIA 2F3RA 3LQRA 4I1UA 3I62A 1MJCA 1R0ZA 2VP9A 4PQRA 2A7QA 2XNSA 4Q1DA 3TGPA 3OIYA 4XTCS 4JLJA 4OYHA 3ZJYC 1T8TA 2K50A 2JA8H 2IC5A 2EVBA 4DK6C 3P32A 4NCNA 3ZIAD 4DDVA 2EYUA 1HY3A 5TARA 1HA3A 3HFZB 2YC2C 3AV0B 3ZVMA 2E9SA 4YHHL 3HOYH 3S1MH 1KJWA 1P2VA 4FMCB 2WTUA 2GF9A 4P72A 1KAWA 4ZIRB 1R0XA 4LY6A 3EWSA 4JVMA 4MRSA 5TY0A 4TLBA 2ZSFA 4OO1I 2YINC 4URWR 2ZYWX 1VQ6A 2IWHA 1IY0A 3A8TA 5JS8A 2LXKA 3TIFA 4JL5A 1GWNA 4TYPA 4E03A 3TLXA 3KDFA 2X8AA 3GEIA 4LJAA 1NSFA 4R2HA 2ZJQA 1LTLA 1HPCA 4B3TQ 1E98A 2CHVA 2ZS8A 4HSEA 4P4TA 1P4SA 4IPCA 4AG6A 2ZRJA 1QBKC 4FMCF 5FH9A 1UWVA 4HLCA 5JHHB 3CP0A 1FX0B 3HOWH 1CULC 3FKIG 1ZCBA 2QT0A 4JLDA 1P5ZB 1D8TA 1HJPA 4M9XA 2QTHA 3TBKA 2R6DA 1ZM7A 3WP1B 3KQLA 4Q4AA 1CKMA 3ER0A 1S9DA 3ADKA 2XSZA 1PH4A 3GLHB 4PANA 4TTPA 4DCUA 2ZR7A 4M1TA 6Q21A 3SDZA 3E70C 3OYYA 4JT2A 1E9BA 2ZI4A 1DD2A 1I3QH 4TMTA 4G7OC 1Z47A 1ZUIA 2X2EA 5J40A 2JEBI 1E1RA 4GN3B 3C8UA 1HZ9A 1KYIA 4LJYA 4X66Q 1G7CA 4TKOB 1ZIOA 4HJ9A 1DBSA 1XZQA 2IF2A 3LRPA 4JV5Q 1G8HA 1T5LA 1U99A 1KQSA 1FFHA 4O0AA 4KBFA 4KJZA 3WWVA 4GRAA 1I94Q 4Q4JA 3B1VA 4UPAA 2QZ4A 4PZ7A 3NC1C 2B63H 4XTRA 3PCOB 3UXMA 4EQ6A 5JI3E 5EUQB 5M04A 2PCLA 4A2WA 2C95A 3CZQA 1FL0A 3EX7C 1Z28A 2R6FA 3CNOA 4PAQA 1Z6YA 3RS2A 4TYNA 2JLXA 4JI2L 2NVYH 4A4DA 2CHQA 1J5EL 1C4OA 3PF5A 1IBKQ 2BIFA 2IW3A 4M4SA 1CJMA 1UKEA 4X8OA 3PQCA 5DI3A 1IOZA 5FOTA 2G6BA 3OEED 1EQQA 1N5IA 2MSEB 3HYRA 4MQBA 4P73A 2A78A 4AK9A 3SFVA 2QROA 3FMOB 3L0PA 2O52A 4DCVA 2CVFA 5EE5B 5KOYA 2EJGC 3PUWA 2OTJA 3WRYC 1AA9A 3LX5A 4B35A 5LD2B 1QVRA 3I55A 4K0KQ 1QHSA 2K33A 1S72A 4V03A 1YJNA 4C2TA 4YMWA 3K8YA 1KRTA 5KNCA 4DT1A 4BY1H 1GUAA 2PCFB 4B34A 5LMUL 3C5CA 3KJIA 2XB4A 3ZQ6A 3PUYA 3DHWC 4U02A 3AF0A 3TEHB 1AS2A 2Y8EA 1AJEA 4OK3A 1O7IA 2HHHQ 3CCSA 5FTMA 4LJ7A 4A36A 4TT3D 3SC3A 3EPLA 4ASUD 1UBEA 1KI6A 1T0JB 2B29A 2EQSA 1XWIA 3EAQA 4BECA 2JA6G 3I4LA 1X3FA 5M3FH 4D6PA 1KTVA 2B6HA 4E22A 2VQSA 3AF2A 2PI2E 4IO9A 1I2MA 1NE3A 2E5LL 1XU4A 4LUCA 4QBGB 3HU3A 3U3JA 5LMNW 1E9EA 3H0GH 3CRKC 5C0XJ 3CM0A 3EIHA 3W3ZB 2IT1A 3CRRA 4LF9Q 2E87A 1KJYA 2ES2A 2RH5A 3IHWA 4Q47A 2GRJA 1G8GA 4DV5Q 4F38A 4JJZA 5BW8A 3J81k 4M53A 3LVRE 4JLVA 3DEFA 5JJIA 4LHXA 2BBTA 2C5LA 3CZPA 2WOOA 4I4LA 1YNJC 4IQZA 4TMKA 2NO9A 3F2CA 5LMUQ 4B3ML 1T3LA 1IN7A 1GRNA 2F7SA 5EXSA 2XB2A 3LH5A 4C7OB 3P4YA 1JBKA 2CWAA 4NYJQ 3D4RA 4Q1AA 3CLVA 4G1UC 4MUAA 4IPGA 3H94A 4NXMQ 1F2UA 2EFGA 2KCTA 2YJTD 3MUFA 4P75A 4ALPA 2WBLC 4JLBA 4XD7A 1K8GA 3ZVRA 1YHAA 4CEJA 1XPOA 2GJ9A 1KL9A 1KDOA 1G8YA 1XJCA 2QN6A 2VP6A 1FW6A 2P65A 4DLRA 1A4RA 3AM1A 1LM0A 2OT3B 2FZLA 3NBHB 4WIAA 2JJ8A 1B7YB 3TREA 4QJ5A 5JFGA 2V55B 4QL3A 3RWOA 2AN9A 4A3KH 3GEHA 3CONA 2XX3A 3BD9A 1XTDA 1E6CA 1VQGA 2RHDA 3KTAA 3K53A 1S1CA 3DKVA 3QKRA 2GZAA 2CQOA 3O8DA 5HCNA 4K46A 5FBWB 2AHOB 1E2IA 4NYIQ 3X1XA 3H3VH 5FOVA 1MV5A 1VQDA 4FIDA 1E1TA 4QOSA 5CITA 2CJWA 4D4KA 1EWHA 2WHXA 4X62L 1L4YA 4UP9A 2JAQA 1W4CA 4R9UC 5JJLA 1FQJA 1NY4A 2WKQA 3KQUA 4PMWA 2ZUBA 3BH6A 3QEOA 1G7RA 4Q9IA 4A2PA 3EA0A 2I1QA 2QSYA 2OTLA 4LHYA 4B2LA 4LJ5A 5M3MH 1OTCA 1NIPA 2K5UA 3VFDA 2IA5A 1X1SA 2YOFA 1O7LA 1X6OA 5EE3A 5DH9A 2WWYA 2YKGA 421PA 3QSYA 8OHMA 4C3HH 1SMYC 4IFDJ 2Q9CA 4LYJA 4JI6L 4BQSA 1UKYA 3CKLA 3PO3G 3S1QH 1KY2A 2HXYA 4JLPA 1NMYA 1J99A 3AVOA 1JR3D 3AF1A 3FKQA 3C41J 1S3OA 1AKEA 1TU3A 2QTVB 3LA6A 4H9GA 2GVAA 1G8FA 4M1SA 3WP0A 4APVA 4FCWA 2C98A 4LUVA 2PEYA 2WM9B 1GL7A 4ZDWA 1N34Q 2K5HA 2GHIA 2IX1A 1N33L 5JCZA 4GSYA 3EZ7A 3CPEA 5JEDA 4PZ8A 3IO3A 2O8BB 2PMZE 1IJEA 3RLFA 2QI9C 3T15A 3K9LA 3UE1A 2XTNA 3OEEA 1OV4A 2GJ8A 4QHYA 1M90C 2E76C 3GQBA 4DV1L 3KFUA 4G5SA 4GOPB 1R9TH 3KXLA 3L8ZA 3LBNA 1LW7A 4QBIA 4LYAA 4D0GA 1G64A 1Q20A 3Q5DA 1AIPA 4NYMQ 4TQUS 3R9WA 1KHTA 4LF4Q 3QBVA 4MRNA 4EPWA 4ZV4A 3GJXC 5FPSA 1KAOA 1SXJD 2WWFA 2GKSA 1LB1B 3PSIA 1LUZA 1XNQQ 1ZUHA 3RNUA 1VYVA 3QJYA 1BO6A 2NO6A 1BVSA 4Q03A 4C4PA 1CSQA 1YJWA 3PUZA 2X2FA 3ADCA 2VQEL 1XEWY 2A9KA 2JATA 2GBLA 2F9MA 2P6NA 2A6HC 2QBYB 3STBD 1NBME 5KNDA 1D8LA 3PV0A 1CBUA 1QF9A 4AI6A 1YRBA 3NHBA 3W6OA 3NG1A 3NH9A 1OF1A 5EAYA 1UF9A 1IN6A 2WJIA 2VP0A 2RCNA 3O8CA 2QMEA 4IFEA 4U5XA 4A3FG 4NB3A 1DCZA 3U4QB 3E2IA 4DJTA 1DXMA 2VF8A 1P3JA 2GDJA 2O8EA 1YVCA 4HLUC 2XZLA 3HPQA 5F9FA 2KA7A 4N0EA 2ZXUA 3T1YQ 2C9CA 2QSZA 3C4JA 4B44A 2UKDA 4JI8Q 2K4KA 2WSMA 2N49A 2BA1A 1FUUA 5SZHB 3X1WA 2J0QA 2GEVA 5JECA 1E2QA 1QHHA 4QG7A 4H02A 2V9PA 2YNMA 4HEJA 4PHHA 3EA5A 1XNJA 3MAAC 2IYWA 4AC9A 1GITA 4KFRA 1W49A 3QKSA 3ULJA 2ZS7A 3PFIA 1KMQA 2L5TA 1YEZA 1XXHE 2OAP1 4O0MA 4A2QA 4BASA 4DK3C 2A1AA 2ASEA 1HNXL 1PH3A 2FEMA 2PMKA 1E2KA 1RKBA 1I4TD 1K5DA 1P9WA 2FSGA 3BDOA 1X3SA 4B2IA 3ND8A 1E2JA 2PZEA 5FBQB 2OFXA 1SROA 5FPYA 2IX3A 1G4UR 2QGZA 1H9SA 3RN5A 3MCAA 5LBIA 1ANKA 1UKZA 2E5LQ 2DR3A 3STBC 2J1LA 1Q86C 4JI6Q 2HEIA 3DO6A 4RMFA 3MWYW 1F48A 1Q57A 3H1TA 5M3FG 3RS3A 3CF5A 1CSPA 2LMCB 1TNDA 1YVDA 1ZM9A 2MSCB 4NP6A 2IXEA 2ZRBA 2GZHA 4GZMA 1YQTA 1PH6A 2OV2A 4L5RC 1YZGA 1VTKA 2E74C 4UNRA 1H9KA 2JJ2D 1FNMA 3PIRA 1N0VC 4CIDA 1D6JA 3B6YA 5CYOA 4F93B 2F55A 1E96A 2A6HD 3WXMA 2Q2IA 1PZNA 1EFUA 3GJ6A 3CR8A 1E2WA 2AWNA 1HNXQ 1QHGA 5K36G 3K0CC 3N2IA 2OBLA 3MLEA 4JKYA 1EWQA 1MOZA 1SVWA 1UFQA 4W9MC 4N3NA 4PHTA 1NBMA 4I1VA 1QUQB 3IKJA 1E1QA 2RGNA 3VKWA 3NBYC 2P2LA 1H8HA 4IDQA 1HNZL 3WNDA 4ZDIA 2REBA 3VU9A 5CK4A 1E79D 5GADC 2BMFA 3B1XA 3EWAA 1JPJA 4RFSA 4W5WA 2D2FA 4BBSH 5B64A 2Q3FA 2V1XA 3QPWA 1NKTA 3B1YA 2ZRDA 4B3RQ 3AP2A 4DCSA 1R8QA 1HYQA 4RD3A 4OQMA 3CNNA 1TU4A 2OM2A 2P6RA 2QU8A 1Z9FA 2ZAOA 2R93H 3J80c 4HIKA 2LKCA 1FUKA 3U44A 3K0EA 1W46A 3GTMH 2LWIA 1XNRL 4TLDA 3EG5A 4BPBA 4ASUA 3ETLA 2MMGA 4JOIC 2ZRKA 1R5BA 1A82A 1TXYA 4FWIB 2JASA 3P4XA 4U00A 3GFPA 3QXJA 3ZVNA 3OEHD 3GLIB 3NXSA 4GNXA 2QT1A 4O2DA 1HE1C 1AGRA 4R98A 2VHTA 1EFHA 1NJFA 5IYCG 3IBGA 5M3MG 1G3MA 2AK2A 2FZ4A 2ZSAA 4DUGA 1RZ3A 1NN1A 2R6AA 3PEUA 4RKFA 5FTNA 3E9HA 1RVDA 3E0EA 1DO2A 4DR1L 4A0FA 2ZTEA 5JSZB 1VQOA 3RDPA 1LF0A 2A30A 3G5UA 1S40A 4P0TA 4CW7A 3UK6A 3O8RA 2PJRA 1DEKA 4H1VA 2FE4A 2IHFA 2W0MA 1LACA 1JJGA 1VQCA 1U9IC 4BGDA 1XEXB 4M9QA 2DFKB 3OZXA 4Q5IA 3SJZA 3H4MA 3THYB 2BMEA 4UXHA 4B73A 2L0XA 2C2HA 4QIWE 4LF8L 3U4VA 4NKRA 1BBUA 1KAGA 2HJVA 1E69A 2VIIA 3VHLB 1GHJA 3WYAA 4A8JA 2BCJQ 4G3XA 4RJLA 2OZEA 4B3FX 2YOHA 1HQYE 4B71A 2PX0A 4KODA 1E2ZA 4GBMA 3RHFA 4OHZA 2F52A 4PQYA 1N36Q 1NLYA 1PH8A 1DAIA 1Z0JA 5AK0A 5IRCD 1OXUA 4RD6A 2IS1A 3B1ZA 1PH2A 4BRUA 5GAGC 1HH4A 3VTKA 4MRRA 2D7DA 2GILA 1L2FA 4L5TA 2ZJRA 1IHUA 3T51B 2A5GA 3NEYA 4OQXA 1T0HB 2Z6VA 1UE5A 2K52A 4HB2A 4P71A 1XZPA 2ZREA 1RRCA 1QHXA 4A0HA 4OHWA 3TUZC 1WBDA 1CKOA 3PUXA 2JEOA 2J87A 1S3SA 1VQ5A 1WBBA 1E24A 1GG2A 3EZ2A 4IFDG 3P1JA 2XTMA 1CRQA 4Q7MB 5CLLA 1WA5A 4OI4A 5EP3A 4XWOA 4LHZA 5C0XI 3U3OA 1E79A 1IAQA 2WAXA 3CRW1 2JJ1D 5FR1A 2HHHL 2WB1G 3WBJA 5J4HA 4PC6A 3KXKA 4XH9B 3BWDD 1QVCA 2JA7H 3K7UC 3W5JA 3B85A 1NNEA 2P5TB 1Z2AA 3TS0A 3KL4A 4L8JA 2Q0HA 5EZ6B 1S1MA 3SN6A 4Q9LA 3W6PA 1W3SA 1KZGB 1XF9A 1R8SA 4X65Q 3FE2A 5L3RA 5FTKA 3TS2A 4O2RA 3L2PA 1SGWA 1IBMQ 3TQYA 4MGKR 3IQWA 1G8PA 3U7HB 1FR3A 1GKHA 3DZDA 4NYIR 4OX9Q 1CR0A 3RANA 3ONWA 1VG0B 2K14A 2XITA 3AUXA 3LXXA 4DV6Q 1M8PA 4AH6A 1FQKA 1GVPA 3QPVA 5BR8L 1JEEA 3TR0A 1W4AA 2OCPA 3R8FA 5ELOA 1MJEA 1Q7YC 1XXHA 4YCVA 1L1OA 1OIVA 1Z2CA 5L8VA 1CJTC 2UXBL 3GTPH 5CM9C 1AE3A 2B7CA 3BB4A 4WW0A 4DHEA 2HLDA 3AFPA 1XBTA 2E2HH 1TEVA 3TW4A 4DV7L 1M6NA 2Q6TA 2K75A 1NN3A 5LB2A 3SFZA 5FFMA 1ZKOA 4GKJL 3R7WA 5J4VA 1AZSC 1KY3A 3WBKA 5C1BA 4EKDA 1FMJA 1D9ZA 3JC66 3E1SA 4PZLA 2C03A 5HTKA 5SZIA 2HLDD 3ZDQA 3T5DA 4QKQA 3A6PC 3A8JE 3W1BA 4KFTA 4TMXA 1YIJA 1OH5A 4OWXB 4KBGA 2VEDA 1SVSA 4BA2I 2ZUDA 4G7HC 3RZOH 1IBLL 5M5XH 1G18A 3T1HQ 2J0UA 1JJVA 4TVAB 2Q9AA 3TE6A 3GTKH 3M1IA 1FYCA 2UUAQ 1O78A 1M7HA 1Y8PB 1E2MA 1U98A 2BEJA 1A2KC 5H1YA 2NPFA 3VX3A 4A76A 3CNLA 1DELA 1XEWX 1C1YA 4L5QA 4X6AH 3FYHA 3MJHA 2O8FA 4B75A 2IYLD 2K5NA 4DR5L 4R4TA 4A3BH 1PH9A 1N32L 2JA8G 5H1SE 3K0AB 1G20E 1HURA 3ZS9A 1YR7A 1U0JA 2QL6A 3TSWA 4NPSA 4DCNA 1IXRC 3FOZA 4KLZA 2I0QA 4OHXA 3BZCA 3M9BA 5FLMG 3NE5B 2DBYA 4QY7A 1VQHA 2QGNA 5DISB 5SZJA 3TH5A 3KF8B 2VBCA 4EFNA 2WWGA 3REFA 5JWOA 3KQNA 1DADA 3UDXA 1RJ9A 3IEVA 1E2GA 2NO0A 1OE0A 2JXMB 2YTVA 2QMHA 2JQOA 2O8DA 3B7GA 3GCGA 1VHTA 4PC3A 4RZ2A 4IEIA 4IOKA 2B21A 4M0LA 4ZKEA 1A6XA 1E0JA 3KKMA 5CLQA 1AN0A 4EJSB 2FPLA 2QMUA 4JT4A 1G21E 3FPPA 4JI5L 5KPDA 1K83H 2QEXA 2ZETA 4JI1L 2ZJYA 3KF6A 1N6KA 1Z6XA 4A3MG 2VSXA 1UADA 3I4NH 3KKPA 5AUNB 5C2JB 2MMCA 4DLZA 3ASYA 4URXR 3U44B 1U90A 3PENA 3H86A 2ZSEA 3JZMA 4JBMA 5D3MA 1S96A 2O0JA 4HJ7A 1EESA 2PI2A 4KN7C 5IP9H 4EPVA 5GQOA 1KK0A 1S8FA 2JA1A 1ZD9A 3CH5A 2FX3A 4NCJA 2XTZA 1AM4D 2RMKA 5H68A 3SS8A 4TT3A 2OWOA 3K0FA 3SQWA 3AEVA 5BN3A 2W6JA 1N32Q 4DR5Q 3F5FA 2K7VA 1KK2A 3A0JA 5GROA 3RRMA 2CEAA 2I1VB 5HY6A 3OFND 4HZUB 2CE7A 4QGFA 2ZE8A 1W0KD 1YZKA 4TQ9A 1US8B 4A6PA 5K8LA 4FMDB 3H84A 1N6LA 1OW3B 3DVLA 2YOGA 3PO2G 3R20A 1F2UB 2VA8A 2VYFA 2ALYB 1X56A 1PJRA 1ZCAA 1MRSA 1TWHH 2RGEA 5EE1A 3D3QA 4CEJB 2XGTA 1PLLA 1JQJC 4C3JH 3M0EA 2IYRA 4TYWA 1CR1A 1M7GA 1GJXA 1WI5A 5DLQC 1NJGA 3B8HA 4W7SA 2QAGB 1G5PA 1EFWA 2GA8A 4PSVA 1DAKA 1ELOA 4B3DA 4E5UA 2YWEA 3LVQE 5FUWA 1EG7A 4TTQA 4YY3Q 2C9YA 2ANBA 3TSZA 2ZR9A 4DV7Q 1YZQA 1XD2A 3J81j 3A1WA 4ARZA 2NN6I 2HIVA 5KTYA 1U0LA 4L9SA 2QM7A 1B23P 2CFMA 2KSQA 4HB3A 5ANRB 1QZGA 3PF4A 1QVAA 4S2EA 3VAAA 4X65L 2Z4RA 2NIPA 4Q00A 5TB5A 4MNOA 2FFHA 4KXFB 3U7EB 2FOLA 2EDGA 2CCGA 2VHUA 1N3BA 2O8CB 1KZ7B 1P75A 1ZUNB 4GOJA 3NENA 2ZSDA 3IPXA 2ZITA 1Y69U 3Q85A 4Q9JA 3RWMB 1R7RA 4G5QA 1V5WA 2VHCA 2BHRA 1I4DD 1LFDB 4LOAA 1JR3A 5FBRB 3T1TA 3PO2H 4ZKDA 2EVWX 4M1OA 2AX4A 3T1VA 1OXXK 2GEDA 2LSSA 3IHLA 3QG5A 1KDPA 1SQ5A 4DZZA 2EW1A 3RRYA 3I32A 4HDCA 4EPTA 2WAQG 2AUKA 4D26A 1ZP6A 1ZNWA 2Q21A 1F3OA 2ZM5A 4GLAC 2QPAA 4IOLA 4QQBX 1EFCA 3OFNA 2AWOA 1XCPA 5CJ2A 2ZRIA 3SJCA 3KYHC 1NBWA 4P33A 2VQEQ 2N46A 3ZVLA 2AXNA 1LVGA 2ZI6A 4C0QC 1Z0DA 1H9MA 3GTGH 2WWWA 1G3RA 2CL6X 1XPRA 3A7AB 2CLSA 1SXJA 2GETA 3W8RA 3ECCA 3EC2A 3P27A 1K8MA 4PG3A 2JA7G 2B7BA 1SN8A 5JHGB 2PT7A 3IILA 2X77A 4HLDA 3NBZC 3TW8B 3AVPA 4N0DA 1Q1EA 4ZI2A 2OQKA 1GRQA 3UATA 3ZH9B 4P74A 4GOKA 1X55A 4KHPL 2V6JA 2LCFA 3KKOA 1T91A 4KAXA 3H2YA 5BR8Q 1AGPA 2ZS9A 3KDFB 4F4IA 1N9WA 3T1YL 2ZIAA 4JYBA 4RY2A 3ZIAA 1W5SA 1Z22A 3I7FA 5DSZA 2G0NA 5DE3A 1WQ1R 3G4SA 1CUKA 1QZHA 2XXAA 2CK3A 2D5DA 2K32A 1SVMA 2Z83A 3S24A 3PG5A 2ERYA 4PV1C 4Z8XA 1MH1A 1AKYA 4BUJA 4DR1Q 1AH9A 1FOEB 3WMGA 1N25A 1Y3AA 2DFTA 3T53B 4A3KG 4CEIA 3C15C 4IXMA 3ULLA 2PQAB 1NIJA 3WY9A 5JEAG 4I81A 4LFAL 1UDXA 1S4QA 2QBYA 1NVVQ 2IX0A 3GDEA 2E2IH 3GTQH 4UJ3A 4HIOA 5KPJA 2KBFA 4PO8A 1VQKA 1N5KA 1GKIA 1QG4A 1X65A 3GFOA 1BDOA 4C2MH 4FINA 4Q18A 2ZAMA 5AJWA 3TQFA 5AUOB 3L0OA 3I72A 1Z08A 4AYTA 2GF0A 4EDHA 2G88A 1GRRA 3UE0A 1YR8A 3IDQA 4QJFA 1OIXA 3T35A 3UDIA 4Q4JB 3V4FA 3S1AB 3I8XA 2R7ZG 1NN5A 4B33A 2EFDB 2FMXA 2V7QD 4RCNA 3N2EA 1TTTA 4HUQA 1WJJA 3A5UA 1WFQA 1MR3F 4V0ME 4KLNA 3U2QA 2ZRNA 4NDZA 5GADl 3DPUA 3K09A 3T1OA 1DE0A 4UP8A 1JXMA 3FHTA 1E1OA 4GN4B 1HNWQ 3BOSA 3Q3JB 4A3DG 1M1YE 2GCOA 3KLWA 4YDSA 2DFNA 3CH4B 4QNMA 5IT9c 2IWRA 4EPRA 3BGWA 4DLYA 3L2OB 1KXLA 2A6ED 1KO5A 2ZRPA 4PFSA 2IYUA 3MJRA 4LDJA 3ZJYA 3PO3H 2E2JH 5CB6A 1UEJA 1MO4A 5AJ3L 3CF2A 3DMDA 4TWZA 3RSOA 1YR9A 3KOJA 4B47A 1WRBA 3N5CA 2P3SA 5CIQA 1KK1A 3I4MG 2F43B 5DIFA 2WWIA 4MGZR 3K0SA 1RIFA 3LLUA 4DSNA 3GLFE 5DHAA 4OO1G 3VMFA 2OBMA 3FB4A 2CL7X 3NEMA 2ZANA 1YBYA 1E2HA 3DLLA 3B82A 4DK1A 4KV9A 3MGCA 3W3AA 4D2IA 4A3MH 1PLJA 3IFTA 1E2DA 3FMCA 1ZNYA 4CVNA 4B76A 1JMCA 4JJKA 4DLUA 5HGQA 4PSAA 5JS7A 1BYIA 1NLFA 2MO0A 4MITA 1NY6A 3UANA 3PEYA 1SLJA 4DVGA 2Q2UA 2PJZA 2ZI3A 3AP3A 3CIOA 5KSOA 3K80C 3I5XA 5CDFE 4Y7NH 2BH2A 4LFBQ 4ZDJA 3T1HL 5EP1A 1YZNA 2R92G 1R4AA 4MZ9A 4X8HA 4I1SA 4LF9L 2VQFL 1A5TA 1GVNB 1Q12A 2EWVA 4BBRH 4DUYQ 4NE2A 1E2FA 4L16A 1Y14B 3PGZA 3I4MH 2NZJA 3BERA 3W90A 1I4LD 1OXVA 4Z1MA 3ZQJA 3RAPR 2H1LA 3AEZA 5IYBH 2FDCA 4M22A 2CCZA 4JLKA 1LV7A 5BN5A 4RD0A 1KMHA 3TUJC 5KSYA 4IOJA 2XGJA 4TSFD 5CM8B 3U7GA 4B3RL 1N5JA 2BDOA 1XCGB 2ZR0A 1VS0A 1PH7A 4M1YA 4BFWA 3HKSA 4P4SA 2XZOA 1HH2P 3FKSA 1E7ZA 3A58B 4OQNA 4BWYA 1GUGA 4GOPC 4DR2Q 2A19A 1YHNA 4NONA 3KB1A 2PZFA 2ONKA 4IDOA 1FJGL 4RVCA 3F3YA 4NXNL 4MYTA 5EXTA 4M9ZA 3IIJA 4YXWA 4B3MQ 3CUEF 1E0SA 1CKNB 1UEBA 2R92H 5CIWA 2ZRFA 2WV9A 4QGUA 4NCHA 2VNUD 1G41A 1GAJA 5AJYA 3DXJC 2Y0SG 1Q82C 4KHZA 1HT2E 4XVUA 4FWTA 4RZUA 3THXB 3UIEA 4E07A 1IZ6A 4MTNA 4JI2Q 2BMJA 4TL7A 2B92A 5FI1B 3TVDA 3AVTA 5LD2C 2OBNA 2ZJ8A 3QENA 2I5MX 2FNAA 1AK2A 5AWFC 1KI3A 3CCLA 5C4XH 5A4JA 1Z06A 2ECKA 2KWIA 2VTKA 2B63G 1H9JA 1I5FA 4A4IA 1DAFA 4M21A 1IYVA 1IYJB 2R7ZH 3EN2A 1II0A 1KOFA 2IHEA 1YNXA 2R62A 4LJ8A 4TMZA 4Z1MD 5E95A 4LF4L 2D7CA 1KKLA 3E9IA 1FVIA 2O0HA 2V6IA 4PC2A 4ZCLA 1JAIA 3O8BA 5UKDA 2JLRA 2AL7A 4CT4B 5JRJA 5C18A 4YQFA 4A93H 4NHOA 3K70D 2E75C 4H44C 4JI0L 1B0UA 5TXGA 1YHBA 1I6VC 3CPJB 1NF3A 3GMTA 3A1SA 4TSFA 2F9LA 3RNLA 4WXPA 3KJPA 1N33Q 2N3SA 221PA 2A3RA 3UKDA 5K36H 2C96A 1VCNA 2Q9BA 3RLOA 2R8RA 5GAHC 2QP4A 3AB3A 2GCNA 3GJ4A 4LCBA 1G7TA 4DR4L 1LS6A 4Q1BA 2QGQA 3VR4A 3K7AH 1E9DA 1YZLA 4PZZA 4B2PA 1VQJA 5AUQA 1JQLB 2O8BA 5FOWA 1P6XA 2OO7A 1FMLA 4QRHA 4BLQA 2BWJA 2W0SA 2Z6KA 3OW2A 3KJEA 3VR5A 4AKGA 1R10A 3VHXA 3S1RH 1JB7A 2F1HA 5E7JA 3LW8A 5EJEA 1VF5C 1FX0A 4MGYR 2CW0C 1N34L 1VQFA 2JA6H 1N0WA 4IDPA 4IXNA 1C0AA 2ODBA 4IOCA 1OYYA 5B2ZA 2REOA 3ICQB 5C3EG 1OKKA 1GL9B 3AGQA 4Q4AB 1TEXA 4PO1A 5LPNA 4RZ3A 1C9OA 4A3IG 4HAXA 1ZRHA 2BCGY 5HPYB 1CI3M 1X54A 1COWA 1PV4A 2BKUA 1JB1A 1G1MA 1ZVQA 2IYYA 1KJZA 1SR3A 2KJQA 1S0UA 1KDTA 4TL8A 1WXQA 1EIFA 2ZRMA 1NMGA 1OB5A 1OKKD 3L82B 1XX6A 2XJ4A 4KYIB 4DR7L 3KJHA 2WAQE 1U8ZA 3HP1A 3HOVG 2H5XA 4GS3A 2IEZA 1X8JA 4D0NA 2O5JC 3H0KA 4BFZA 3KKQA 4F92B 4URYR 4OK5A 4FMBB 1K3RA 1A0IA 1DG1G 3IGFA 1UBCA 3SJBA 2R65A 3CAMA 2HXSA 3LBIA 1TL7C 4LYFA 1GUTA 3VNVA 3J81c 5FL7D 1LTQA 5HZHA 1J7KA 1KKMA 4UJ5A 2QAGC 3EPKA 1XMVA 3BG3A 4Q1CA 1SHKA 2GAAA 1MO3A 2NOAA 1X8LA 4D4MA 4EIWA 1TWFH 4FCVA 2WMNB 4FMDF 4UP7A 2GJSA 3FTQA 3JVUA 3VR6A 3LBHA 4HAVA 1GKUB 1QHHB 4NYMR 5C46F 1D5CA 1XXHB 3SEAA 1P73A 4CEHA 1L1OB 2CCKA 1VQNA 3UWKA 2BEKA 3QE0A 5EXPA 4HB0A 3T1QA 4BLOA 4K8OA 4LBVA 4MH0R 1SKQA 1TQ2A 2CNWA 2EFHB 4DK0A 1NVUQ 4LZZA 2V1UA 1GNPA 3I56A 5DNYB 4UNSA 3ICEA 4B48A 3DM5A 2KENA 3U4ZA 3IRBA 1OH7A 1BYUA 3LGJA 2EJFC 3TRZA 4JKIA 4DR2L 4DLTA 3CF6R 2JLQA 4IKEA 2X19A 2I5HA 3OTOL 3K8AA 2DWQA 4HB4A 1CKEA 5J3BA 2R7DA 2VSFA 4XWKA 1H8ED 2GJAA 2YWHA 4Q9HA 4A3LG 4JMPA 3SHWA 1NG9A 3D31A 4AURA 4R2IA 1SXJE 3PCRB 2VL6A 3J80i 2VW9A 1W47A 1VF7A 4KFSA 1L8QA 3WMFA 1N6OA 3CCJA 1YNNC 1Z0AA 4D4JA 5DHFA 1B9MA 4JV5L 2BBSA 5IYDH 1U81A 4LWZA 2PL3A 3OW7A 4URVR 5ELNA 1OFUX 5K8UA 1GM5A 1WCMH 2ASBA 1CS4C 4XVQA 3S17H 3FP9A 4HYYA 1GHKA 4YCUA 3ZD6A 4YWKA 3A4NA 2GNOA 3IPYA 1E32A 5GJWC 1JPNA 4PPFA 3AQQA 3CPWA 2NO1A 3CRQA 4JI4Q 2AK3A 3OE7D 5JEAJ 4LUOA 2Z0MA 4NTZA 1ONBA 4Q7KA 4ZCMA 2UXBQ 4KKSA 1RW4A 1WDTA 2XSZD 1UE7A 1IY2A 4ABYA 1ODFA 4WJ3M 4AY2A 4ZPXA 2VPPA 4I1OA 1NVWQ 4HAUA 2REXB 1WF3A 3X2SA 1TF7A 1U5KA 4TN1A 4US1R 4ILEA 1AS0A 3DDCA 2F4VQ 1B70B 1W0JA 1F2TA 2KHJA 4QC2A 3HPRA 5FBVB 1J8MF 3RABA 2QF7A 3AB9A 2CXXA 1IBML 2ODWA 4EPXA 2F3IA 4PPNA 1U94A 5K8IA 4DUGD 3IIKA 1JJCB 2V4DA 4LJ6A 3FHCB 2AHOA 4YY3L 1MABB 2OXCA 2Q2HA 1R5OA 4LWCA 1WE2A 2UXDL 4J0QA 4LYHA 4QNRA 3SE0A 5FOUA 4MKHA 3NH6A 2IYVA 5JBQA 5KSZA 4JLAA 1Q21A 4V0MA 3DM9B 4QBFA 4RD1A 1ASYA 5DN6A 4A6XA 1P9RA 2RHQB 2FWRA 1XTSA 2IXGA 4EQ5A 2ODEA 4G01B 5L3SB 5EP2A 4IRUB 2PNHA 2A69D 1KO8A 4Z54A 2V8OA 1SMXA 4AQYL 1D2MA 4G5GA 3PIOA 2DWOA 2NGRA 3C14C 4ESVA 3AKDA 1OHHA 2UXCQ 2CLDX 1KRSA 3TR5A 1VG8A 5FPHA 3HOXG 2IS6A 4HZIA 1PLKA 3VR2A 1EUJA 4JI5Q 3NKVA 1X9NA 4A82A 4A3BG 2W2TA 4IEEA 2YWGA 2WJGA 4HAYA 1R2QA 3U6KA 4LPKA 1TUEA 1Z0IA 2J0SA 2WB1E 5HE9A 3I1FA 4AIIA 3HOUH 4DLWA 2EFEB 3U58A 2OQ0A 3VNUA 3HWSA 4MYUA 4KLKA 4LX0A 1P60A 4JCVE 1S3GA 2QE7D 4OJQA 3L0IB 2HUPA 1L2TA 4LC0A 1EOVA 2ODNA 3QF7A 5KUTA 3JAMi 4DCTA 4LF6Q 1HTPA 4W5HA 4CZ2A 1KI4A 4ZIRA 1N0UA 3EQLC 4DDUA 1OSNA 1TWGH 1NL3A 4ME3A 2QQ0A 5FUXA 4MUBA 2IYSA 2ZI5A 3A1TA 4X64L 1E9FA 1PH1A 3BS4A 2EQBA 1G3IA 2E8GA 4EPYA 2VP5A 2UUBQ 3SHFA 1OH6A 2H92A 4PZYA 1D7QA 1EWRA 4R4IA 1S2MA 2XZPA 3GLHA 4A3LH 2GN5A 1TQDA 3RRZA 3G6EA 4TL6A 2GXUA 1KK3A 2UUCL 1ZBDA 2QTFA 3FWYA 5IHPA 4KYUA 2GVBA 1MT0A 2HF9A 1Y1WH 1SULA 3GJ8A 3AVUA 3M4PA 2DGYA 2C99A 3KX2A 1CEEA 3RS5A 1ZJ6A 2Y0SE 3CCVA 1EFTA 2FSIA 4BZXA 1Z6AA 2JCSA 3UMFA 2ZE6A 3THWA 4H0LC 2H57A 1VHLA 5B58C 2MQHA 2D0OA 4OI0A 3CRVA 2TMKA 3AP1A 4X8MA 2KCCA 4XVRA 2OAQ1 3IUYA 1R5NA 4DB4A 4A3FH 1SVLA 1RRFA 4LBYA 3W8NA 1IBLQ 1OPXA 4KMUC 2A8VA 2ZJOA 4PPGA 4B3TL 4DLVA 2QE7A 1W5TA 1I50H 2G0TA 4GNXC 5GAEC 4BE7B 4LUZA 2O0KA 1F60A 3K9NA 1P16A 3BXZA 2BOVA 2EIFA 2C8VA 3ADBA 2F4VL 2Z43A 3DL0A 1A7JA 2N78A 4OI2A 3V4RA 3H15A 1KSFX 4C0BA 3W5OA 1RL2A 4URUR 3IO5A 5GVRA 2A6EC 4AKEA 5IP7H 1XRJA 3RYTC 2F1RA 3U3MA 4JBKA 1S9HA 2EYQA 3F0TA 3NIBA 3TMKA 2ZVQX 4DWJA 4KKTA 4GI7A 3ZD7A 3QG1A 3R7WB 4BBRG 4EAQA 4HLUA 3TZUA 4YWMA 1GUSA 1N6RA 1A63A 1SKYB 2ZRHA 3LDAA 3PVSA 4NBSA 4QJ4A 2VO1A 5CK5A 4ZO4A 4DC9A 4ERNA 5AJXA 4OWTB 4LF8Q 2DN8A 3HR7A 1OHHD 1TAGA 1E2EA 3G82C 3OPOA 4C30A 1E9RA 3U3KA 1ZYUA 4DT1B 4EUNA 1CF4A 3VQTA 1OXSC 2EWWA 3B2EA 1RFLA 2GCPA 3GO5A 2OESA 5G41A 3OF5A 4HR7B 3I4NG 5EZ5A 1ZM2A 2FGJA 2UUAL 2Q3MA 4LI0A 1JAHA 1R0WA 5JWHA 3I3SR 4TMVA 3RN2A 5AJVB 3AKYA 2JJQA 1ESNA 2PZGA 3AGPA 1J8YF 1NMXA 5A35A 3K0AA 4JBXA 4D0LB 4LF5L 1TWCH 3RLNA 4JYAL 2OLKA 3DM3A 4YMUA 4P3YA 1SRUA 1QHYA 1K8RA 5J5CA 4GNKA 2ZYUX 1UDWA 4A92A 3W1GA 2SHKA 4URZR 1WMSA 2OCEA 1IJFA 2AD1A 1VQAA 4O2LA 1QJOA 3TKLA 2FN4A 4TZ0A 1CRPA 4A3EH 5KU1A 4XWAA 3GJ0A 1P9NA 4HDQB 3SR0A 1T6NA 4BBSG 2GAOA 2UUCQ 4Q4HB 5C44G 4JL6A 4XOIA 4GLVB 2F43A 4IPDA 1W36B 1KNQA 2A5JA 5M5WH 4IDNA 1EQRA 4HUTA 4UKDA 3B1WA 4A0RA 4IFBA 3GJ3A 4TLAA 5IWAQ 4NCIA 1Y1VH 1VQPA 2H16A 5HZKA 2Z4SA 3KTAB 3EC1A 2RGBA 1E4YA 4R7ZA 5EE9A 3A1UA 1R6BX 1DAMA 4AKHA 4TLEA 4LNQA 2WZQA 2YU9H 1Q22A 2W6JD 3CB4A 2Z0SA 2JDID 4PC7A 1XCMA 3OOCA 1R0YA 1G6OA 2FSHA 3V9PA 4A93G 3CCQA 1NVVR 3IEUA 4E09A 1SHZA 2UU9Q 3QVVA 1Q0UA 3QY0A 1FP7A 2CHGA 2XEXA 1Z63A 5BN4A 3CCMA 1GIAA 1O3YA 1X6VA 4NYJR 1PHJA 1UKVY 4KITB 3QKRB 2AFHE 2GXAA 3BH7A 4A0GA 3FMPB 4JZKA 2ZTCA 3SQXA 1SXJC 1XTJA 1FNNA 3QBTA 4S35A 3GLFA 2I4IA 3M85A 2XTIA 1RYFA 3PIPA 5JMTA 2NVTH 2RGAA 2CJWB 4W5JA 3FFBA 3KQHA 1VQEA 4HJ5A 1UM8A 3TK1A 1VCOA 1Z6TA 3IBYA 2BA0A 1GP2A 4Q19A 4GKKL 3AKEA 1ONLA 5F2EA 1E9CA 2EU8A 2WJJA 3KXIA 2QMOA 4IJHA 1DS6A 2WMOB 1NKSA 5ELXA 3ZS8A 1LABA 4DR3L 1JT8A 3KUDA 2UUBL 1JJ2A 3JVVA 3QQ5A 4LV6A 4Q01A 2UVQA 3THYA 4DDTA 1T9HA 1T3SA 4H13C 4P4SB 2QAGA 1FTNA 2UU9L 2C78A 3I5YA 4JVSB 4BFVA 1VQ9A 2PBRA 2AMCB 1CJKC 1PFSA 2IY5B 1BBWA 4JLOA 4KSCA 1UBGA 3KFVA 4YMVA 4DR6L 4JK1C 1ZYRC 1NMZA 2J7PD 4Q21A 4A9AA 4KCGA 5TDHA 1RIPA 1BMFD 2O5VA 2XOKA 1IXZA 1IM2A 3Q5EA 1COWD 1Q8KA 4YDHB 1I6HH 4GDFA 1YR6A 4FN5A 4LJ9A 3HOZG 2HF8A 4L8GA 1VG1A 2PH1A 3BAFA 3A8KE 1AS3A 1BMFA 1E2LA 1II8A 3O47A 3C5HA 4GL2A 3W9YA 2WSSA 3FPAA 1TPZA 2UXCL 5L3VA 4A15A 3KQKA 4B3GA 3UMSA 1NBMD 3GPLA 4Y0AA 5IY0A 3GP8A 4KSBA 821PA 1VCIA 2YZ2A 4HJAA 4M1KA 4DV2Q 5EUMA 4JI7L 4L9WA 2BM1A 4M2LA 5FJ8H 3ZLJA 3G48A 2FF7A 1KI8A 3M4YA 3VKHA 5H8WA 1TKWB 5L3QA 4OBEA 1N6HA 3UPUA 3U4QA 1XTKA 5IYCH 1U8AA 2ZE7A 3EZ9A 1X8KA 2Z5FA 4JOIA 5M5YH 2MNAA 4QGHA 1EK0A 2CLCX 1GOTA 4Z51A 4UNQA 3B9QA 4FD2A 4IVRA 2HJGA 3A4MA 1RRPA 2JLSA 1E9AA 1QHIA 2VSOA 3AF4A 4EQ6B 2ANCA 2IEYA 2ZT9C 4L15A 2O8EB 4B3SL 3M3YH 4KHPQ 4YXWD 4DNTB 2WVJA 2ZYTX 5TV2A 1JJ7A 1HEIA 4A3JG 2GTPA 4M9SA 2NO7A 3HOXH 2VHJA 4YCWA 1HZBA 2RKOA 5KNBA 1DPFA 1X86B 4NXML 4JBWA 4DV0L 3GLGA 1TMKA 3OAAA 4LBWA 3CCRA 2ATVA 2I3BA 5EXXA 4YMSA 3HOUG 3L8YA 1E3PA 2C04A 4A3GH 3NTUA 4GT1A 4LV8B 4DLXA 1VQ4A 1OB2A 1VCMA 2ZRGA 4EX5A 1PH5A 1G7SA 3LLMA 4C9BA 3ASZA 3CRMA 5FI0B 4C0SA 3HDTA 1CP2A 3THOA 4CYMA 1XD8A 1E0KA 1E94E 4MRPA 2ZRLA 2QP3A 4POFA 3I2ZA 2CK3D 1ZNXA 5LMNL 1VIAA 2AD5A 2CBZA 1E99A 3JAMc 4ACBA 4B74A 2ZM6Q 3QXXA 1G9XA 5KSPA 3MEFA 4BY7H 3PEVA 4G0NA 1AE2A 4US2R 5E7IA 5C0XH 2ID0A 1VQIA 3OEHA 1Q90A 4JLMA 4PHFA 3WYGA 3P26A 3CC7A 3LV8A 3S1NH 1M1KC 5F9HA 3KUCA 3RZDH 1ZM4A 5C4MA 4IJLA 2VRWA 1T8UA 1F5NA 2GVDC 4LC1A 1IQPA 1VG9B 3EBEA 4XSGA 1YZ6A 2BJWA 1E22A 3I8SA 4PC1A 1LYLA 3KZ1E 3U6BA 3BB3A 4CEHB 1YI2A 4RKEA 5IDVA 1WCV1 4KVGA 4LK2A 2YTXA 1GTVA 4Q7JB 1H8EA 2D4HA 1YITA 4DR6Q 1C9KA 3IQXA 3RS0A 4PO9A 2R2AA 1W2BA 3FKSD 4RFSB 4BFUA 3Q7PA 3TJZA 3R9XA 3QXSA 1GFIA 1XTQA 2YWFA 1VQ8A 4NL4H 4Y0VA 2B8TA 3SNHA 3RSLA 2ZE5A 3A8IE 4DAMA 2BC9A 5IWAL 1ZAKA 1KNXA 2AKYA 1TWAH 3UMRA 1HNWL 4P31A 1OH8A 1HUQA 4MKIA 3I4OA 1MO6A 3X1ZA 5JCPA 3J7A5 2H18A 2B8GA 2BH8A 1Q3TA 2D62A 4IW3B 3FVQA 3TAHA 3UG7A 3WYFA 3DKPA 1N6IA 2WKPA 3NELA 1J2JA 4X66L 2AUJD 2W00A 4MDEA 1GD7A 3AQ4A 3GLIA 4JL8A 5P21A 2D0PA 4R4QA 2WPDD 1ZU4A 4DLSA 1K0RA 3CW2A 1B8AA 3J7ZC 3MD0A 1II9A 1A8VA 2VQFQ 1LF5A 2RGXA 5FR2A 2CDNA 4JIMA 4CDGA 1D2NA 1TF5A 1IXSB 2D74A 1KO1A 1Q3HA 2K5VA 3CRLC 3BU2A 3S2HH 4DV2L 4DR3Q 2GZDA 3BK7A 5C4XG 4HZUA 4PSKA 1X1RA 4MYCA 4LF5Q 1YZUA 3RS4A 1NMFA 1XNQL 4GNXB 3EIQA 1ASZA 2NTYC 4WJ4A 4QGGA 3C16C 3HOVH 1JXOA 1E3MA 3CPHA 1OXTA 5EE0A 2PNRC 1ZM3A 4FDBA 2Q3HA 3NBFA 3CMEA 3TSOA 1AQUA 4CT5A 4AD8A 5JSZA 3CO5A 4DNRB 3I61A 1F6BA 2Q8IB 3T56B 4NU0A 1T4GA 3H0GG 2QM8A 2KHIA 5FBLB 5GJVC 1UE6A 5JRZA 4M8NE 3W34A 3MSXA 1P8LA 5CYPA 3FHOA 1H9RA 2A68D 1FZQA 1V43A 1TQ6A 1XD2B 1WP9A 2CMKA 3TUIC 1BKBA 2QORA 1CKNA 5BQ5A 3VR1A 1TU2B 1VYUA 2AR7A 3CWQA 3PITA 1CU1A 1KSJA 3K0XA 2FJUA 3M6AA 4K81B 1KSGA 5G3YA 4F7WA 4Q66C 1HR0Q 3KKNA 4I7ZC 3AKCA 3AYHB 1OYWA 1OLOA 1P2SA 2RGCA 1ZD1A 3HJNA 3QVUA 5IYBG 2IBMA 2ZUCA 4D4LA 2WICA 2OCYC 1IONA 3SOPA 4BFYA 2MSDB 2JJ2A 4LF7L 2J0VA 3KLRA 2JA5H 1GNQA 2QPTA 2RGNC 4PTLA 4RSGA 4Z8YA 2FA9A 2KE5A 4GP7A 5KYKA 4NMMA 4BRWA 1Z29A 1FTSA 3V00A 1XMJA 2OLJA 2WJVA 2H5EA 3LWNA 1JR6A 5KDDA 2GESA 1ZIPA 2XJ9A 1Q46A 4N1AA 4HIDA 4FW9A 1QVFA 4JYCA 5FJ8G 3Q72A 3N70A 4I99A 1VMAA 4QJ3A 3D0FA 2B3GA 4DV3L 1IY1A 1X3GA 3A74A 2AXPA 5C4JH 1NSTA 3EW9A 3RC3A 4A1FA 3S16H 2ZQ5A 4LFCL 3K9HA 1W48A 4GKJQ 3K0CA 5FUVA 3LX8A 1G5TA 1UE1A 1UBFA 1DTSA 1TX4B 1W36C 4GZYC 1L1OC 1HTWA 2V4ZA 4TLCA 3T61A 2R6GA 4LFBL 1HT1E 3U5ZB 4F4JA 3Q7QA 4KFUA 4LJ4A 3E5HA 4LV5B 3QNUA 4OO1H 4L5SA 2WPDA 4M1WA 1GILA 4LF7Q 5AJZA 1KSHA 3EIVA 1OFTA 1JALA 3BC1A 4UQOA 1ZC3A 3AUYA 5TVKA 2DFLA 4DV6L 2VL7A 4OQFA 2IK8A 2QNRA 3MXNB 1J90A 5KHOC 5G53C 1IBKL 3RRNA 1HR0L 1EX7A 1H65A 4LHVA 4WA7A 1N36L 5G40A 2WAYA 4B3SQ 1ZD8A 2XAUA 2NZOA 4YONB 3HOWG 3CF0A 1XMSA 2NN6H 2G83A 4C0LA 4OXPA 2IHBA 4IVQA 1J6QA 1W0JD 3QKSB 4WXRA 2WFWA 1HQMC 4JBYA 2KBNA 2QEQA 2FSFA 2OE2A 1KI1A 4GMXA 3BH0A 2QRZA 1DG3A 2AKWB 1Y8OB 4A3EG 3AF3A 3LXRA 4DUZQ 5BYJA 1YJ5A 4JI3L 2J0UB 3SJAA 2HYIC 5DYGA 2KB0A 3WDNA 1P2UA 1H9SB 4PZ6A 3A7LA 3SBEA 2XNDD 2N1BA 3EIEA 4LGMA 4OONA 1RRGA 2C35B 4NPHA 5C4GB 3CW2C 4GN5A 4H1UA 1KI6B 3T12A 2O8FB 1XPUA 1DO0A 1ZMXA 4GMDA 3K70C 2BJVA 3F8TA 4BLRA 1NN0A 4YMTA 3NDPA 2VZAA 3HKZE 3K81C 2IF0A 2R44A 3GLHE 4GLXA 1G4AE 1KO7A 3OE7A 4BLPA 4TTRA 2F1JA 4G5OA 1IN8A 2OXRA 1SZPA 5C3EH 4DXAA 1YKSA 2VUMG 3I73A 4BXXG 5IP9G 1E4VA 1OFIA 1U8YA 3HOYG 2OEPA 2RB4A 3A36A 4GFDA 4IVPA 3VKGA 3LO5A 4KI0A 3REGA 2J7KA 4K0KL 1G291 3C7KA 4WZBE 5KDOA 3CD6A 3MFYA 2NZ8A 3G0HA 1T5IA 3CX7A 4C7OA 2JDIA 1VECA 5AUPB 4EJSA 2ZSBA 3LWUA 4AG5A 3LNNA 2IS4A 4AIMA 4C3ZA 4C3IH 4LK1C 1XMOL 2BBWA 3CWZA 4WZAE 4TZ6A 2G1KA 2WP8J 2JA9A 2YV5A 4PXAA 1G16A 5KDLA 2OCAA 3B60A 1NG1A 1W2HA 4A3JH 2ZJ5A 5D3MB 4RG1A 2CNWD 4WBSA 4D82A 1Z5ZA 2ZPTX 4GPTA 4V0KA 3D7MA 1VKJA 1U2RA 2QQEA 3KF6B 2JLVA 1G3QA 2PLFA 4BLSA 4FCTA 4TYQA 1XMQL 2ZYVX 1I2DA 1SKYE 5HR5A 5JLJA 1A62A 1W0KA 3K9GA 1Z0KA 1DAGA 4LHWA 4JVLA 4OJKA 4C0KA 3QF4B 4MA4A 2H17A 2BE5C 2QUZA 4X62Q 2IYTA 3BBPA 4HATA 1KO4A 4DIDA 3WNCA 2C77A 4PPQA 2V1CC 1XD9A 3TAUA 1KMHB 1E9SA 1P62B 2A69C 4CF7A 2FPMA 2P0EA 4QM6A 1G51A 4DPGA 2IHYA 4ACAA 2YYZA 3P20A 1XTRA 5D3QA 5FOXA 3AVWA 2I5LX 4JI1Q 3BFVA 4GZLA 4C2UA 1MRNA 3QXHA 1A2BA 2FFBA 4O25A 2ZJAA 2IUUA 4A3DH 4DUZL 2DYKA 5FLXc 5BYKA 4PX9A 1ZNZA 4D25A 2PCJA 1HNZQ 1WOCA 1CXZA 1HQCA 1XTIA 4Q1FA 1H95A 3ADDA 4QL5A 1E1QD 3OESA 3WRXC 2P67A 4TMWA 3S14H 1G6HA 2D2EA 2IUTA 3EZ6A 4DEXA 721PA 4QBHA 4RD2A 2VF7A 5FL3A 3DZ8A 4NXNQ 3UWOA 2HCJB 4AWXA 4C0AC 2HQLA 1IXRA 1MABA 3MWKA 4US0R 4U7DA 3PJRA 4JI4L 1TQ4A 1GUOA 3ULPA 2ZRCA 5G3ZA 2O8CA 2RHSB 3H3VI 2JK8A 1P72A 3GTLH 2RGDA 3QI2A 1FP6A 1OT3A 1Z07A 3AFQA 1XMIA 1GDDA 1Q81C 2HYDA 521PA 4PAMA 1V9PA 1YHQA 4QM7A 4WVFA 3A4LA 3QUSA 4P4UA 4DV3Q
chains in the Genus database with same CATH superfamily
4CTMA 4PLZA 1E1CA 3BBLA 1BE1A 4JVOA 5HCIA 5KQSA 3DV2A 3L7JA 3FHWA 1P5RA 2FYTA 3B9PA 1CJCA 4RV5A 1P80A 4N12A 3UG6A 1VSVA 2UZ1A 3PQDA 3ITDA 2R93G 1E2VA 1P3Y1 3P2OA 4JCOA 4JD5A 4K3VA 2Z4IA 3PI7A 4ENRA 1DV1A 1V1RB 4AYXA 1K7FB 3MGBA 3VKUA 4D9EA 4DYHA 3FLBA 4EAAA 4DOMA 3F49S 4MR7B 4E46A 1DQPA 1PEKE 2FVXA 1XYGA 3QKUA 3DMNA 4C7VA 1EQAA 1XRMA 1EBBA 1SXJB 3Q11A 4F5ZA 4ENQA 4DSTA 4G57A 4CM1A 5T4HA 1NQTA 4XD7D 2W2KA 1E5QA 4BVJA 3VPDA 5M34A 5LNK1 4QGAA 5JDCA 3AUFA 3MMSA 2NWQA 1GNVA 5AKHA 5ALYA 5CBPB 4QOIA 1SVIA 1SYDA 5H70A 2L69A 2X9GA 3P2KA 3Q8MA 2QEJC 1LS1A 3S2DH 2WHYA 5AVRA 3RJ5A 3B53X 2B4RO 5C0OE 4KO1S 2VPIA 1JE5A 5DLQE 1KGDA 3UDFA 2H7VA 3DOCA 3FMIA 1U4MA 4RVCA 3WGYA 1WXHA 3X1DA 2REQA 1GPBA 3OZCA 3PGA1 5CGZA 5GM1A 4DSOA 1BS1A 1XDBA 2H63A 4DMKA 2OSBA 1O57A 1AZTA 1PG2A 1QRAA 3AY7A 3L6OO 4RZXA 5DI3B 5ALLA 3W1EA 3W8EA 1ADJA 1KAAA 4BAUA 4IIEA 4E11A 2OC9A 4MCHA 1RI4A 1MIUA 3WHIA 1P5HA 1LCIA 1RADA 1QYDA 1I3NA 4MHEA 1MHPA 2HMYB 4ITRC 4CIWA 3IDZA 1YFLA 1H42A 4PF1A 2W2MA 4KAAA 2QTLA 3ZIDA 4ECEA 5A4MS 3NC0C 5J47A 4E3ZA 3SJBA 4MP8A 5K3FA 3RVBA 3Q9SA 3TQCA 1QR2A 2F0OA 3ZZ0A 2ZULA 4MV8A 5CA1A 3A6HA 3KWJA 1Y4UA 1QB7A 3RE1A 1Q1ZA 4DSUA 3WMFA 3CZRA 1QG2A 5AM5A 3TNYA 1HXHA 1RXUA 2R97A 1CTQA 2HL6A 3IP5A 4BVFA 3MMPA 2ZI7A 4RU1A 1HE8B 1NP6A 1QF7A 4PLWA 4CBVA 5LM3A 3NIGB 5BOSB 1W4BA 3FPKA 5ILOA 1ZISA 1W581 2ICIA 4M1MA 2WUVA 1SOVA 3GV6A 2ODQA 3MJDA 4JBHA 1PFNA 2QUKA 1KDRA 5JPNC 2XVXA 1TA0A 1ZVKA 4E14A 4MJ3A 1RQLA 1GTSA 2X6QA 1RWWA 3O2NA 4LWQA 3SQMA 3S9WA 1JA0A 4BCDA 4EB6A 3KBXA 1JIJA 2VDWB 2ACKA 1AKWA 4QHSA 5AKGA 2PL9A 4MWGA 1XJ0A 2D0IA 3KIPA 3L79A 4I1IA 1O6GA 4JA0A 1USUA 1NTRA 1JEDA 1MORA 2TRSB 3UO8B 4BJ1A 2VP4A 3LTEA 2YL2A 4XXHA 3I2YX 4M46A 4YRJA 3T54A 4HV4A 4G5RA 1DEXA 2PX3A 4CLOA 4OIKA 4XQNA 2GCOB 1IL2A 3H9QA 5JAQA 3RG8A 3F2DA 3TR6A 3VGJA 3C1FA 5AJ3Q 3FCCA 4PAOA 3EVAA 3RC1A 1U0HC 3HS3A 3HYNA 5TJ9A 4D9JA 1WHSB 5JOBA 1NI4A 4MPPA 2QW0X 3QOFA 4FI3C 4RPCA 3WHLA 4DRZA 4ON9A 5AKZA 3A6DA 5DTEA 2XUJA 3U4CA 4B5LA 1J2TA 4NI5A 1V6CA 3VU9B 4DJDC 3CO0S 4KUGA 3OHMA 1XNQB 2RBEA 2YFHA 4A3CG 2X6TA 3BCUA 3IRUA 3U0VA 2FGKA 4D9IA 4NICA 4BFTA 2I46A 4CQJA 4UE2A 8ATCA 2HIXA 1R9TB 3ZX5A 3FFAA 3CEMA 2IGTA 3VUEA 2GZRA 5HK9A 4D79A 1SFOH 1W5EA 4R2JA 5A71A 1K97A 2HOQA 3R5FA 4HPWA 1G6Q1 1F0NA 4NWIA 2OUKA 3H9UA 1LPNA 1ULZA 2IKSA 1IWOA 4L63B 1P9OA 1Q83A 3GC6A 4KDFA 4MW6A 4Q9KA 4B7AA 4B3CA 2HN9A 3GTJH 1UR5A 3CFYA 2QA5A 3F7MA 2KQUA 3Q8DA 5CH5A 3UB3A 1B15A 4MKGA 4CNBA 4ZI7A 2DR2A 3NJRA 4YPFA 2FZWA 5JEEA 2CVPA 3T5GA 4DV5L 4J2HA 4L6CA 3UK0A 3WWPA 4BO6A 2HBZA 4DARA 5C32A 2ZPUA 3CCCA 3ZN2A 2VN8A 2P2SA 4OQPA 3BWCA 1BVRA 1UC8A 5EUBA 3PE4A 2JH8A 1YZTA 5HIAA 2V7QA 4C2BA 1V16B 3FSGD 5LCXA 4JHLA 4E1BA 3K58A 1XJVA 2F3TA 3C1TA 4GP6A 5BN5B 2LS01 3EPJA 2N8NA 1VPLA 2JAUA 3BCRA 4YFYA 3UCXA 5EJ9A 4QU9A 7GPBA 2R8BA 3KD3A 1JEAA 1FFCA 3EGVA 2XA1A 4KY7A 5DEIA 5F2NA 2I6FA 3PU6A 1G8SA 1M67A 3EQ9A 4OM7A 4E08A 2YS6A 1H0KA 4YAGA 4J7UA 4KQEA 4TM8A 3DEKA 3H5VA 1FFAA 3OO0A 4MKFA 2I3DA 4X85A 4HVLA 4YCJA 4R1OA 3RVMA 2FJ0A 4WGFA 4EG6A 1F9PA 5M5WB 4HS4A 3RC8A 3SXHA 1GZHB 2R7KA 3GVIA 4ND6A 2ATEA 2GF2A 3HGBA 2IYQA 4O4LA 1VQLA 3A37A 3H04A 3RWBA 1W7AA 5HP4A 4H59A 1X19A 3PQIA 3BHNA 3W6NA 4MV0A 2QUHA 2PSEA 4IUCS 4KOAA 4UU7A 1A3VA 3INNA 5IJZA 4F87A 2AI2A 3L8MA 4PWZA 5FTLA 3ER9A 3G0DA 3BE4A 4BN5A 3EE6A 1GDTA 5HUJA 2OT2A 1I6WA 2Z95A 3DTVB 1QQ7A 4IIDA 4DKXA 4DV4B 2FEOA 4NR0A 1QDEA 2BF4A 3IPAA 4LJZC 3K2IA 1K9MC 1EKXA 2BUBA 3WL7A 2Q2TA 1C30B 4J2OA 1FW8A 4J1TA 2IUSA 5DX0A 3ZCUA 1OZHA 4CM4B 2HCTA 3N76A 2MSLA 3PQEA 4RF3A 3A27A 5KEIA 4RD4A 1A77A 1JR4A 2IPXA 5EP4A 1W1WA 2C3UA 3L6BA 1ZH8A 1ZW6A 1ODSA 4M99A 4UOEA 1W1IA 5IYDG 2VJMA 1RJEA 2GD2A 3F90A 2LDXA 4ENWA 5KTMA 5AW3A 4CGZA 4WNAB 3LHDA 4KD3A 1EX6A 1X15A 1Z2NX 1CQIB 2PMDA 3KQMA 1IN5A 4LECA 3TFWA 1E92A 4LJSA 2B35A 1GNRA 2Z08A 5DAUA 1U04A 6YASA 1L4GA 1OXKB 1UZMA 4H6VA 4AKIA 1D4OA 5AVXA 3N8NA 4W5OA 1NXQA 1X74A 3BIOA 4OL0A 4ER7A 1AUPA 2F3QA 4ZI5A 1XRRA 2WHPA 3E8SA 3UFXA 3UWKA 1CW2B 2XCRB 3QO2A 1J70A 1D09A 2BFDB 3BORA 4ZKCB 3NEJA 2O4UX 3BUSA 4M7PA 5DW3A 5NULA 1OZAA 1J0XO 3GLTA 4DV1Q 1O6FA 3CCEA 4MINA 3V1LA 5CDUA 2NYUA 5JXHA 3E6ZX 4YP1A 4DNXA 3LX0A 4TKLA 3OQIB 3OD5A 4BP8A 3LGSA 2RAPA 2WOJA 3GJ5A 1AKRA 3OIFA 1EU4A 2MSKA 2E2WA 4KLCA 4PO3X 4U2BA 1M66A 4XJSA 1WB9A 3B13B 1XAGA 2WAMA 3ZPXA 3GTOH 4QEZA 1I5RA 3D6WA 4IPHA 5EQ0A 2Y1EA 1V1QA 2IHKA 2JAPA 2ZTSA 4UUBA 4HHEA 2YN0A 1W44A 3QIVA 4P3XA 2EL7A 2RC5A 4R41A 4H7IA 4A6DA 1LFAA 1EY0A 3VA7A 2HV8A 4ZT7A 1WV0A 3EGDA 1OASA 1LT5D 1PTKA 2OYRA 3W05A 1M6HA 5CM2Z 3ZZTA 3V6MA 4EITA 1HFWA 1JU3A 1VLMA 3D3KA 3GJRA 4JWTA 1KI9A 1EGMB 2J3JA 1M7BA 4PG6A 4YJ2B 3KHSA 4DEYA 4DR7Q 1Y7TA 2O5IC 1UBNA 4LFAQ 3ISJA 4RKBA 1G6ZA 4DPMA 1EVIA 3BVZA 1WMBA 2W2LA 4D96A 2IKQA 5TS2A 3ASUA 1GUNA 3HKZG 3B51X 4EX7A 1GFWA 2YNMD 2JLYA 4PLCA 1Y8CA 2ZRAA 3AH8A 3OT1A 5IAJA 4GMFA 1FDSA 1H1DA 3I30X 4BEJA 4LFBB 2DCMA 5F12A 1NRWA 3S44A 1PTOF 2P2GA 4NVRA 5FFNA 1YJXA 1EBFA 3K32A 5B57C 1KDBA 4NJMA 2ZJPA 1YDFA 4DNOA 3L0SA 2IUEA 3IIMA 1Z83A 4N8X1 3C0KA 4I4TF 1EGAA 1OJLA 1XJQA 4YLGA 2ZUFA 3OOYA 1CS0A 2WF5A 3I9JA 2HV9A 1CM9A 4YO7A 1ETHA 3E48A 4G67A 3GLGB 5JDIC 2AMFA 2C20A 2BEVA 4CV2A 4N0QA 3QXCA 3R3YA 1L5OA 4P3PA 2ZT7A 4BB9A 2PA0A 3T16A 3W8FA 2J41A 4PRLA 1IW7C 1Y3IA 5KWSA 4I1PA 1T25A 1KQGA 4IRXA 4AQYB 1JHOA 2IPKD 3MTDA 1NI3A 4ZA2A 4MVXA 5HK8A 3G71A 5DPMA 4ZYSA 1NY5A 1X9IA 2ZROA 5HZHA 4BA1I 2VUMB 3GIDA 3I61A 1SVKA 5CJPA 3U7FB 1YE8A 4L5BA 3QHQA 4ENTA 3MT0A 4KU4A 4REQA 2J48A 3MWJA 3WSWA 5FPTA 3J80L 4EO7A 2A68C 3ZV5A 4CL8A 4DA2A 1SQFA 3IESA 1PVVA 3HUDA 4BS9A 3MAGA 1RWVA 2DB3A 1DXHA 4X1KA 4W4TA 2F6RA 2XOKD 3TE7A 3HFGA 5ALZA 3RBZA 3STUA 3SZRA 4RLFA 5KB3A 4BNWA 3OTWA 1QIDA 3EVBA 1KY5A 2BMDA 1WEKA 2H0RA 1GQYA 1GFZA 2QV7A 3RSSA 8ABPA 2GGSA 2OBXA 4LHEA 3TRIA 3OO1A 1WDLA 3D8BA 1U3GA 3V5NA 1EWIA 3TRFA 3LY5A 1Y9AA 2X7JA 4CMAA 1J24A 1W94A 2D3WA 3IMCA 3NVAA 4JDPA 4R9SA 2C3OA 4H7BA 1U31A 4MIYA 4WKNA 5IKEA 1JQYD 1B93A 1EJ0A 3L04A 2VHEA 3BTSA 1NQOA 4GNRA 4X5OA 1VL1A 5TQ2A 2P68A 3AINA 4ND8B 1C3JA 2DKFA 4MEAA 1Y1VG 3RC9A 5JPCA 2W6QA 2NMVA 1Y4DE 2FRDA 1Y8QA 1HZCA 4TWAA 2UVPA 1STHA 1O4VA 2NVXB 2QG6A 3ZGYA 5THQA 2AN4A 5DI9A 5JVG3 3U4DA 1JDBB 1XEAA 2GXQA 3AHCA 3C45A 3RKUA 2ZBPA 3HLYA 3G8CA 4BEVA 2KW5A 2A0UA 1PKEA 4EKIA 2FU5C 4BNHA 3L7LA 1V26A 4MVJM 5KJ6A 4KUHA 2B1JA 3D0QA 4JK3A 5HIKA 1PUIA 1Y8NB 5EJMA 3RK0A 4JV5B 1JOKA 1F2TB 2ONYA 5CGQB 1JFLA 4E1AA 3TLGA 1L4UA 1PQPA 4Y6RA 3QFFA 4A26A 5ALVA 3OWEB 4CDEC 1N6NA 5G1NA 3T5MA 4BLTA 2AOTB 2IH4A 1M34E 3AKZA 1V0JA 3RR5A 3ENKA 3RYIB 1OFGA 2HDNB 3TDMA 2X0EA 3GLFB 1DAEA 2GTIA 3L0ZA 3SGIA 2RH8A 5HSGA 4EA7A 3W5BA 4FS8A 3THXA 2HSEA 2Y2VA 3KU4A 4RGOS 1BCPB 2QP9X 4BKPA 1SXTA 3QF4A 3CVOA 2WJ6A 2ORIA 1DX4A 4IHQA 3B52X 3L05A 2B3TA 5JJZA 3BYYB 4R3UC 3NTIA 3CMAA 3DMFA 3QI7A 3WL6A 5L4NA 2EP7A 4CMGA 4AQYQ 2VYND 4JROA 1UBTS 3M1YA 3Q9UA 2JFOA 3TP7A 2UYQA 1CERA 2HT1A 4JQOA 2C2BA 2F3RA 4R7GA 3I62A 3MN1A 1NMSA 2ENWA 3IEPA 3M2PA 4PQRA 4Q1DA 2A7QA 4Z1OA 4G41A 1CPYA 2XGSA 2GQ0A 4JLJA 2H00A 3CTMA 3RYHA 5GZ1A 1R18A 4MUFA 3T5BA 1U5BB 4TRDA 3VOSA 2IYEA 2AOXA 4E4YA 3K5MA 3P32A 4XCVA 5JDIA 5TARA 5F9MA 2YC2C 4ATNA 2VZLA 3G9UA 2B7LA 1FRQA 4RNDB 3WGTA 2Q2OA 4ZO8A 3A6EA 3OU2A 3GA7A 1R0XA 5KQLA 1IJKA 2XE8A 3BPSA 4M9UA 3EWSA 5HCUA 3RV3A 2VPYA 4CGYB 2Y1DA 1IK6A 1S7CA 3BD6A 2IWHA 2ZYWX 3UV3A 1D0SA 1Z36A 2PLNA 2DULA 4PZUA 3HRZC 4JBGA 5CW2A 4BNJA 3L7AA 2X8AA 1KL7A 1T5XD 5J39A 1CUZA 1PWXA 3FCAA 3QE4A 3VPXA 1LTLA 2GD0A 4Q3BA 4N7BA 3WADA 1QBKC 4FMCF 2AOUA 4FBGA 4FK8A 3CP0A 1EXVA 1FX0B 3HOWH 1U28A 1YQXA 4DBLE 1ZCBA 2LKVA 1CT9A 3H2SA 3QLVA 1HJPA 4M9XA 2QTHA 1CR6A 2XYRA 3TBKA 4WFQA 3ZDYB 4F8JA 5LQAA 4PHFA 3FYCA 4CZ2A 4XLLA 1YB4A 2AG5A 2NQ8A 1Y5RA 3ZDEA 1QO0A 2ZR7A 5F51A 3E70C 1W6RA 3D8UA 4GSLA 3OYYA 3SHTA 5B1EA 2EPBA 1CWUA 4LOKA 4G7OC 4QT4A 5LQCA 3BCSA 1SOUA 4WRDA 2X2EA 2ZJ7A 2JEBI 1HA6A 4GN3B 3BVPA 1KYIA 2PT6A 4LJYA 2P9BA 1CE8B 4I7EA 3UVEA 1ZZGA 4JV5Q 2IY8A 1G8HA 3G23A 4L07A 1UP7A 3R7NA 1KQSA 4MHOA 1Q0PA 4M6WB 1NQXA 1U3FA 3MEQA 1UWKA 1SIOA 1Z74A 2HK9A 1E3IA 3NC1C 4GICA 1QQ5A 2BTQB 1CB7A 1O58A 4EQ6A 1U1IA 4CUJA 5JI3E 3H6KA 1RI1A 2AIRA 2C95A 3PKJA 1FL0A 2I54A 1Z28A 2O3JA 3HO6A 1JWAB 3I64A 3R6DA 4OU5A 2JLXA 3B8EA 1LDEA 2NVYH 1OC2A 4H7FA 4A4DA 1J5EL 2BIFA 4JJEA 1U0SY 2G36A 4X8OA 5IU6A 1CJMA 2V97A 3WK6A 4YYEA 4KO3S 1IOZA 1T1EA 1M8JA 4FT4A 1DJRD 1DHTA 1YR1A 2MT9A 1K7EB 4K86A 2AFIA 3HYRA 4IDEA 1CY4A 1EFAA 1PJBA 5AKLA 2AV6A 2DUMA 3QPAA 3D6AA 5K45A 4J4HA 5KOYA 2C9ZA 2EJGC 2OTJA 1IB0A 4FONA 1AA9A 1YZFA 3ADOA 3KUPA 4KMMA 4B35A 1RAGA 4B4OA 1QVRA 3I55A 4B3IA 1UIMA 2C82A 4ODGA 1X2BA 1Y3BE 4NOJA 4YMWA 1KRTA 4NZNA 5LMUL 2FW6A 1OCEA 2Y1GA 3DG9A 4ERXA 3DHWC 1RLOA 2I2AA 3AF0A 3TEHB 2R5NA 4FFSA 4Y9TA 2Y8EA 1CB0A 5KYIA 1YBMA 5FTMA 1KYXA 1FK8A 4TT3D 4B3MB 3UUGA 4GAEA 1UBEA 3OKCA 2JCXA 2VUUA 4BECA 1Y8RA 3ZHZA 5BSHA 2QZSA 1V3VA 2Y1WA 1KTVA 5CR9A 4S12A 5E9QA 2VRNA 4DR6B 4E22A 4FDLA 3OZWA 1I2MA 1L9XA 1PZGA 4KIUA 5ARCA 4QBGB 3HU3A 1LJ8A 1FJGB 5LMNW 3W3ZB 4G65A 1P2FA 2IT1A 3CRRA 3VDXA 3S8MA 2E87A 2H2AA 3VYUA 2RH5A 4PRZA 4CM3A 4DV3B 1P29A 4BNVA 3J81k 4QICA 3LKVA 3GFSA 5JJIA 2V65A 2VRCD 5ISRA 2BBTA 2XN9C 1HE4A 4FX5A 4QPDA 4XB6B 4IQZA 1JHUA 1TJ4A 3F2CA 4B3ML 1JGTA 4IYRA 2F7SA 4HT3B 2YXDA 2B25A 3PPXA 5IBRA 2O7SA 2I8CA 3LH5A 1UC4B 3P4YA 1L4BA 3ZHYA 4I8DA 4AL4A 3HOUB 1F7UA 1JHPA 2QSUA 2BGWA 3VJRA 2EFGA 3MUFA 1H23A 1YFZA 2YJTD 3GZ4A 1H22A 3ZWOA 4EUEA 3BMCA 4ZEMA 4NECA 1XJCA 2QN6A 3KZMA 4FDVA 3VOAA 4BB0A 2MDTA 3A3YA 2GRAA 4ZAXA 1B76A 1V9SA 3NP9A 2HDLA 1LM0A 1L5HB 1Q77A 2ODAA 2QUAA 4O1IA 4B4WA 2QLNA 3NBHB 3FTDA 4EMUA 1B7YB 1KLGD 2VDLB 4G37A 2FMFA 1IUKA 3QB3A 1N2SA 3I04M 4RV4A 4BX2A 4BQFA 5JFGA 4DV0B 2AN9A 4A3KH 3BD9A 1CYDA 1E6CA 1VQGA 2CD9A 3P0RA 5HJ7A 1ISGA 2K6AA 2ZTLA 5KOJB 2GZAA 2J4CA 4N0MA 2C2XA 3DULA 2E37A 4EF4A 3ZBPA 4WJKB 4QOSA 1JDTA 1WR8A 2CJWA 2JBAA 1DQRA 5ALDA 5CITA 3IEIA 2IIQA 2I8LA 2P1ZA 2YXEA 3FYUA 1W4CA 3N8GA 3CLUD 1NY4A 1NHGA 5BSGA 5JCOC 5TPWA 4N6NA 4Q9IA 3MK31 2B0JA 1LPPA 4PU0A 3EA0A 4M86A 4U2KA 4ZALA 3UOGA 4XRGA 2IU3A 4YJKA 3CEHA 4B2LA 3FRPB 2EV9A 3CUWA 3CU7A 2ZSUA 4KMOA 4LJ5A </