2IYYA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and so4
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
169
structure length
169
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 66
structure length 169
sequence length 169
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyyA00
1EGAA 3CO5A 5BYKA 1ODFA 1TU4A 4IDOA 2GTPA 3QEJA 5FTNA 3FTQA 2WKRA 1KZGB 2J46A 3TAUA 2P6NA 4JT4A 2JLSA 4CIDA 2GETA 3SEAA 2F3RA 1SKYB 2GJ8A 3AGPA 4A92A 1MO6A 4JL8A 4UNRA 4P4TA 5CITA 2WOOA 1XEWX 2GESA 4HDQB 3SFVA 3UMRA 1COWA 4DCNA 2LCFA 4DLYA 1J99A 2ZE5A 2W2VA 3GEHA 5KPJA 2ZIAA 4NONA 5FOVA 1YZTA 4DLSA 4UXJA 2GAOA 2ZI3A 1DADA 4JJZA 1R0WA 3PEYA 2RGCA 3BS4A 3OHMA 2FFQA 4F38A 4FWTA 5G3YA 2V6IA 1GL9B 1SVIA 5FI1B 5BQ5A 2OAQ1 4AY2A 2V1XA 3QG5A 4LY6A 1ZUIA 4NCKA 5E7MA 5HKKA 2WZQA 3U44B 2ZEJA 3LO5A 4DIEA 4NZYA 1AM4D 3NBYC 2O8BA 2CNWA 4NE2A 4ZO4A 4Q1CA 3WHKA 1DS6A 5E3HA 1VG1A 3SJBA 4EPWA 1TPZA 3U6BA 5BYJA 4C7OA 3FMOB 2VP5A 1WDTA 1SKQA 3TR5A 2HYIC 5BW8A 3OIYA 1Q44A 1XD9A 3TLXA 3CNOA 2QZ4A 1NBME 1W4CA 5EE9A 1YZUA 5CIWA 1H8HA 3U4QB 3NDBB 2Q3FA 3MUFA 1KKMA 4GZLA 3AVUA 2WJJA 1VHLA 2Y8EA 1EFUA 2VEDA 2C78A 2Z83A 4V0KA 3CB4A 3THOA 4HLCA 1E2QA 4BFXA 1FNNA 5A5GA 4JMPA 1G1MA 1SXJC 2V55B 4DSNA 5EXPA 5JWHA 5CYOA 1JXMA 1QBKC 3WMGA 5GVSA 3ND8A 4DRZA 4FXPA 1XXHE 4G5OA 5FUWA 4IHQA 3SYNA 2ZUCA 4DSUA 3R8FA 4MGZR 1T9HA 1CXZA 2ZROA 2A30A 5FI0B 4E09A 4AKGA 1XZPA 4M0LA 2NZJA 4DT1A 2IK8A 3SR0A 2J0UB 1TQDA 1OYYA 1L2TA 1P3JA 2J7PA 3TW8B 5ANRB 4O3MA 2ZU0C 2FE4A 3DZDA 3K0FA 4C3ZA 1XXHA 2O8EB 2ZI5A 3TIFA 5JS8A 2CK3A 3T1VA 1OIXA 3FFBA 1T5IA 3BH0A 3BK7A 2O8FB 1Q57A 3EA5A 1MH1A 2XSZD 1E2LA 4C0HA 2A5YB 1E2HA 1XTKA 1UADA 2A5JA 5FL7D 1RYFA 4RD3A 2ZUDA 4TMKA 4Q4AA 4ZDIA 1QG4A 2I1QA 4KFUA 4OK5A 1W36D 2I1VB 4B44A 1PVOA 3KFVA 4QJ5A 2GA8A 4XSHA 4D6PA 2BCJQ 1TX4B 3QKUA 2Z43A 3EG5A 2ZYUX 4P4UA 1J8YF 4WZ6A 4EPVA 2PT5A 4HDCA 1IN4A 5TY0A 1Z3IX 2C9YA 2CMKA 3L0IB 2LKCA 1T6NA 1GZSA 3VQTA 1MOZA 4NCHA 4RD0A 5FBLB 521PA 1NY5A 3UIEA 2J0QA 4RKFA 2FGKA 2J3EA 1XJCA 3CWQA 4C4PA 4DLRA 1RZ3A 2NO1A 3GLFA 2V9PA 3FYHA 3BRWD 1R0XA 3E2IA 5FOUA 5EJEA 4A6XA 2XNSA 2ZRKA 3AH8A 5DHFA 4IDNA 3CX8A 5G3ZA 3O8RA 3IKJA 4M53A 1TU3A 4QBHA 4EJSB 2PZGA 1BS1A 3KJGA 1ZBDA 5FUYA 2JJ2D 1H65A 1HYQA 1OPXA 1R2QA 1MRSA 2PX0A 3VR4A 1SKYE 1WCV1 5FTKA 4ESHA 1U2RA 4NYIR 3ECCA 4HAZA 1VYUA 2ZJ8A 1E3MA 3WMFA 4PPGA 1F6BA 3T1OA 1AZTA 3SU8A 1P9NA 2GRJA 2ZRJA 1E1QA 3TSOA 2ZRGA 5HKKD 2GK6A 1KK3A 1P5ZB 1P4SA 1YZNA 1X8LA 5C1BA 4MYCA 3B5JA 5KDLA 1VG9B 4PR0A 2O8CA 3CH5A 4PC7A 5L3QA 5CJPA 4RCYA 3IGFA 1IONA 1B0UA 5KHOC 1AK2A 821PA 3UPUA 2O0KA 2HLDA 2IYTA 2OM2A 3SYKA 2P6UA 2OSBA 2ZJ5A 4QXAA 2XB4A 1COWD 4Z8XA 2XOKA 3GP8A 1NLFA 3K0SA 1TF2A 3D3QA 4JVLA 1G17A 421PA 5B57C 2JLZA 1CRQA 1BH2A 1W2HA 2PLFA 3LWNA 2VRWA 4FW9A 4I1VA 5CDFE 5J5CA 5J40A 2R6AA 2OCBA 4MA4A 2WTUA 1EWQA 3VX3A 4DSTA 3RS5A 5ELXA 4G5RA 2IEYA 3GD7A 4BFVA 4IVRA 3M6AA 3TAHA 5FH9A 3KQUA 3RRYA 2NO7A 3OIUA 4BFSA 2RH5A 3B60A 3WYGA 2O5VA 4MGKR 3NH6A 2ZVPX 3L0SA 3MRSA 2G9NA 3OAAD 4FMDF 2FFAA 3EASA 3RSLA 1IAQA 2GBLC 4S2EA 5FPHA 2FU5C 5JBQA 4TZ6A 3ADCA 3FHTA 5F98A 3QKRA 2EFEB 1XNJA 4B33A 2B8TA 1VPLA 1UFQA 4PPNA 2ZSAA 2QBYB 4Q48A 3B85A 1U0HC 5EE0A 3VHLB 2GJ9A 2FPMA 5GJWC 2ZRDA 3LAWA 4Q4JA 4PSKA 1NJGA 1OH5A 4V02A 1T8TA 3EAQA 1E9AA 3RS7A 4IDHA 4FINA 1A7JA 5GJBA 3R20A 5D3MA 4LJ6A 4CT4B 1YR7A 1G7CA 2AXPA 2WV9A 4B2PA 4NYJQ 2WJHA 4NYIQ 1E2GA 1RRCA 1N5KA 1Q1QA 5EXTA 1HY3A 2ECKA 3KQKA 2WAXA 4OKSA 2A5FA 4BASA 3LDAA 4HEJA 3ADBA 2HCBA 1SXJD 1OLOA 3CX7A 1FFHA 1II8A 2R8RA 3ZH9B 1CR1A 3FWYA 1NVXQ 1Z0IA 1OSNA 4B3CA 4PQRA 4GBMA 5KTYA 3QBTA 4MH0R 3UMFA 1K8RA 3GLIA 1Z6XA 4A82A 2IYLD 4L9SA 1KO8A 4KJZA 4CEJA 2ORVA 3W3ZB 3MWLA 1NIJA 1NN0A 3CZQA 2ZS7A 1GSIA 4Q7KA 1Y3AA 3NWJA 1TTTA 2OCPA 5JWOA 1OF1A 3SI7A 4HB3A 4URYR 5J4VA 1XEXB 4X8OA 1C1YA 4DLZA 2HT1A 2WWWA 1KJWA 4B35A 3NBZC 3SJZA 3MLEA 4Q19A 2QAGA 5CB6A 1JI0A 3NKVA 5K8TA 2H16A 4L9WA 5CK4A 3REFA 2ZE6A 5SZJA 3VKGA 2JASA 3THXA 3D7MA 1LB1B 3M0EA 3P4XA 1I4TD 1X3SA 1L4UA 1W48A 5FBQB 3MSXA 4GNKA 3RSOA 2OT3B 4U00A 1SXJB 2IHBA 1Q3HA 2AWOA 4R2IA 4RKEA 2FGJA 1S0UA 3SDZA 1NMZA 2R44A 3FHOA 1OW3B 3IQWA 3KJIA 4HLUA 4KYIB 1K5DA 4N3NA 1NLZA 3OEHA 4ARZB 3FOZA 1OXTA 3ICEA 3DL0A 3ZDQA 3TMKA 4AD8A 1U99A 3BB3A 2ZETA 3HYRA 1M7HA 3W6NA 2F9MA 3BBPA 4ON9A 3TQFA 2QGZA 1JAHA 2ZSBA 1XEWY 1XU4A 3GLHA 2GZDA 3TQCA 3NHBA 1G4UR 3OFND 1K5GA 4MRVA 2VIIA 1G8YA 2ZRHA 4XTRA 2ZREA 1TF5A 3IILA 1CTQA 1KGDA 3KJHA 5J4YA 4RSGA 4Z8YA 4G5SA 4HZIA 3FHCB 4NTZA 1XMVA 4N1AA 2D06A 1KO4A 4IVQA 1ZNWA 4WXPA 4B3DA 5EE3A 3U44A 4D0NA 1E4YA 4BFWA 5L3RA 1UKEA 3ZQ6A 4NH0A 1CR4A 4I4LA 3L8YA 1A2KC 2GK7A 2JDIA 2QMEA 2F43B 5JHGB 1TF7A 4ZIRA 2XJ4A 1ZNZA 1I2MA 4Q66C 2QE7D 3SOPA 3Q3JB 1NN5A 2GWHA 3FMPB 3ZVMA 3IQXA 2FPLA 2YOHA 3V4FA 4C0BA 3LLMA 1FPMA 1RJ9B 4JVMA 4CEHB 3U7GA 1ZW6A 4TMZA 4F7WA 1DPFA 5TDHA 3GJ0A 1NP6A 2AN9A 2V7QD 4BZPA 4YQFA 1N5IA 3KUCA 1E0AA 1C4OA 5DNYB 2VH5R 1UDXA 4Q00A 1EESA 3VR1A 1AS3A 1X8JA 2IXFA 3RANA 5L8VA 4MUAA 1OXUA 1SHKA 3K70D 4Q18A 4WIAA 4ASUD 3GLFE 2GBLA 2GNOA 3DMNA 3I4LA 2BMFA 3THWA 4TYPA 3A1TA 3H0KA 1ZUHA 1M6NA 2OESA 4FCWA 2WPDA 1A1VA 3A58B 3UATA 3K0CA 4IOKA 4TQAA 3KUDA 3PEUA 2JLXA 3KZ1E 3QKTA 2PMDA 4IW3B 5KU1A 1E0SA 4UKDA 4QHTA 1P9WA 1NKTA 3WYAA 3OZXA 2PEYA 3B9QA 5EUMA 3ZYCA 4OHZA 1PLKA 2FSGA 2EWVA 5FPTA 1J8MF 4C0LA 4PO9A 2YHSA 2JLQA 4LBYA 3MD0A 2DY1A 4ZKDA 4LBWA 2JJ1D 3EZ7A 3FMFA 4FCVA 4JBXA 1FMLA 3DMDA 2ZPTX 3K0AA 2CLCX 1FUUA 3FDIA 4OHWA 3NC0C 4A6PA 2V54A 4TLAA 3K0CC 2JLYA 2JIZD 5IK2D 2MSEB 4M1SA 3GEIA 3LVQE 3EZ6A 1TQ2A 4B74A 4LX0A 1O3YA 1RRGA 1GRRA 1CP2A 1US8A 2P2LA 1G9XA 1FUKA 1UM8A 4IFBA 4NKRA 4Q01A 5C46F 1FX0A 2J87A 1E0KA 1TQ6A 1U81A 1IN7A 1UEIA 2EFGA 4M1OA 2ZJZA 1GVNB 2A3RA 4KVGA 3R7WA 1XPOA 3W6PA 3DZ8A 1RRFA 2BV3A 2AX4A 2ZJ2A 2WKPA 2QQEA 1LTQA 2IUSA 4A8JA 2EFHB 1UBGA 4RY2A 2IT1A 1NN3A 2D4HA 5DHAA 2WBLC 4QBFA 1BYUA 1CKEA 3D8BA 4GMXA 3Q8XB 3RWMB 4DKXA 3X1DA 3SQXA 2OAP1 4EQ6B 4MKIA 4OHVA 1HQCA 4X8MA 4LWZA 3KQNA 4BECA 5FPYA 2JAQA 3MJRA 3P4YA 2X2EA 2D7DA 4OQLA 2IYSA 1KDPA 5C4MA 1U8ZA 1G291 3K53A 4PC3A 4D4JA 4G01B 1G21E 3LFUA 4RD4A 1HV8A 1OFHA 3LX5A 3OAAA 2GF0A 3QQ5A 4W5JA 4AKHA 5TV2A 3PUYA 4RZXA 4Q03A 1AQYA 4JLMA 4LHYA 4CVNA 1JR6A 4Q4AB 1OJLA 2V6JA 4KCGA 4KFSA 3CPHA 1XWIA 1BYIA 1UKYA 2E1RA 1BMFD 2WSSD 3C41J 5DI9A 3J81k 4Q1BA 2AK2A 4LJ8A 2VO1A 2DYKA 3LV8A 4D2IA 4JL5A 1G41A 3ZS9A 3KKOA 4US2R 4TMTA 2DBYA 3HYTA 4ESVA 1YQTA 2O0HA 4NYMR 1EXMA 1JBKA 2D2EA 4A9AA 1F2UA 1Q3TA 1QHSA 3QKSA 1PUIA 4GP6A 1T3SA 3AF2A 2GF9A 3VHXA 1P75A 1ETUA 1CJMA 3R9WA 2AL7A 2ZRPA 4DUGA 5E4FA 2JJ8A 1IXSB 1G19A 3GLGE 2H7VA 4JLAA 1W49A 4LYAA 3L43A 1T91A 2ZS9A 1DTSA 2GEUA 5FPSA 1YJ5A 3UWOA 5JWRA 3U6KA 4LJ7A 4QM6A 1OKKA 2C95A 4G5QA 5CYPA 2BBSA 4W7SA 4IDQA 1KK1A 4EJSA 3T1QA 4MYTA 2CBZA 1NVVQ 1KAGA 1Z63A 2BWJA 2WMNB 3EPLA 4QJ4A 5AWFC 2DWPA 2IW3A 2WWYA 3GMTA 2VHQA 1VCNA 5FBWB 1M34E 1YZLA 3CONA 1F2TA 3EIQA 2VTKA 4ITRC 2A5GA 4DUGD 2O0JA 5EP1A 1Z6GA 5EE1A 3U7EB 2ONJA 5CLLA 3V9PA 2W6JD 5H70A 4URZR 4D25A 1SULA 1ZC3A 1JPJA 2WJGA 3LVRE 1XP8A 4PFSA 4PO8A 1AS0A 4TTPA 1P9RA 2WWFA 2F1IA 5L3SA 2W58A 3DO6A 2H5EA 2XNDA 4DCSA 5EUQB 1WA5A 1M1YE 2GKSA 4YLGA 1KKLA 3IBYA 3AGQA 1J7KA 2R6GA 3X1YA 1Z0JA 5KUTA 1DAFA 1JALA 4LJ9A 1OXVA 3U3RA 4UXHA 3THYA 4TMWA 2FF7A 4ERNA 1XFAA 5JEEA 2YWFA 1NJFA 2WHXA 3K09A 4YMSA 2IUTA 3QPUA 2VL7A 3NTUA 3P26A 5BN5A 4YONB 1IJFA 4NL4H 4Z51A 1XJ0A 2J1LA 4FCTA 3TUIC 1VKJA 5DGXA 1YR9A 1F48A 1WXQA 3Q5EA 1S96A 2ODWA 3OE7D 4OI2A 2BBOA 2RKOA 4ZKEA 3AF0A 1FQJA 3THWB 3UG6A 1CJTC 5HCNA 4JVNA 3GJ3A 2D62A 3CR7A 1F2UB 1XTJA 3QKSB 1Q1ZA 2XSZA 2KBEA 2OFOA 5K8LA 3QF4A 1VG8A 4PX9A 4KHZA 4K46A 3GLIE 4IJMA 4C7OB 3ND9A 3UXMA 5GADl 2GAAA 1GNRA 2CK3D 1IM2A 1EWRA 4R9UC 1TNDA 3QEOA 2OV2A 1TMKA 3HP1A 4F4IA 1VDZA 3KXIA 1E32A 1NY6A 2PH1A 3MFYA 4UJ3A 4TLEA 3AF4A 4OI1A 4BLQA 4QHSA 4M9QA 4M1MA 2J41A 3WHLA 2YNMA 1OT3A 3QSYA 3RNLA 3SS8A 2ZJOA 1EG7A 3T06B 1AIPA 2ODEA 4GI7A 3PV0A 1QHHA 2V1UA 3ADKA 5AUQA 2XZLA 2JIZA 4JYCA 2QM7A 3QXCA 5IK2A 1IBRA 2ZYWX 2PL3A 4PQYA 3Q9LA 2Z4SA 1N6NA 5SZKB 1KO5A 2YC4C 4NYMQ 3C7KA 5K8IA 3CPEA 4KVAA 1E2JA 2XTZA 1ZC4A 1E1RA 3A4NA 2ZJYA 2FJUA 1W1WA 3KDSE 3GJ4A 3HU1A 1FX0B 4HB2A 4EPRA 3AVYA 1GKYA 1JJ7A 1R8QA 4G1UC 3AEZA 3DM5A 1CF4A 2KB0A 2IYWA 1DG3A 2EU8A 3RS4A 1W0JA 3CWZA 1KO7A 1KI7A 1N2CE 1VCOA 3LRPA 1XXHB 2ZRMA 1NMXA 1E9SA 5EE5B 4E5UA 2ZE7A 4KFRA 3L0PA 3B13B 2DR3A 4WZAE 3N5CA 4A8JC 1LF5A 1GNPA 3ZQJA 3MGCA 3PXGA 3WMEA 1MKYA 1XB2A 3ZZUA 2DFNA 4FMCB 4BZXA 1PUJA 5JS7A 1RFLA 1W2GA 1XEXA 3T34A 4F4JA 3GLGB 2F3TA 4TMVA 2YOGA 1ESMA 1KI4A 2BJVA 4HAXA 3MAAC 3IBGA 3SBEA 2JLWA 1HH4A 5FBRB 4HAYA 4MQBA 4B2LA 1G6OA 3UMSA 1G6HA 2PX3A 3L2OB 4BFTA 4HB4A 1WRBA 4YXWD 1S9DA 4ZCIA 5LPNA 3QVUA 1E9CA 2BBTA 3KJEA 3GJ5A 4U7DA 3CF6R 1EFCA 2FN4A 2F6RA 1KI6A 2JGNA 3AVOA 5F9HA 4FN5A 1W4RA 4HLDA 4DDVA 3ZGXA 1I2DA 2FSFA 4BZQA 1R10A 3BC1A 5HE8A 1RC8A 1E69A 4A0GA 2ANBA 2OBLA 3A4LA 3AUYA 4BLRA 4TYNA 1R4AA 1X86B 1XD2B 1X6VA 1TUEA 1OIWA 2OILA 4JKYA 4Q7MB 4GOKA 4DVGA 4HAWA 1GDDA 4U02A 5DISB 5SZHB 4D81A 1LY1A 1VG0B 1W4BA 2FFHA 3BFXA 3RS2A 1E96A 4LGMA 4B3GA 1W0JD 2CE2X 1M2OB 2BMDA 1QHHB 5TARA 1US8B 2P0EA 2WIBA 1XZQA 2QQ0A 4JKIA 3TNFA 1D8TA 2BCGY 2J59A 5TVKA 1T3LA 2C99A 2GJAA 4KFTA 2C9CA 2XAUA 4PC1A 1KI2A 1DAEA 1HT1E 2WWGA 4JL6A 4PXAA 1OIVA 4D26A 2BM1A 1HEIA 1KYIA 5JECA 2OUKA 3HR8A 5AJVB 3W90A 1JNYA 4LHWA 3CNNA 2RAPA 2C04A 1CS4C 4MYUA 2RGNC 3G5UA 4JS0A 4X8HA 1CRPA 1OE0A 1GRNA 1AS2A 1RIFA 2ERYA 2OXRA 2FG5A 3KXKA 4Q1AA 1TL7C 4HYYA 3GCGA 4KLZA 2V3CC 4N0EA 5DSZA 1RRPA 2UKDA 3CZPA 3FKSA 3QENA 3SJCA 2QG6A 2QP4A 4P33A 1U9IA 1G8GA 2R9VA 2ZSDA 4JT2A 5BN3A 1P2UA 4KODA 3B82A 1UBCA 1KMHB 2NQ2C 4AKIA 1DVRA 1PZNA 2V4ZA 2Z4RA 3ETLA 4NMMA 1RPZA 4DDWA 4B47A 4Z1MD 2G1KA 1OB2A 2F1HA 4ARZA 2NO6A 4KU4A 1IXRC 1KI6B 4ZCMA 2CHGA 4PPFA 2EYUA 1CJUC 2CHQA 2FSHA 3BH6A 4LC0A 1UBFA 1CULC 1EFHA 1G8HA 3GLHB 1N0UA 2AKYA 2HUPA 4IXMA 3QKRB 1T3HA 2C2HA 1VYVA 1S3SA 4AIIA 2IYVA 3PCRB 3Q72A 3MMPA 1M74A 3A1VA 1YE8A 4Z54A 2AWNA 4Q4JB 1SXJA 1QHYA 1U90A 5BN4A 3BORA 4DZZA 1N5LA 2A7QA 4XOIA 1MO3A 3W8NA 3K09C 1G16A 4TYYA 1S4QA 1F3OA 1LS1A 2UZIR 4W9MC 3QJYA 3C5HA 3QF4B 2B7CA 5SZIA 1G7TA 3ICQB 1DAIA 4KI0A 3CW2A 4TL8A 1GL7A 3RC3A 2IYQA 4ABYA 1ZNYA 2IUUA 4PHHA 1NG9A 2Z6VA 1PLJA 2NOAA 4RCZA 4WAUA 1ZM7A 1SVKA 1ZM2A 2WVJA 3N2IA 3SHWA 4C30A 4AWXA 4US1R 3EPJA 2A5DA 3ZJYA 3KFXA 1VCMA 3DOEA 3ASZA 1SZPA 1CJVC 4D4KA 1DARA 4AG5A 2VP6A 2ZJAA 2QRZA 2QAJA 1K6MA 2UVQA 2P6RA 2HDNB 1VYTA 2L0XA 3JVUA 4YC7A 4CRWB 2GXSA 3BXZA 4QG7A 2CJWB 4MRRA 4LYJA 4CEJB 1E2EA 5FTMA 4LDJA 3VR6A 3QXHA 2QMHA 2QTHA 2PZFA 2NG1A 1JB1A 1GUAA 1GP2A 1XCGB 3PEVA 3OIWA 4URWR 4DEYA 2EFCB 2ONKA 3I92A 4Y0VA 1D9XA 5GVRA 4BPBA 2VHJA 2RCNA 1E1RD 3IO3A 2R6FA 5DLQC 4TL9A 2QEQA 3O8CA 4OL0A 2HV8A 2R6DA 3BB4A 5CM8B 3VR2A 1DAMA 2JJ2A 4WA7A 5B2ZA 1I4DD 1JR3E 2HF9A 1EFRA 4OBEA 3LH5A 2H17A 1OFIA 2YWGA 1L4YA 2ZQ5A 1N6PA 2QENA 2QAGB 4QHYA 1Q0UA 2JA1A 1ZIPA 1KAOA 3NXSA 5KNBA 2IS1A 4C0AC 1KO1A 4ZI3A 1S1CA 1NNEA 3C4JA 2F55A 1Q21A 2R6CA 3KB1A 5CIQA 1W36B 3FVQA 2GXAA 1MO4A 1G8PA 4QFMA 1OH8A 3H84A 4LUCA 4YDSA 1R5OA 1GG2A 4LPSA 4V03A 4LJYA 4R2HA 5AR1A 1P73A 2XX3A 3LLUA 4PANA 3JVVA 4BE7B 4WBSA 4XD7D 1KTVA 2EFDB 2Q9CA 2X19A 4GDFA 3QNUA 1T5LA 3T5DA 2ZI7A 3RABA 3SFZA 2QPTA 4B75A 3MWJA 2W6JA 4C0SA 3VNUA 1GITA 2ATXA 4PAMA 3EXAA 2CL6X 3U61B 4GRAA 2BIFA 3PENA 4FI3C 3NC1C 1T0JB 2FEMA 5FPKA 3IIMA 3RDPA 2AR7A 5EZ5A 2GCNA 3MWKA 2ZITA 2CEAA 5AJZA 3W34A 1MV5A 1DEKA 4OJQA 4DDUA 1VMAA 1P2VA 1ZM4A 5AUOB 4NDZA 4XWKA 1B23P 3KTAA 4RFSA 4Q47A 4IDPA 2R65A 3C8UA 3PG5A 1HURA 2QORA 4HAVA 3IIJA 1JECA 1ZM3A 2OXCA 2ASEA 3W3AA 2H1LA 2OHFA 4IRUB 3K0AB 3Q7QA 3AF1A 3BB1A 4OI0A 4PHFA 1D2EA 1E2MA 3KX2A 3AVTA 2TMKA 4POAA 3EPKA 1AJEA 1MABB 4KBFA 5FOSA 2JLRA 3FFAA 1M7GA 4V0MA 4B76A 2X1VA 3A37A 1QDEA 2N1BA 1F2TB 2E9SA 2RGNA 4JLNA 3AVPA 4TT3A 2QMOA 4D82A 3UKDA 1WBDA 3LBIA 3U5ZB 1ANKA 3QVVA 4LHXA 4OI4A 4QM7A 1GWNA 4BRUA 2QPAA 1Z07A 3CNLA 3AKYA 4CZ2A 4A2QA 2ZI6A 1W4AA 3GLHE 1CU1A 2G0TA 1ZNXA 2OLKA 3H86A 4URVR 5JI2E 3T12A 2XOKD 4I99A 1EX6A 2C8VA 4V0LA 3V4RA 3RAPR 3EIHA 4KBGA 4A0RA 3V00A 4QKQA 2J0UA 1WP9A 3KKPA 3QXXA 2IA5A 3MWYW 4Q1FA 4XWOA 4FMCF 4OK3A 1G7RA 2B6HA 4AYWA 1G64A 1Z0AA 1H8HD 2O8FA 3OEEA 2EYQA 1XTIA 1ESNA 1Z29A 2GCPA 2IWRA 5FTLA 4F92B 2NPIA 3AP1A 3GFOA 3IIKA 1JR3D 1J70A 4XTCS 4Q4LA 1GILA 2C98A 3AVXA 1OYWA 2VP4A 2XTMA 3B2EA 3I61A 2WPDD 4Z1MA 4DEXA 1G7SA 1XMSA 1P2TA 4C0KA 3U7HB 1NMYA 4IEIA 4QGHA 4ZPXA 1YRBA 1KHTA 6Q21A 2P5TB 4KITB 4ASUA 4DB4A 3GEEA 4UXIA 3E70C 1W0KD 2RMKA 3K9NA 1D5CA 3ZVNA 2ZRLA 5KSPA 2GCOB 5KSZA 3VX4A 1JQJC 1OB5A 1OFTA 5CLQA 3FB4A 5DO9A 3UK6A 3KTAB 5IRCD 2H8KA 2AK3A 2LWIA 4JJKA 4P4SB 1E94E 1DAKA 3BFVA 1OH6A 4V0OA 2VHCA 2REXB 4JYBA 4MITA 1VHTA 4ZCLA 3TE6A 5HCIA 4QBIA 1IXZA 1FMJA 4GMDA 4PC6A 4TSFA 4UQOA 1SVLA 2ZE8A 1IN6A 4OJKA 2ZUBA 3G82C 3IDQA 1E9FA 1TUIA 4M9XA 5J4HA 3GQBA 4CDGA 5B64A 3O8BA 3BJIC 3FPAA 2R2AA 4I1OA 3I62A 4BUJA 2XZPA 3NIBA 1QVRA 3KL4A 3CRMA 1YZKA 3AVQA 5EP4A 3NHAA 1N3BA 5P21A 5J47A 2G0NA 1FNMA 2AFIE 3BWDD 1E2DA 4GOXA 1HE1C 4HUQA 2DFKB 2F43A 2RHMA 4NCNA 4OK6A 3BD9A 2IS2A 2ZRIA 1D9ZA 2BOVA 1TEXA 1NVVR 3CRQA 3AV0B 5GJCA 2ZAOA 4DCVA 4QL3A 1G3RA 2HYDA 2VYFA 4FD2A 2YC2C 2XB2A 1KDOA 3BGWA 2MMCA 2VBCA 1CR2A 5LD2C 4TLBA 4AI6A 2CVFA 4M2LA 1NKSA 2BBWA 1SVMA 2JCSA 5HTKA 2BJWA 3PUWA 3I73A 4LJAA 3NEYA 4HUTA 3U7FB 2VP9A 2J0VA 3U60B 1G5TA 3EC1A 3NBFA 2DWOA 1KI8A 3LD9A 3VU9B 4BFYA 3LXXA 5JCPA 3LA6A 2W0SA 2GXQA 5F3WB 4L16A 5FL3A 1Z0KA 1YR8A 4FMBB 4LSGA 2QY9A 3VAAA 4PZLA 4U5XA 5JI3E 1KSFX 3CRW1 4TL6A 2O8BB 1RW4A 3L0OA 4DLWA 2BDTA 4F93B 2EW1A 1QRAA 3AKEA 1Z0DA 1WF3A 2QI9C 5CM9C 2HF8A 2KI5A 2Q9BA 1E79A 1BO6A 3C14C 1KK0A 1XTQA 5DH9A 4W5WA 4EFMA 3THXB 3R8CA 5D3QA 8OHMA 1W7AA 4M8NE 4AURA 4UNQA 4MGIR 2FSIA 2GILA 4JLVA 3ZZTA 3LW7A 4B3XA 4Q21A 3WBKA 1P60A 2FDCA 1JQLB 3CPJB 2G88A 4L5BA 4DIDA 1KI9A 2FEOA 4M1KA 2EQBA 3AKCA 5KO2A 5KPDA 2WWIA 4UNNA 4QNMA 3TH5A 1HT2E 1KSGA 3CF0A 3SQWA 5DI3A 4B73A 3RC8A 2PCLA 4HDOB 3I32A 3FKSD 1IY0A 2OCAA 3IHWA 2G1JA 3KKMA 4AYXA 4XD7A 3EZ2A 4KO8A 2VPPA 3CM0A 2O8DB 1VCIA 2YINC 3CKLA 1T8UA 4EIWA 5DN6D 2IF2A 3H4MA 1TAGA 3TUZC 3IEVA 3JZMA 3PITA 2CXXA 4JIMA 1NG1A 3WRXC 4CEIB 4EKDA 3CF2A 1U9IC 1GNQA 2SHKA 4JLDA 3X2SA 3A4MA 1SVWA 2BC9A 3AP2A 3ADDA 1VTKA 1HQYE 5DYIA 3W8RA 3K70B 5L3QB 3ZD6A 2HEIA 3NBXX 3T61A 4DHEA 5FTJA 1AGRA 4CEIA 4Q7JB 3SJAA 1E98A 1Q22A 5CB8A 4DB2A 2OFWA 4PZZA 2ZRCA 3IEUA 4F91B 4RVCA 3OESA 4E22A 2Z0MA 2N46A 4B34A 1YRAA 2I3BA 2QP3A 3RYTC 4F4CA 1DO2A 2QBYA 1FP7A 2IS4A 2NPFA 4NPHA 3TBKA 3FGNA 1U0LA 4QNRA 2CHVA 1DE0A 1LFDB 4RFVA 4GL2A 1ZU5A 2XGJA 3S1AB 1T0HB 4QGAA 1E9BA 1YU9A 2QTVB 1E2NA 4GZMA 4KXFB 1P62B 2RGAA 3EW9A 4PC2A 5DIFA 4CYMA 5D3MB 1DO0A 3MJHA 3UWKA 4TLDA 5CK5A 3CH4B 3F5FA 4B6EA 5IHPA 2I4IA 2VLIA 3AVVA 5JSZB 1S2MA 1NBMA 4YXWA 3GJ6A 3A8TA 4GFDA 2XZOA 4BEBA 5FBVB 3SYLA 1IN5A 2QSYA 2J45A 2QGNA 1R7RA 1Z6TA 2XXAB 1KK2A 2CVHA 1XCPA 3K0EA 4PQFA 4XH9B 2WMOB 1N5JA 2IWHA 1E1QD 2ERXA 5B58C 1KI3A 3N70A 4Q4HB 1UKZA 1Z2AA 2X8AA 4IOMA 4P0TA 4QRHA 5AUNB 1DG1G 4TYQA 3HPQA 1UEJA 2H92A 2ZVQX 4KV9A 2CLSA 4DLTA 4LI0A 1JR3A 3QG1A 3C16C 4YMUA 1N6OA 1W5SA 5KOYA 4LYHA 4DSOA 2O8CB 3EZ9A 2ZR9A 4BEJA 3EPHA 4EPXA 1JEEA 2D3WA 4LV5B 4YMTA 1T4GA 1NVUQ 1ONBA 4RZUA 1JJVA 1MT0A 1WE2A 2CJWA 2ODNA 1GOTA 3I3SR 4NP6A 3BIFA 2ZRNA 4KSBA 3RS0A 3WP0A 1ZIOA 3AF3A 1GIAA 4K81B 4P31A 4PPQA 5KDOA 2ZRAA 2ZXUA 2XITA 221PA 5G53C 3TKLA 3QE0A 1HUQA 2BHRA 2ZRFA 2FZLA 3AP3A 2QP9X 621PA 4CT5A 1XX6A 4B3FX 1FQKA 3K9HA 1OHHA 4BLTA 3I5YA 3A1SA 5JZVA 4ILEA 1WBBA 3QXJA 1G8FA 1V5WA 2D74A 3EA0A 4D80A 1Z6AA 3TVTA 4LBZA 1YR6A 3CUEF 1YKSA 4BFUA 1QVAA 1E9EA 5A0FA 4LPKA 1Q1BA 5JRZA 4IKEA 1IHUA 2OO7A 2OBNA 4C0JA 1X1RA 2ZR7A 3B1WA 2ZRBA 1R0YA 3QOFA 3ASYA 4WVFA 2GCOA 2NTYC 2VHUA 2YWHA 2B8WA 1E9RA 2G6BA 1SGWA 2AXNA 1KIMA 2GJKA 4M9SA 4DLVA 4A36A 3K8YA 3GJXC 2HJVA 3P32A 5E7JA 2VA8A 1KI1A 1GM5A 5C4GB 4D0LB 2C96A 2BM0A 4Q1EA 1N25A 3D31A 1WQ1R 3HPRA 3NH9A 1BKDR 4BWYA 2FMXA 3DKPA 3K1JA 2IXEA 4G5GA 1LVGA 2PEZA 1YZGA 3MG9A 1OH7A 4BLOA 2J9RA 3LY5A 4PZYA 1CEEA 2W2XA 3DKVA 3L82B 3ZS8A 2EVWX 1M8PA 3LBHA 4DT1B 3BERA 1P6XA 3ZVLA 1DAHA 5HZHA 1GL6A 2WAYA 4D0GA 3R9IA 2QA5A 3ZLJA 1Z08A 1E2PA 1HA3A 1G4AE 2YZ2A 5JCZA 5AJWA 1R6BX 1NL3A 1ZAKA 4BQSA 3QBVA 4EDHA 1W0KA 4RD6A 2XJ9A 2ZAMA 5JHHB 2JLVA 3VR5A 2IF0A 1JEDA 1BIFA 3THYB 1G18A 3KKQA 3LQQA 1NVWQ 2AKAB 3NEJA 3SN6A 3TSWA 3H1TA 3L8ZA 1X8KA 4LBVA 2F9LA 3ZZ0A 1G3UA 5F2EA 5TMPA 1QF9A 2ZSFA 1FTNA 2VSFA 1ZUNB 2FPKA 1VIYA 4R98A 5AK0A 2Q6TA 1MRNA 4DDTA 2BMJA 1XPUA 2RGXA 2F7SA 4Y0AA 5KNCA 4TQUS 4TMXA 1ZP6A 2P3SA 4M1YA 4DBLC 1U8YA 4B2IA 5JRJA 2RGEA 2QTFA 4XJXA 1ZVQA 1HE8B 4MKGA 4NHOA 3E5HA 3PFIA 2XEXA 3T5GA 2W6ID 2IHYA 3EARA 721PA 2IYXA 3QUSA 2WJVA 3ZVRA 2N42A 5JEDA 3HJNA 2AHOA 4OQMA 5KSOA 1IY2A 1OXSC 2DFLA 2ZYTX 5JMTA 1ZD8A 3HU3A 4I1SA 5LB4A 2IYRA 4HAUA 3TK1A 2GEVA 4LCBA 4Q5IA 2Z5FA 1E2KA 1L8QA 2R62A 5LB2A 4H9GA 5LD2B 2IYZA 1SHZA 1Z6YA 1OHHD 3I72A 3G0HA 5UKDA 5H1YA 1RE0A 4TT3D 1Q12A 3M1IA 1FW6A 2ZI4A 3A1UA 2F1JA 2CLDX 2WICA 5FUXA 1ZJ6A 4MYHA 1ZCAA 1C9KA 2Q3MA 1N6IA 3U2QA 4X8LA 2J7KA 4M21A 4XSGA 2CL7X 4ZIRB 4YDHB 2WKQA 5FR2A 3GFPA 1R0ZA 1R5NA 1S8FA 3HWSA 1Z2CA 3NG1A 4JLBA 4Q9JA 1J90A 2ZTSA 3GLFB 2NGRA 4D4LA 4DCUA 4C9BA 3WY9A 5EQTA 1AA9A 2IBMA 1KOFA 3ZIAA 2H18A 3EC2A 1XJQA 2FV8A 4K8OA 4A4DA 4Q9HA 2GDJA 1YHNA 2C03A 3TUJC 1QHXA 4LV8B 3OFNA 1OV4A 4V0NA 4EFLA 5FOWA 4PSAA 4QC2A 2PJZA 1UJ2A 4IXNA 5EXXA 2V7QA 1OFUX 3VR3A 4WW0A 4JLJA 1V43A 4OQFA 2JATA 3OIVA 4A0HA 1DOAA 3W5IA 3KQHA 1LS6A 4BLSA 1E4VA 2C77A 3T35A 1LV7A 5G41A 1II0A 4W5HA 2GHIA 3AKDA 3VMFA 1QG2A 5AJYA 2JDID 3LX8A 1NN1A 4M9ZA 1R8SA 4EQ6A 5K8UA 2CE7A 3WP1B 3P1JA 1XMJA 2WWHA 1H8EA 2KJQA 4URUR 2ZANA 5M04A 1QHGA 4M4SA 1LF0A 1ZMXA 3NDPA 4DLXA 1N0VC 3PUVA 2CL0X 1AN0A 3IUYA 2NO0A 3I8SA 4P3YA 3IPYA 3D6TB 1Z06A 3WNBA 3GLGA 5FUVA 2BEJA 4IOJA 4QOSA 1EFTA 1PV4A 2IX3A 2OEPA 1KJYA 3P20A 2QUZA 2JEOA 3AM1A 1CJKC 4R7ZA 2OZEA 1JAIA 2QT1A 2HXSA 2PT7A 4MRSA 3TW4A 4C2UA 3A1WA 1NBMD 2VF7A 2PLRA 2QROA 4ZI2A 1E6CA 2WWXA 3HR7A 2D7CA 2G83A 4Q9LA 1DBSA 1PLLA 1RJ9A 1QZXA 1RYHA 2QMUA 3JZAA 4M22A 5DN6A 5G40A 3RHFA 4DWJA 2NMVA 2FOLA 3IPXA 2P67A 3P27A 5C18A 4OQXA 4NCJA 4AK9A 5KNDA 1KJZA 2IXGA 2QT0A 3QXSA 5HZKA 1N6RA 2G3YA 3GLIB 2HCJB 1AGPA 1IJEA 4D4MA 5KDDA 5DI3B 1F5NA 4V0ME 2RB4A 3F8TA 3SZRA 4O2RA 5EP3A 2AD5A 1ZU4A 4OHYA 3PUXA 1BOFA 1U0JA 1XTRA 4L4UA 2FWRA 3LW8A 3KKNA 4G3XA 3U3MA 3OE7A 2ZU6A 2QNRA 4IVPA 2P5SA 1O87A 1H8ED 3WBJA 2HJGA 3CLVA 2DFTA 3WYFA 2BVNA 2E87A 2FX3A 1X1SA 4KSCA 4MDFA 2BMEA 1NI3A 1CBUA 1QHIA 2H57A 2Q0HA 1TQ4A 4RD2A 4LZZA 1N6LA 5F9FA 1RKBA 3LXRA 2D2FA 3A36A 2J5XA 2Q3HA 1G3MA 4RZ2A 4MRPA 4B43A 4JBYA 5HE9A 1II9A 2QL6A 2XNDD 1G5RA 3U3KA 1FP6A 4BLPA 2CCGA 1XF9A 3WRYC 2P65A 2QSZA 4O0MA 4HLQB 4JLKA 2OLJA 1FL9A 2VP0A 3DVLA 1IOZA 1E9DA 4B6FA 3LNCA 2DCUA 1PJRA 2ANCA 3FKQA 1I4LD 4KAXA 4A15A 4C2TA 4NCIA 1Z0FA 1F60A 2W6IA 4CW7A 2UZ3A 4ACAA 4A2WA 3B1ZA 1XDBA 3LQRA 4IFEA 1NLYA 2B7BA 4P4SA 4RJLA 4HZUB 4OYHA 1G3QA 4NU0A 3AQ4A 2A78A 4QJ3A 1N6KA 3B6EA 1KDRA 1LW7A 2X77A 2J0SA 4C0QC 3X1WA 3CR8A 4LC1A 2DB3A 2JLUA 2IYUA 4MDEA 4TWZA 2CCKA 4NBSA 1WMSA 3SE0A 4AKEA 1KMQA 4RFSB 3QPWA 1W36C 1JPNA 1E0JA 3WNCA 4H1UA 3M4YA 2WOJA 3K9LA 3WXMA 4BFZA 4JLPA 1ZCBA 3U3OA 4I81A 1KSJA 3B78A 2VQSA 4XVQA 3SHFA 3VFDA 1Z8FA 1L7VC 3GFTA 2DPXA 3EZFA 2DWQA 4YMVA 2MMGA 4WOPA 2Q9AA 2YVUA 3SBDA 2ZM5A 4URXR 4TSFD 3DDCA 4HUQB 4GOJA 2RGDA 3B1VA 4LHVA 4B3BA 3C5CA 4II7A 2WM9B 5B30A 1G3IA 4JLOA 2O8EA 3TSZA 3CBQA 1E2IA 4JZKA 4PSVA 5TB5A 5H8WA 3PJRA 4PHTA 3TGPA 1VECA 4XIGS 3K70C 4LK2A 3HDTA 4PAOA 2AD1A 1GKIA 1DAGA 4M1WA 4PO1A 5KYKA 1NRJB 2FFBA 1AKYA 1MO5A 4TTRA 2GJSA 4L15A 2ORIA 5E7IA 3I5XA 4Q02A 1Z83A 1XRJA 2HXYA 3DHWC 2C5LA 1SXJE 4HI0E 4BRWA 2X2FA 4DC9A 4H1VA 4NYJR 3KB2A 4O2LA 2RHDA 3CRRA 1EK0A 1RVDA 5IT5A 2ZI9A 1VIAA 4TN1A 3BH7A 5JLJA 1CIPA 3QIAA 1GTVA 3VNVA 4M1TA 5GJVC 2PMKA 2K5UA 1S9HA 4WXRA 3E1SA 3PQCA 2OBMA 3RRMA 4JVSB 2YV5A 4S35A 3C15C 4HLUC 1E2FA 5JFGA 5JJKA 4TQ9A 2F1RA 3BFKA 4HZUA 3TR0A 4EJSC 1IY1A 2VP2A 5AJXA 5IDVA 5FOTA 3PIRA 4TTQA 4Q4HA 5LBIA 1FTSA 4WZBE 2O52A 2WJIA 5EP2A 1JXOA 2KSQA 4MUBA 4QBGB 1UPTA 3KQLA 5E95A 4MKFA 3TVDA 2QU8A 2YWEA 3Q5DA 4Q1DA 1AZSC 2OCYC 4JBWA 4QGFA 4Q9IA 3A6PC 1AQUA 5J4LA 4DLUA 4EUNA 1XEFA 2FNAA 1ZD9A 4FWIB 3Q7PA 5BWMA 3RLFA 5JJIA 3R7WB 5C2JB 1W46A 3K0FB 2WIAA 4GT1A 3Q85A 3BAFA 4UJ5A 4B32A 2NO9A 1G5PA 3GJ7A 5FL7A 2HLDD 2GVDC 5L3VA 4CF7A 1EX7A 1MR3F 3CIOA 3SC3A 1ZINA 1D6JA 2AFHE 3WNDA 2ZSEA 3QI2A 4GP7A 3RRZA 4LJ5A 1CLUA 3OEED 1OKKD 2OG2A 5HPYB 1SQ5A 2PZEA 1A2BA 4PTLA 2CNWD 1MABA 2J7PD 1SVOA 1KDTA 2C9OA 3FMIA 4RD1A 1TEVA 5LDDC 1ZRHA 5L3SB 1KZ7B 1LNZA 2W2TA 3QF7A 4LJ4A 4GSYA 3ZD7A 2LKDA 3B9PA 3DM9B 3X1ZA 5H68A 3R9XA 2Q21A 4US0R 1D2NA 2KBFA 4MKHA 2FA9A 2BKUA 4HSEA 5A4JA 2W0MA 2IS6A 1KSHA 1BMFA 2WSSA 3K9GA 4LHZA 3RRNA 2QM8A 1WB9A 1CR0A 2B92A 2BKEA 3N2EA 4G0NA 4LYFA 4TLCA 4A1FA 5KSYA 1UAAA 2A2ZA 2ORWA 2ZR0A 1XCMA 1GKUB 3NVAA 2NZ8A 4FMDB 1NIPA 3OF5A 1S3GA 2ZJBA 1W44A 4ZDKA 2QE7A 5DYGA 3PVSA 3QPVA 2REBA 1YVDA 3I1FA 3TJZA 4TYWA 1GAJA 1P61B 1KY2A 4B48A 1J2JA 2YYZA 1Z28A 1U8AA 4L8GA 3IO5A 5JSZA 3UG7A 3B1XA 4OQNA 1G20E 2OFXA 1GRQA 121PA 2GZAA 1KNQA 2GEDA 3GJ8A 2XXAA 1FOEB 1A5TA 1Q20A 3RVBA 2PBRA 2G77B 1XD8A 3W6OA 3IHLA 1P72A 1ZYUA 5AUPB 3U3JA 1E99A 3AB3A 2IYYA 4GPTA 5CDFA 2PJRA 1NSTA 5HR5A 2EWWA 4AG6A 1XBTA 4I1UA 1W47A 2HT6A 1FZQA 2YOFA 4UNSA 4TL7A 4MGYR 2GZHA 4IOLA 2DHRA 2GXUA 2B21A 3T1TA 2WSMA 4AYTA 4Q7LA 1XMIA 2FH5B 2ZYVX 1QHNA 3F3YA 4A8JB 1DELA 1NF3A 3B8HA 3CX6A 4R71A 3REGA 4P32A 1Y63A 2ATVA 4LRWA 2O8DA 3DEFA 5JJLA 3HU2A 1EFRD 1HTWA 3VTKA 3QY0A 4A0FA 5IF9A 4XVUA 1M7BA 4E07A 4E03A 2ODBA 4HB0A 2W83A 3O47A 1OXXK 3ONWA 3KXLA 4ZDWA 3RS3A 1KMHA 2NIPA 1Z22A 2RGBA 2VHTA 3MCAA 4OHXA 3SNHA 4CEHA 3B1YA 1Q1EA 2KWIA 3EIEA 2YKGA 4N0DA 3GPLA 2OE2A 1D2MA 1NSFA 4FIDA 5DE3A 4AC9A 3X1XA 4DJTA 4B71A 1S1MA 2MSDB 2V8OA 3AUXA 2FZ4A 3O8DA 5BXQC 3DPUA 1P7CA 3F0TA 1IN8A 2GVZC 2A9KA 2REOA 2QN6A 3T15A 1R5BA 4YMWA 2KE5A 2QRNA 1A82A 1GFIA 1AKEA 5EXSA 3EWAA 5TXGA 3AVWA 2QPOA 3B7GA 1U94A 4XWAA 3PR1A 4LV6A 4LOAA 4ZDJA 5J4KA 2XTNA 5EZ6B 1U98A 4A2PA 2CDNA 3PUZA 4J0QA 1UF9A 2RGGA 3S1AA 1TADA 3BE4A 3CRVA 5FR1A 4JSTA 2PCJA 1Z5ZA 1P2SA 4RZ3A 3TRFA 1A4RA 4XVRA 3RWOA 3VU9A 2ZS8A 1IQPA 1XD2A 1W5TA 1KNXA 2MSCB 2VSOA 3VKHA 1ELOA 2YJTD 4O25A 5FOXA 3ZIAD 3OEHD 4EPTA 1ZD1A 4ZV4A 5CJ2A 1UKVY 2WJYA 4BGDA 4Q9KA 1YZQA 1XTSA 3U4QA 3VKWA 4TZ0A 4EFNA 4MRNA 4CGZA 4QGGA 1UBEA 2BEKA 4ACBA 4EAQA 3EWSA 4PAQA 2IEZA 2IC5A 1SVSA 1N6HA 1N0WA 2VF8A 3H2YA 4KLNA 5FFMA 4JSYA 3W9YA 4DXAA 4EPYA 3EX7C 3UANA 1E79D 2W00A 4UNPA 4KYUA 3PEWA 1UDWA 1KY3A 2JJ1A 3W5JA 4PHGA 2IL1A 3BOSA 1XPRA 4DCTA 2CCJA 3LBNA 4HATA 3DOFA 1II8B 3I8XA 2QAGC 4IEEA 1ZM9A 3FE2A 2VSXA 1Z47A
chains in the Genus database with same CATH superfamily
4CQMD 3CO5A 2AOTB 3AV3A 1APBA 5IW8A 4X63A 5FTNA 3O4FA 2WKRA 1FFSA 3VO9A 1R9JA 1KZGB 4Y6OA 2IZ6A 4L51A 4CIDA 2GETA 3GJTA 1VA4A 2GJ8A 3DJFA 4O1IA 4JL8A 5EGSA 3PQEA 3MYRA 2HWYA 1TMOA 5TMEA 2GESA 2KQUA 3UMRA 4DAEA 3PTAA 1COWA 4JUAA 4WKCA 1L5NA 2LZ0A 3UICA 1U7TA 4DCNA 3DQQA 1VRVA 3IBCA 1B8VA 1J99A 2C31A 3LT0A 1PJAA 1PVDA 3KIPA 1C9JA 4DLNA 5KPJA 2I4LA 2ZIAA 5FOVA 1T3ZA 3LK6A 2OBXA 1JEJA 2XE7A 1QTQA 3JAWB 5CA0B 3OHMA 4JC8A 4KQIA 1NNUA 1WBJB 3HU5A 5G3YA 5KC9A 2OAQ1 4PR3A 2XVXA 1ZUIA 2A0XA 2WZQA 3OBBA 4CJXA 3LO5A 1PGNA 4IXDA 2QDXA 3DO8A 2CNWA 1MFPA 2O8BA 1WMAA 2YW9A 3MF4A 3N1UA 5LQUA 1T3GA 1RM4A 3SR3A 4C2AA 2MINB 1FTGA 1VG1A 2HI0A 3RH0A 1Y4DE 2OZLB 3U6BA 1WDTA 4H7JA 2H48A 5F35A 2HWWA 3ROKA 5BW8A 2XCRB 2DKOA 3TLMA 2HYIC 3CNOA 5EE9A 1TVEA 1HE4A 3U4QB 2DT8A 3ENWA 2Q3FA 1W6UA 4L2IB 2GJ4A 4UE3S 5D2CA 5E6SA 5EKSA 3V1TC 1CT9A 1GA4A 1QOPB 5ITZB 1SKMA 1KKMA 4Z0NA 3AVUA 1XNRB 2YHBA 3I9NA 1Q84A 3RBZA 3OF2A 2VEDA 4AF8A 1TKAA 3GEGA 1MZPA 2Z83A 4A8TA 3CNBA 4BFXA 1FNNA 1QO0D 3ZKAA 4JMPA 2GLXA 1SXJC 4EKIA 2EJUA 4EWLA 5CYOA 3ZJTA 2R8OA 3WMGA 4EY7A 5FD8A 4UOEA 1M0EA 1BKSB 4UUPA 5EMLA 5FA5A 3OLQA 3ND8A 2R7KA 1Q7EA 4FXPA 1WPXA 4O0LA 1Z4LA 4BO5A 4E7OA 1TQHA 2P9QA 2QQFA 2ZUCA 3EYAA 4MOWA 4DSUA 5C52B 3PGA1 1D2CA 1T9HA 2H08A 3SJ7A 1S7CA 5FI0B 2EFYA 5JQGA 4UASA 4DT1A 4TOIA 2J7PA 1OYYA 3TW8B 1P3JA 4O3MA 4BKPA 1PJ8A 3LYHA 2YXBA 3WLOA 4JT8A 5H3HA 2FX2A 2PZJA 1OV6A 4MCHA 4RK5A 3RU2A 5B55A 5BSGA 1AHNA 2O8EB 3FFBA 1A96A 2VJPA 3A9WA 1AV7A 3AEQB 3NBQA 5COBA 4K6CA 4JBGA 2XSZD 1RI2A 3REQB 2PGXA 2X6RA 3L0DA 1JU4A 4MULA 3K0BA 2ZKLA 2XWQA 3T6KA 3MWEA 3H4VA 4XXHA 4ALKA 3OI7A 1XTKA 3LT4A 4W6ZA 1QIDA 2A5JA 3DMTA 4KO4S 3KXDA 5FL7D 5KAPA 5TX7A 5I7FA 3J81A 5BW5A 1E77A 4EH1A 4I1RA 4MQFA 2PANA 1PT7A 2CLEB 3GV0A 4DQVA 5J3JA 1NQ5A 1U7DA 1W36D 4HSGA 1I5RA 5D3ZA 5C9ZA 4NZMA 5ECDA 4G25A 2OCLA 2XIJA 3QEAZ 2J3JA 3UWDA 3W7BA 3ANSA 5BWLA 4OLAA 3QKUA 3U49A 3WYEA 2BI8A 3EG5A 4WZ6A 4AMZA 1J8YF 2RGYA 1N0HA 1IN4A 2YV1A 3L0IB 1TM3E 2IPXA 3JSXA 3GP3A 4QU5A 4K88A 1LVUA 3PUJA 4RK7A 4BUCA 1MAWA 4IQGA 4QXMA 2MSLA 1Q0TA 4C4PA 3LSYA 3CWQA 2XYVA 5K4HA 2VAPA 1DKOA 3HKBB 4Y2XA 5JZBA 1CQJA 2I2AA 2A67A 3EXEA 4GECA 2V9PA 1IJBA 4KGZA 5J2TA 2AOWA 3BRWD 2I2CA 5EJEA 1P7YA 1NUQA 3IEXA 5DHFA 1LBIA 2YWBA 1XCLA 4IDNA 3EG9B 5EJFA 2BKLA 4RHYA 1S8NA 2PZGA 3IDOA 4O4JB 5FV7A 3IOMA 3ILYA 4LRQA 3WNZA 1I4WA 2AOXA 1G4HA 2CXSA 1NC3A 2H54A 1OPXA 3HC7A 3KRTA 3AZPA 4ZV7A 2CDAA 2PX0A 3VR4A 1VIDA 4HAZA 3UFBA 1Q92A 2OD7A 1E3MA 4IQ0A 3GN1A 4MRAA 5BNWA 3DTYA 5ALPA 4EGSA 1W8DA 3EUAA 1FC0A 2AZDA 3ABOB 3M6FA 5TQVA 1L4NA 3SU8A 1E4EB 2PR2A 2ZRJA 1E1QA 1CE8B 4CV3A 2ZRGA 4NMHA 3PHIA 1A69A 5EKDA 2JKVA 3A4IA 2GK6A 1DV1A 3IURA 3JS5A 4O4LB 1KK3A 1WG8A 1YZNA 3N28A 1X8LA 4ME6A 1OX4B 1KU6A 1MB4A 1NYLA 3B5JA 2X0DA 3TOZA 2O8CA 1RQXA 3CH5A 5C1DA 3V6LA 3S1SA 1T6ZA 4WE3A 3R77A 4MQMA 4RCYA 3IGFA 5CJPA 4ZQBA 5T4FA 3WQHA 3D3WB 4CLRA 2ZAYA 3AR4A 4QIHA 3SYTA 4L07A 4D3YA 1P7WA 4GPIB 3M3DA 2ILVA 3C3XA 4NC9A 2OSBA 2ZJ5A 5DBEX 1KOGA 4A23A 1T1JA 2XB4A 4K26A 3GP8A 4JI0B 2HWXA 1UM9B 1EXWA 3B3AA 3D3QA 4NV0A 1Y98A 1I9CA 2W6OA 4JVLA 1G17A 4M0DA 2ZYIA 1A9PA 3L1JA 1A9XB 3F6SA 3ZNOA 2JIMA 2OXFA 3ICWA 2DBZA 3LWNA 4N54A 3CVOA 2HU5A 4WK4B 5DWDA 3WGHA 5J5CA 5CFPA 4DOMA 1JMVA 3K96A 5JCJD 3D6MA 4MA4A 1KYVA 2HWUA 3O4RA 4AXXA 1EWQA 3HY6A 4X6UA 5ELXA 2BFCB 3H8VA 1XDUA 1WUTA 3WGYA 1W30A 1E5VA 2PIDA 3M6AA 5DM1A 3SQOA 3TX6A 2CXQA 2PQ0A 2NO7A 5MGBA 4R16A 2B1QA 2O5VA 4EMSA 3HFGA 2I67A 1X77A 1DKLA 1B1AA 5FPHA 1SVUA 3IAM1 3SC6A 3U37A 3ADCA 2FFJA 3L1KA 3FHTA 4A27A 1R8JA 4RSMA 4ERXA 3QKRA 1XE3A 3QSGA 2EFEB 5KYWA 3ELYA 1UFQA 3FZEA 4FZVA 2E55A 2ZSAA 4CKBA 1T0UA 1JE0A 3DC7A 3VTZA 1O0BA 4EL0A 1Y3BE 3NOXA 2BP7B 2CNKA 2FPMA 4Q4JA 3AJRA 4BCDA 4MR8B 4DMKA 1LK5A 1T8TA 4YV2A 1OH5A 1JS1X 1V5IA 2CNNA 2HJHA 1NATA 3LGXA 4IDHA 1GZHB 4E0BA 3KCQA 1A7JA 2ZWOA 3R20A 5GJBA 1JEYB 4XVCA 5B6IA 3E53A 1KOJA 4DUPA 4YUXA 2WV9A 5JROA 3UC5A 1M9NA 4QAQA 5AO9A 4ZGGA 5KU7A 5JXJA 1E2GA 2ET6A 1RRCA 3ESBA 1N5KA 4LXYA 2WAXA 5FJJA 5EWMA 3LDAA 5B1HA 1MF7A 2O48X 3IAUA 4J0HA 3TTVA 3DEJA 1YCFA 3ZHYA 1L7OA 2HCBA 4PLCA 4EZIA 5C7LO 4B3MB 1B73A 2DT5A 1RHQA 1II8A 2R8RA 2B83A 3DBRB 4YJDA 4B3CA 2YBDA 2YJGA 4ETMA 1DC7A 2WJWA 1IPEA 2H4FA 4EYKA 2O4CA 3GLIA 1Z6XA 1YKFA 2AC4A 2C2GA 1UZAA 4L9SA 4UHCA 4X6YA 1JLRA 4KJZA 5LIRA 4CEJA 4BNXA 1DQPA 2ORVA 3O74A 2PL1A 4D5GA 1P8JA 3SHVA 5A5EA 2WYHA 1GY8A 2OMEA 3KS9A 4EVIA 1GSIA 1RWKA 1U5BB 1KC3A 1KZ6A 3NWJA 4RMHA 1KEEA 2QAIA 5JWOA 1OF1A 1YRHA 4KQ9A 1YIOA 2XUPA 2NUBA 1IBMB 3GFGA 2P40A 2PKXA 5A6SA 5I5GA 4DLZA 1VI5A 2FW6A 3BUSA 5C8YB 2Y1DA 2PYZA 3SJZA 1GPDG 2PXCA 2F8TA 2QAGA 5CB6A 1JI0A 3S3TA 3NKVA 5CK4A 3REFA 2ZE6A 3VKGA 1BKYA 3TMYA 3WKEA 4ZARA 1V5GA 3D7MA 3ROQA 3PX2A 1M6YA 1LB1B 3JYHA 3ND6A 3IV7A 1L4UA 1GCOA 4GNKA 3RSOA 4BGVA 4U00A 3GCZA 4YP7A 2EDCA 1USVA 3N0WA 4IP0A 2FGJA 1UC8A 1NMZA 2R44A 3IQWA 1OW3B 1M2WA 1BDBA 2EJVA 3AEYA 3HDJA 3JRWA 4HLUA 4OQPA 4PVDA 3FW1A 2G5CA 2AQ8A 4AD8A 4F86A 2VDOB 1PK8A 1H2HA 2GUGA 4HNHA 1ISRA 1IOLA 3BB3A 3V34A 1YL5A 1IVYA 2YUIA 5HVNA 3TQFA 1KPIA 2INGX 4KKXB 2ZSBA 4NJEB 2NU9B 1XU4A 2GZDA 1PGPA 3EGIA 4R2LA 1O7JA 3X1JA 3ZDZB 5JD6A 4MRVA 4B7XA 5BUSA 4OOFA 3WJ1A 4YUAA 3LX4A 2J9XB 1G8YA 2XYRA 4U6QA 2ACKA 2V7TA 3PKZA 2F4VB 3I23A 5CX1B 5DU2A 4EYGA 2H5LA 3KJHA 4MVWA 4HZIA 2R96A 4EG5A 1JSLA 5DOVA 2HJRA 4ZO6A 2V9CA 4AECA 1IZ9A 1O96A 3HCBA 4HFJA 4B3DA 5EWMB 4D0NA 4E33A 3OQNA 1UKEA 3ZQ6A 1UJNA 4BWFB 4UMFA 3HACA 4KXVA 2ARKA 2VWPA 4DA4A 1A2KC 2EIHA 3G5AA 3M6UA 3PD7A 2VJMB 2HDOA 4PNHA 1NW3A 3ETNA 4Q66C 3CKMA 4DILA 1TCUA 3Q3JB 1NN5A 2GWHA 3E35A 3FMPB 4BC1A 2FPLA 3FD8A 4JU9A 3JYLA 1ZIXA 1YDMA 4B40A 1YOBA 4BL5A 4WN9B 3QHPA 3W4JA 3U7GA 4L8LA 3T3MB 3DMRA 3BG5A 4E4YA 4EHIA 4H3SA 5K0SA 1DPFA 4IGEA 2Z8ZA 1AUVA 3PGVA 1U5BA 2QVXX 1EINA 1U0RA 1VLMA 4BNFA 3IH5A 2GZRA 5EHXA 4LDRA 4P3KA 4EGFA 1UDXA 4XUEA 2QZZA 2C97A 2UYQA 2Y1GA 5L8VA 1W35A 3VU0A 2KS6A 2PBFA 3K70D 4L0DA 4ZVLA 4CMBA 4WIAA 5DSXA 4EG0A 1ZRNA 5JD5A 3HKCB 2O2HA 3OPMA 4G0ZA 3TTSA 3DMNA 3HMKA 1V39A 2HIAA 2OL4A 2GX6A 4FE4A 4FQ7A 4FCWA 2YRFA 4R6WA 1FYEA 1NXSA 3PK0A 3A58B 3WISA 3K0CA 2JGEA 4IOKA 1RI1A 4IUCS 4TQAA 3U7IA 2JLXA 1RABA 2DUNA 3QKTA 1ES9A 4KQKA 1QCZA 2PMDA 5KU1A 1N2SA 2FW0A 2VT3A 3LZ6A 4X3PA 2XVAA 3UA4A 1FLDA 5HHTA 3PT9A 2IV2X 4KQFA 1PZXA 1UBJS 2PEYA 1BHO1 1P1IA 3L8CA 4R1MA 4ZCQA 5EUMA 1ZH0A 1KFJB 1WW8A 3FOAA 4OXNA 3WLEA 4K6OA 2R8XA 2B8JA 2EWVA 5FPTA 1CFJA 1JNXX 1V6SA 1SCBA 5WRFA 1FF9A 1MMFB 2FB9A 2W4MA 4C0LA 3OM9A 4F6RA 3MD0A 3AUKA 4X7PA 3R8XA 4PNEA 2ZW9A 4LBWA 1TLFA 2EP5A 3R5FA 3BL5A 3O03A 3ZQUA 4JR0A 4FCVA 2ZPTX 3VI3B 2EP8A 1GO2A 1LBTA 3DA8A 2CLCX 3FDIA 1A71A 1NF8A 4LSZA 5U9CA 3NC0C 4P7GA 3WLFA 4S1OA 3CCCA 2EZUA 3AT1A 1FNDA 1MG0A 2BFFA 3L40A 4A6PA 4BO1A 4TLAA 1E3IA 1FNBA 2Q5CA 1ZL2A 3CTMA 2HO5A 3KYCB 5FA6A 3PLAE 2XKJE 1C4WA 1P1BA 3EZ6A 3I9JA 4B74A 1G20B 1NKVA 3G6WA 2QKYA 3EDYA 3OU7A 1CP2A 2DHEA 4FBGA 2QG9A 4RF3A 4Y6PA 1U3UA 2JARA 3PFBA 4Q01A 4DV2B 4FQ8A 4G67A 1FP1D 3JZFA 2OHOA 1JGTA 3VC2A 5FFNA 5A4DA 1JT2A 2ZKIA 1OLUA 3O3MB 2YJ3A 3R7WA 1KYXA 5BT8A 1XPOA 3K2QA 1VJRA 2G9ZA 2BV3A 2AX4A 2RJNA 2K87A 3C7CB 1KFBB 2VDNB 4K7JA 4ZXPA 4KQ1A 4OKNA 1LTQA 2V0CA 3V48A 4RYLA 1E66A 2XD4A 4ARIA 1MAVA 5EJ2A 5KTOA 4JSRA 4F85A 1KHHA 2IT1A 3P0HA 1U3WA 1EIZA 3RYFA 5K0GA 2VHZA 4B3TB 2W22A 1ZWKA 4Y1GA 1I1QB 1H4QA 1EUQA 3LLCA 5BR7A 3OJCA 4GMXA 2Y1KA 3RWMB 4LE2A 4PS0A 5LQKA 5CAEA 3SQXA 1CUVA 3UUWA 2OAP1 4YRPA 3UT6A 4MI9A 2GERA 2JIQA 2PSJA 1Y4UA 1A77A 3BTSA 5JC1A 1H93A 5FPYA 1PJQA 3MJRA 4R1NA 3ZGOA 1Z36A 1YGPA 3PDWA 3PUHA 1U8ZA 3SX0A 2EF1A 4PNPA 5C4MA 1KXJA 3WFJA 1KQFA 1C7ZA 1EWVA 1TXGA 1G21E 1TI7A 3LFUA 3RF7A 1GPJA 4EKEA 3BRCA 3OAAA 4YAFA 1E6KA 2WLTA 3I01A 4W5JA 4AKHA 3G2QA 1IU9A 3SSNA 3VMMA 4DN6A 1AQYA 2BFPA 1CF2O 4OPMA 2JI8A 3STHA 4LHYA 5C53B 1JR6A 4YBRA 4ZK2A 1JQ5A 4KCGA 4MLZA 1P77A 1UKYA 2E1RA 1BMFD 2WSSD 2YL2A 3C41J 1LX7A 1U8FO 3H13A 4GXRA 5DI9A 1DT5A 1NSYA 3A6GA 2DYKA 4D2IA 2I0FA 4TPKA 4B3RB 1Y7LA 2DBYA 3UV7A 3HYTA 4ESVA 1YQTA 1H4TA 4RA9B 4GEGA 5K0LA 3H2BA 2FY8A 3STWA 4GP6A 3WSTA 1X2BA 1T3SA 3IBSA 3RUAA 3VHXA 2X40A 2XCSB 5B4TA 5LUAA 4MKRA 2B37A 4HTFA 3SY8A 3TWOA 3R9WA 2W2KB 5E4FA 2B4RO 4M0PA 2QRGA 4JLAA 4LYAA 5ILQA 3VDNB 3PTZA 5EKUA 5F78A 5JWRA 2GEUA 3K1AA 1YRQA 2G08A 2O20A 4LJ7A 4O8ZA 3AVVA 4K8RB 4CFYA 4F8JA 3H75A 3W77A 1KK1A 4NMXB 3RRBA 3U7QA 1JHQA 3GYBA 1NRXA 3IIEA 4N8EA 1O0CA 1KAGA 5BOVA 5BV7A 4F9TA 3TXYA 1MJGM 2DLCX 1QE3A 4N7RA 5ARCA 2IW3A 2Y1CA 5IUNC 3CG0A 2VHQA 1DJOA 8OHMA 3RUIA 1F2TA 2WP0A 1I3NA 4EG6A 1KAHA 1DRJA 4DUGD 2O0JA 2XRZA 3ZE9A 2Z5VA 3C3WA 2V7VA 1JXAA 2V7WA 1Z6GA 4FYPA 3U7EB 5ADWA 2C9MA 3JQ8B 2W6JD 3NXKA 3CF4G 3N86A 5EMMA 5DM60 1JVSA 2O2DA 4EVSA 2WFAA 1TUGA 4LRXA 4TV8B 2ECFA 4PO8A 4RZSA 2WWFA 2QZ9A 3IC5A 3ZY5A 2Y3IA 5B7PA 5E9AA 5FL7A 2GKSA 3C6ZA 3HG7A 3IBYA 2HZ7A 3AGQA 5DTRA 1ADFA 5SY4A 4C22A 3Q7RA 3X1YA 1Z0JA 2OKGA 2RHOA 5LP1A 1T9BA 4FTWA 2G4VA 2NZXA 2Y1XA 1XFAA 4RH0A 2XDWA 5HNKA 4YMSA 3EBOA 3H2GA 5BVHB 4GOOD 1KVUA 3QEMA 3HGTA 3UAGA 4OMDA 4AT1A 2RDMA 4OB8A 2JZOA 3A1DA 3TUIC 2JNWA 2PX8A 1LQTA 2F59A 4M46A 3NM5A 1F48A 1WXQA 3Q5EA 4PGGA 5HOQA 4IGAA 1UPXA 2WQZA 2X8LA 4OI2A 1SIOA 4BQEA 4OIFA 5KQMA 4MW2A 1VJ1A 2ZTVA 3IELA 1MCZA 1JJBA 4B6JA 5B6PA 4HQ6A 1B41A 1B8NA 1VGRA 1UOOA 2NNLD 3QVGB 3UG6A 1CJTC 3UHAA 2ONZA 3C3PA 1WMFA 4JVNA 2A1IA 1OILA 3GJ3A 2YWDA 1YVEI 5C8YF 1KJQA 3QKSB 2E0IA 1F0KA 2XLBA 1S2IA 2YWXA 1Q1ZA 1SC3A 2KBEA 3JQBC 3EDOA 2HU2A 2OFOA 4X84A 4E4TA 2GYYA 1VG8A 1EVYA 3QF4A 4KHZA 2QY6A 2WHYA 4BNWA 4UCXA 2GAAA 1GNRA 5GADl 4BVEA 1IM2A 1CETA 2DSTA 1TNDA 2BDEA 3ILXA 1TMKA 3HP1A 3KZXA 3O73A 4WCVA 5TQJA 3AF4A 1C0PA 1OT3A 5DNUA 4BO7A 3GR6A 4UMDA 4FT2A 4B7AA 1PNRA 1EG7A 3A70A 2B69A 2GD0A 2ODEA 4HYQA 2W5UA 3PV0A 3KKLA 3KZCA 5JXIA 3R4VA 1W2WB 3ADKA 1CY1A 4HNUA 2C4KA 1GFWA 1YCDA 4QUBA 2ZYWX 2ZJ3A 3RFXA 4ND8B 5BWOA 3ZLUA 4YCLA 3M33A 4L76A 5K3FA 1C7RA 1N6NA 5SZKB 1KO5A 1DWOA 1B0ZA 1UJMA 2XTZA 4P1ZA 1MOSA 2A0UA 1E1RA 2H7YA 3G9XA 1JDBB 2PWZA 3KALA 3T7TA 3JQCA 1W1WA 2QJRA 5JO0A 1GG8A 1K3TA 1GKYA 1JJ7A 4H7EA 1J7JA 5EHGA 5J23A 2KB0A 3UMCA 2A6PA 5DTIA 2Z08A 4QUAA 4C2BA 3UJBA 1GTZA 1KI7A 1VRWA 2CBXA 5KYVA 5LA6B 4KIJA 4O29A 3ZWMA 4AQYB 2ZRMA 1E9SA 3OPYB 4KGXA 2ZE7A 1CZOA 5ARDA 3ROFA 2DR3A 4WZAE 2VDKB 2C58A 2BGGA 3PWSA 1XB2A 3TDMA 3EH1A 3MTDA 2DFNA 3ZZUA 3MWDA 4EHBA 2A9OA 4RF5A 4Y6SA 4H1WA 1RFLA 1XEXA 5JS7A 4IIUA 3D3JA 2IUFA 1Q1AA 2YOGA 1VL2A 1KI4A 2BJVA 4TXLA 3AR6A 2BZSA 3I12A 4L8VA 5FBRB 1HM5A 1FTYA 2Q7DA 1NPDA 4JJ6A 4O5OA 2G04A 2AFHB 1G6HA 3L2OB 1DQNA 2P9JA 1X9IA 1G66A 3DF9A 1VE5A 4L5JA 4MVJP 4JI7B 1WRBA 1YMVA 1G2QA 1N5MA 1S9DA 2H0AA 2JFQA 4N12A 4GLOA 2W2PA 5EFOA 3QVUA 5L3ZA 2BBTA 1OAKA 5AW7A 1JHUA 1XVUA 3GCWA 2FN4A 3C6QA 3PHBE 4XEUA 2F6RA 1KI6A 2JCYA 2JIOA 3TLGA 1G8KA 1V1RA 1RFGE 3S5JA 2ZSHA 4L1KA 2AMYA 4V2IA 4DDVA 3NI2A 3B7PA 3ZGXA 5JCXA 2FSFA 5LR6A 3LF1A 1VL6A 1A0OA 2OBLA 2PS3A 3A4LA 2X2PA 1XD2B 1UWKA 2QPLA 1QKIA 3KT0A 4JX9A 4OHBA 1JRLA 3INGA 1OFUA 1U2PA 1UMBB 3N7AA 4BN0A 1WXEA 5K4GA 2JFVA 4DVGA 4HAWA 1RPTA 4U02A 1EJ6A 4ZYUA 4D81A 1YULA 2FFHA 3H2ZA 3RWBA 2XKBA 4J3NA 5D87A 2XWPA 3Q7EA 5LDGA 2DTXA 2D7JA 4OYRA 4NJEA 3AY6A 3F78A 2R7LA 2UAGA 2CE2X 2K2WA 2V96A 2BMDA 2ZVDA 3EIFA 4HDSB 3NZEA 3X43A 3FGPA 5TARA 4F3CA 2WIBA 3R74A 3TNFA 3LBFA 3VA7A 4L9AA 1V8OA 2NU7A 3HRHA 1HX7A 1Y8CA 2AJDA 3H9JA 5I7SA 3DE3X 1UXGA 4GG1A 4LYEA 4PC1A 5TT0A 3FNHA 3FVVA 2CJPA 4AY5A 1DAEA 4EGJA 4ZCSA 1CY8A 1OYVA 1ZA2A 1ULBA 3AWDA 4YX9A 5JSHA 1Q19A 4UM5A 3MELA 1NUUA 5JECA 1KYIA 3LE8A 3LUCA 3KQQA 3QWBA 4Y6LA 5AJVB 3ZR4B 5B7NA 1DO8A 1K75A 3W90A 2Q6LA 1RLTA 1JNYA 3PF8A 4IPTA 2HLHA 2BKVA 3CNNA 1CG6A 3D0KA 2RAPA 3MTGA 4DV7B 3SD7A 1B3BA 3G5UA 4ZMBA 2QIOA 1BXRA 4TZKA 1WZEA 3MOIA 4IG4A 4HGQA 2OXRA 2K7FA 4CKZA 1TL7C 4KLZA 2V3CC 4BIMA 1RTKA 3ETEA 3CZPA 4LOKA 3SJCA 2QP4A 3U13A 4FYIA 4I4CA 1G8GA 1K97A 4XGQA 5AKKA 4MMZB 1O9HA 2ATIA 1ZIDA 2NO5A 2HZBA 2I3DA 1UKBA 2JJMA 3K4PA 2HBRA 3R3HA 3RFVA 3KEMA 2H1WA 2NQ2C 3VC7A 5DGIA 5ESRA 1XYYA 1PZNA 2Z4RA 4IDDA 5FUQA 4NMMA 3R3VA 3UAXA 5DTMA 2OORA 4B47A 1XWWA 4Z1MD 5CPBA 3K8ZA 2F1HA 5AVQA 3EEIA 2BTQB 4XGNA 4CCAA 1RJFA 3MRXA 1N5OX 3M1LA 4ZCMA 4UCFA 1QPZA 3UAVA 2CHQA 3KYDB 4DR1B 3WDKA 2OO3A 2BFEB 3DE6X 3P9CA 1UBFA 3Q3GE 1ACMA 3D7KA 3OQPA 5D3KA 5DXFA 4LVNA 4Y2YA 5EMKA 2NUTA 1RWPA 4HKTA 2P69A 4JI6B 1LJ8A 3VBCA 2CD7A 1A5AB 1UMCA 1W29A 4GX2A 3IAHA 4YJKA 1NV9A 2IYVA 2L82A 1P2GA 4L4YA 5GOZA 2CXOA 1ZGZA 3FUCA 3JAKB 3Q72A 5ESWA 5GY7A 3LCVB 4JUCA 2AGVA 4JOCA 3TQIA 1QHYA 5BN4A 4Z4FA 1MEEA 1QIKA 4FM9A 4OAOA 1ECFA 4RQBA 3K09C 3PS9A 1GKLA 5BNZA 4MDHA 1YQUA 2Q27A 2NTJA 1F3OA 4FS3A 3AESB 3FHLA 3HGQA 5JJBA 5JS6A 1MEOA 1R64A 1Z0ZA 3PXXA 4L7VA 4W9MC 4ND3A 3FZNA 4V0RA 5SZIA 3DR5A 1G59A 1JEYA 1E7YA 3O8LA 3DWEX 1G7TA 1ML4A 3F97A 3NJ4A 1DAIA 5TQ0A 3UXEA 1A27A 3D6FA 4ABYA 4U9UA 4PYKA 1H2BA 4C1NA 3E9RA 1ESDA 1GN8A 3TFOA 1ZM7A 1ZGHA 1ZM2A 4AWXA 1BWSA 1G0NA 3G49A 2XNKA 1VCMA 3KUKA 5CNIA 4ZAFA 1SZPA 4R1LA 4I0WB 4F4UA 3WLJA 4BGIA 4F72A 2WYUA 5A4MS 3QVXA 2ZJAA 1W581 3FJ1A 2PSFA 2HDNB 3DTNA 2VNJA 1RM3A 4YC7A 4CRWB 1DJMA 2W2QA 4MRRA 4LYJA 1P0MA 1M2GA 3BIOA 3RK1A 1CZNA 3W8DA 4YY3B 3QVSA 1ACJA 4LDJA 2JIRA 4M38A 3FETA 3NASA 2PZBA 4HTAA 1M1YB 2FR1A 3BK2A 2QTHA 2HMAA 1WEHA 2NG1A 3PEVA 4Y7DA 3QU7A 3GEDA 4URWR 3NBAA 4RMGA 4DQXA 4KGVA 4Y0VA 2WB2A 1D9XA 5C51B 1F4PA 3WDLA 3ZGNA 4ZYVA 2RCNA 1E1RD 1A50B 1J8DA 2H51A 2QX7A 3ET4A 3M5PA 4G41A 1IE3A 1YT5A 3BE5A 3L1VA 3QOYA 3DPIA 4RYDA 5IEJA 2R6DA 3BB4A 4W5RA 4WK0B 2G6TA 3C1OA 3VR2A 3O8CA 1COZA 1DAMA 1PG0A 3F8SA 2D5AA 1I4DD 2B25A 2HF9A 4WA7A 4F56A 4OBEA 1JJAA 1VL8A 4MARA 1JFTA 3M3HA 1L4YA 2ZQ5A 1N6PA 1YB1A 5K3AA 1J2EA 1NX9A 1Q0UA 1UM9A 2QAGB 3OCCA 4PG5A 4YRLA 4CDMA 1KAOA 4ZJUA 3FTPA 4EARA 4QVIA 3PHGA 3SLKA 4ROTA 4C0AC 3M83A 2Q5JA 1T0BA 2BHNA 1NUPA 4J0EA 2F8SA 3K94A 1UPUA 2HQBA 3OWXA 3H42B 1LSOA 5TJ9A 2F55A 1Q21A 1Q0QA 1U28C 1L7MA 3EDMA 3MTQA 3V7WA 1G8PA 4QFMA 2H65A 2X13A 1Z15A 3D9QX 3Q5GA 3GC6A 4LPSA 4QJBA 3U81A 5I3ZA 2X9VA 1P73A 3DAYA 3LLUA 5KTRA 3JVVA 1OLSA 3W3AD 3DMYA 2P6OA 4P84A 4C7BA 4CR8A 5CFZA 2JCBA 3T5DA 1CQPA 2HEGA 1F1BA 3MWJA 4YUZA 1U0SY 4GRDA 4C0SA 5A3JA 2ATXA 3T4EA 5DCWA 4AULA 2CL6X 4MA0A 3SFTA 4OMCA 3H1BA 3ZWDA 3PENA 4FI3C 3NC1C 5CB0A 2BDUA 3DLIA 4JQYA 3HJBA 1WB4A 5EZ5A 3MCUA 3MWKA 2ZITA 4LZPA 3TMAA 1R18A 3L7MA 2YFYA 4DDUA 4CIWA 5FTWA 1CUCA 1NNI1 2CF5A 4RFSA 1MAHA 4Q47A 1PAUA 4IDPA 2BY4A 2XYHA 3CMCO 4FONA 1A4IA 3IT1A 2W6CX 2FQXA 2W90A 4U9HS 3TJRA 2CMDA 3H7IA 3W3AA 4TKUA 3ZXXA 4ZI7F 4NVRA 2ZUSA 4PHFA 4ZHQF 1D2EA 1FDOA 2GZ3A 3KX2A 4ESOA 3AVTA 1RKXA 2TMKA 3PA6A 1AJEA 2Q2WA 4KBFA 5FOSA 5FBHA 3FFAA 4HZGA 5D8DA 4ZJYA 4Z9FA 3OCUA 4EA8A 3HCWA 4JQZA 1WZUA 4JLNA 3AVPA 2V65A 4ZAVA 3HBLA 4P5EA 5CT4A 2Q2QA 3KTOA 1NTOA 4UEQA 3LHSA 3TVYA 4R2JA 2X8BA 2CDCA 1QKKA 3QVVA 3UGKA 4EMBA 1GWNA 2QPAA 3ZPXA 3CNLA 3AKYA 1ITZA 1K9VF 3OX3A 1JSRA 4A2QA 5K3OA 2P0YA 1BVUA 1W4AA 3GLHE 4HAIA 4BXOA 1CU1A 3R41A 3FR8A 4OYYA 3VH3A 4C4XA 1ZNXA 4MNTA 4ND4A 4YS6A 3RAJA 2NZWA 3EJ6A 3AXSA 3I45A 2J8ZA 1VZ3A 2XOKD 1BD3A 3KR9A 4DBZA 1WQ3A 3CA8A 3DMPA 4A0RA 1XZ8A 3VJKA 4OSPA 4Q1FA 5AKLA 1UODA 5C7YA 4OK3A 3TTWA 4AYWA 3SM3A 2H8GA 1ODKA 5T67A 3MBKA 1ORHA 1GARA 2YVQA 2YXDA 2PTHA 2EYQA 1XTIA 1ESNA 4IJQA 1B0PA 3A1EA 4ISBA 2P4HX 4QDKA 3TZEA 3ZCTA 2P3QA 3GOQA 1SURA 3E7PA 3OFVA 4INAA 5FJIA 3IOBA 5LKAA 3VVCA 1J70A 2CFRA 1C7IA 2I6FA 4XTCS 2N9UA 1J5EB 4LDAA 1A2QA 1QV9A 2VP4A 3IQFA 3AVXA 1C7EA 2WPDD 4Y2HA 5DDIP 4IDAA 1G7SA 4Z1MA 3I61A 1XMSA 1YZ3A 16PKA 3JQAA 3G2OA 4C0KA 3U7HB 1YGYA 4ZYLA 4MV3A 2BTQA 4F6CA 1MB0A 2EX1A 1C4KA 4IEIA 4LMPA 3KP1A 4ZPXA 3GVHA 2FETA 1HKHA 2XWBF 4KITB 4CM4B 2ZB4A 5BSWA 4DB4A 3PIDA 2FOXA 2OV1A 2RMKA 1O6ZA 3BWEA 4ZXFA 4NE7A 2EIXA 3DFMA 4JZYA 4LGVA 2IPLA 2DQ4A 5K51A 2ZRLA 5ALHA 3KYDA 5KSPA 5FQOA 2O7NA 3HKDB 4Z86A 5CT6A 4N4AA 1QGOA 4ZGBA 1J56A 5K9ZA 1T43A 1O4WA 1XCBA 3AUJB 2FPIB 3GPBA 3KTAB 4BQFA 5IRCD 2SECE 4TUYA 5BP7A 2LWIA 4WY8A 4JJKA 3ENKA 5TQ2B 3UTDA 1VHWA 4M8SA 3BULA 1H2FA 3NP9A 3PDHA 4RL4A 4ZCLA 2I34A 2VJNA 3O82A 2E4WA 4QBIA 1IXZA 4PC6A 4RGBA 1ZH6A 1IN6A 4TWRA 1SUCA 1QP8A 5EJ7A 2IDJA 4OX9B 1QUFA 4BB0A 3HVIA 2Q45A 3FI9A 2P1ZA 1PZGA 1Z37A 2RJ3A 2Q62A 2ORED 4WD3A 5BR8B 3UBTA 3I62A 4EKNB 1N2OA 3TTTA 5C46F 3ZJVA 1PR6A 3GFFA 1SK8A 1TTHA 1QYIA 2FG6C 1KQPA 1YZKA 1HRKA 2J30A 5IKMA 5J47A 4TS3A 4D3FA 4GI1A 1F38A 4W6QA 2HUNA 2HQ1A 2PA3A 4RK1A 1HE1C 3T4UA 5A4KA 2DFKB 1HORA 2PK3A 4NCNA 1WNFA 2PGJA 3NMUF 3KYIB 2ZRIA 2AZ4A 1BHSA 4PFJA 4UCQA 3U4HA 2ZDGA 1AKWA 1NVVR 3ZJ4A 3UJ7A 4F97A 4QPNA 2ZJ7A 3S2FA 5LA6A 4YRFA 1U2ZA 1LI7A 1Z45A 5U4QA 3UHFA 3F9RA 3C6YA 1BE8A 1NR5A 1TO2E 1T3TA 4PO3X 2X6QA 1KDOA 3E81A 3TIXB 5JRDS 2CVFA 1JHOA 3SQNA 1HFEL 1NMEA 5HTKA 4F21A 3ILHA 1ECLA 2BJWA 4JH0A 3ZNQA 1P0PA 2OBYA 2ZUWA 1GUBA 4R9VA 3MMNA 1OBOA 2PO7A 3I4FA 1G5TA 1ST2A 3EC1A 4KO1S 1GJRA 2DWOA 2R1VA 1KI8A 3LD9A 4NEHB 4PGMA 5DK4A 2ZBRA 1U1DA 3JAWA 2GXQA 4C03A 3LLVA 1VI6A 3HUDA 1ML3A 4LSGA 2WW8A 1XZEA 4PZLA 4U5XA 4LZNA 1C2TA 4DY4A 1KSFX 3HA3A 1KEKA 2P9BA 2XHEA 3K6RA 3VH4A 3ETHA 3L0OA 4DLWA 3ESCA 4ETWA 4F93B 3USCS 3HUFA 4MJ3A 1Q0LA 3AFHA 3PRKE 4M9CA 5ICMA 1PZFA 3ONEA 2R66A 4EITA 4TX1A 5SV2A 4D1YA 5DH9A 4NBWA 1WV0A 2RG7A 1FUYB 1OWPA 3AFNA 4JXZA 2E4UA 3THXB 4BX9A 1KJJA 2RGWA 4PLFA 3UVEA 4UNQA 1YJ8A 1X70A 4QDZA 3S70A 5JMWA 5B3JA 1TQ8A 1FS6A 3BGVA 3LW7A 3PXEA 4PFKA 3VNAA 3WBKA 3ZZTA 1WUHS 4E5UA 4UZFA 2GDZA 3CLRC 1VXOA 4OU5A 3CPJB 4V39A 1L9KA 1BC5A 2G88A 4FNAA 3KD2A 4FD3A 5G1OA 1HMPA 5ED4A 1K89A 4ALNA 3WGQA 5CW2A 2WWIA 4UNNA 4YV0A 1OZGA 1NXQA 4CL8A 2QD4A 1HT2E 3AFOA 3TH5A 2I7VA 4D8UA 4YHHB 3CY6A 5I7UA 5H3LA 3I32A 2Z3ZA 4QT4A 1LUAA 1Q15A 2QTMA 3ZG6A 3ZGYA 4JY7A 2QOEA 4C0WA 2J48A 3SE7A 1HNZB 2C7VA 1Q6ZA 1TAUA 1G5IA 1M34B 4EIWA 1U7XA 5AI4A 1J2TA 1KC1A 1ZICA 2VPYA 3H4MA 1H3FA 1X74A 5AK3A 3TUZC 3PITA 2CNOA 4C88A 2R0QC 1YNSA 4IX1A 4S3MA 1AOXA 1QB7A 4E2YA 4B31A 4BY9E 1E7MA 4YQYA 4CEIB 1UOEA 3PDUA 4H17A 1THTA 4JOBA 4MGHA 1E9VA 2HSWA