2IYZA

Shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
169
structure length
168
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRNPGAVVRHILSRLQVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIKIMATE KINASE
publication title Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 60
structure length 168
sequence length 169
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iyzA00
1JR3D 3V4RA 4KYIB 4CYMA 1EG7A 5FUVA 4HB2A 1OYWA 4EPWA 3BJIC 5HKKA 2IBMA 3K70B 1M7BA 1XEXB 4DKXA 3TW4A 1P2SA 5G3ZA 3CBQA 3EA0A 2RMKA 3HU3A 1T6NA 2QPAA 1ZIOA 4WW0A 5K8LA 3UPUA 2KBEA 2XAUA 3HR8A 3ETLA 4FWIB 1M1YE 5G53C 5DO9A 1I4DD 3VMFA 4PTLA 3FOZA 3MJRA 3NVAA 4F91B 3DVLA 2C77A 1GG2A 4A0GA 3N70A 5E7MA 3QPUA 2J0UA 2CJWB 4DLXA 2CLDX 1E9EA 1GKUB 2ASEA 1N0UA 2ONKA 4QL3A 5TY0A 4BASA 2ZI5A 4D4MA 1ZC4A 5DNYB 3KXKA 2O8BA 4TQUS 1Z3IX 4NL4H 3LLMA 3DOEA 5FFMA 4JBYA 1GOTA 3VHXA 3AKCA 4GFDA 4N0EA 4US0R 2BC9A 2Q3FA 4JL5A 2P6NA 4B32A 1BO6A 2AD5A 3U4QB 4HLDA 4L16A 1KK0A 2OG2A 1G20E 2W6JD 3QF4B 3K0SA 4AC9A 2RKOA 2IS4A 3LBNA 4JIMA 4GL2A 4IXNA 2EFHB 1T5IA 1E96A 2DWQA 2EWWA 3LXRA 4DBLC 4HATA 4KU4A 2D2EA 1XZPA 3LRPA 3BH6A 3NBFA 3SS8A 2CHQA 2P6RA 3CZPA 2L0XA 2EYUA 3HR7A 2DYKA 1NMYA 3IHWA 4QRHA 1G3RA 1BMFD 5KNBA 3G82C 1KZGB 2G9NA 1JAIA 4KXFB 4LYJA 1RC8A 1RRGA 2WZQA 2WAYA 2ZRNA 4I99A 1MH1A 4EFMA 4A6PA 4DVGA 3EC2A 3HU1A 2GETA 521PA 5C4GB 5HZHA 1P3JA 1IY1A 2VTKA 3Q3JB 5AK0A 1GRRA 2XB4A 4UJ5A 4JVLA 2CEAA 1VG1A 2A3RA 4A0FA 4F4CA 2ZRCA 1W0JA 2XB2A 1QRAA 3AKEA 1X8KA 3NTUA 3GLFB 1OPXA 1E0AA 2IYUA 2VRWA 3RRMA 3ECCA 3DO6A 2QTFA 3H86A 2WWHA 1LVGA 1X1RA 5FOVA 4NCHA 3H4MA 5DYIA 2NQ2C 2CL6X 5CM8B 5AUQA 3FVQA 4ERNA 3HYTA 2ODBA 2DPXA 1AGRA 1EFHA 4DSUA 3OHMA 4Q7JB 4RKEA 2F1HA 1XEXA 3ND8A 4BECA 2ZVPX 1KMHA 3F3YA 1ZUIA 3QENA 1KMHB 3GLIB 3I72A 4CEHB 2CK3D 4DIDA 4JJZA 3D8BA 4ZI3A 3P4YA 1I2MA 1W36B 4QNMA 1KHTA 2DR3A 4W5JA 4C2TA 1NJGA 3UIEA 1E3MA 3BD9A 3TGPA 4US1R 2XXAA 1PUIA 3O8DA 2WHXA 1UBGA 2WV9A 1W47A 2BV3A 2XXAB 1NSTA 2GA8A 3T5GA 1G5TA 4X8LA 4RD1A 4UJ3A 1Z0FA 1XU4A 3AVQA 1YZGA 2LKCA 4Q7MB 4UNRA 2CJWA 1N5JA 4NHOA 4URYR 4DCUA 2QG6A 4F38A 3QG5A 3EAQA 4XOIA 1UPTA 1NBME 4LBVA 3A4MA 1DS6A 1YR8A 5B2ZA 1S3GA 2AKAB 4IOJA 4PQRA 3EG5A 4X8OA 5GJWC 1EFTA 1RRPA 2QSZA 1HH4A 1N25A 2HUPA 3DMDA 2G6BA 4NYMQ 1EGAA 2GKSA 4PX9A 3UG6A 4DDVA 3GLIE 2AWOA 1EFRA 1PLJA 4LRWA 2WBLC 1KI3A 3THXB 1E98A 4F7WA 2VF7A 3WP1B 2JJ2A 1ZM9A 2N1BA 2A5FA 2XNDD 1F2UB 2EVWX 4D4KA 4E03A 5LD2B 4CDGA 3R8CA 1OH8A 3WMGA 2TMKA 1SVMA 4WZBE 4WXPA 3MMPA 5CJPA 2DB3A 2ZSFA 3TMKA 1ZAKA 4DEXA 3NHAA 3VFDA 1OXUA 3TSZA 4DEYA 1G8PA 5DHFA 3TE6A 1E2DA 3IGFA 1WF3A 1R0XA 5A5GA 3EIQA 2ZI9A 4ON9A 4EJSA 3OIYA 2WOOA 1R10A 4PFSA 4HEJA 3SYLA 4C2UA 1Z08A 1JEDA 2C9CA 2OBLA 2IF2A 2XZLA 4RD0A 1WXQA 3PQCA 3QUSA 1KKMA 2BBTA 4G1UC 1N6OA 3I62A 1OYYA 4NMMA 2XGJA 2NPIA 5UKDA 4S2EA 2CCJA 4MKHA 4DZZA 3CUEF 1KOFA 1TQDA 2BJWA 2AWNA 2D74A 2EFDB 3C41J 2FSHA 1G7RA 1XEWY 4HLQB 3GFPA 2XEXA 4XH9B 2ZROA 3CH5A 1QDEA 5F9HA 1JPJA 3I3SR 4PAOA 2GXAA 3NDBB 2CXXA 2G83A 2UVQA 2QORA 4Q9JA 4BZPA 4NPHA 3ICQB 1W4BA 1F6BA 3QVVA 4OQXA 1FL9A 4B3XA 5KSZA 5CIWA 2KWIA 4JBXA 2OESA 3GJ8A 3BH7A 3EARA 4IVPA 2NTYC 3RS7A 2ZJ8A 1IY0A 4OJKA 2GJ8A 2GESA 3BRWD 3RWMB 2G88A 4HUQA 2JLSA 4W5HA 4B33A 3IIMA 2QA5A 3U44A 3I5YA 1S9HA 3GCGA 3U7FB 3OZXA 4KJZA 2BM0A 4E07A 4FI3C 1Z07A 1US8B 3IIJA 4EDHA 4EPVA 2GEVA 2QE7D 4C0BA 3T1OA 3I32A 4DB4A 2QI9C 1YVDA 2P5SA 1L4UA 5EXXA 1GDDA 1ZINA 2G0NA 4Q7LA 5FPSA 3VU9A 3R9XA 4C0AC 2ZR7A 1M8PA 4L8GA 1R5OA 4TL6A 5JSZA 4Y0AA 1Z6AA 4C0LA 1TUEA 2ZSDA 1E2GA 2YOFA 3HJNA 3WNCA 2VP5A 2GF0A 2QPOA 4N0DA 3AUYA 3PJRA 1UDWA 3FTQA 1UBCA 1XXHE 2PT7A 4TYYA 5JWOA 2BOVA 1O87A 1F48A 3IO5A 3B82A 1SVLA 2GNOA 2HYIC 2WWFA 4PPQA 5E3HA 2IXEA 1ZIPA 2OO7A 2WKPA 4DLYA 1M6NA 2CLSA 1FMLA 1Z28A 3IKJA 3QKSB 1FFHA 4PQFA 4OQMA 1SVKA 4LC0A 2QM7A 2HLDD 1JPNA 3CF0A 1R8QA 1H8HA 4GNKA 4NCIA 1NSFA 1DAIA 3L43A 4M4SA 4NTZA 5SZJA 2W6IA 2WWXA 4P3YA 4P4UA 4TLCA 4FMCF 3SQWA 1XMSA 3OEHD 4P32A 4QG7A 3A8TA 2J45A 3GEHA 2GCNA 3AKYA 5TDHA 2AD1A 1U99A 4MQBA 4R2IA 5JHHB 1E2KA 2R6AA 1LB1B 1VCMA 5AUOB 1A5TA 1V43A 4JYCA 2W0MA 3NH9A 3ZVRA 4IDPA 2R6GA 1NN3A 1KIMA 1P9RA 4PAQA 2CE7A 2QAGC 3IBYA 2X77A 3BE4A 4JYBA 4DJTA 1W36C 2WKQA 2O8DA 4M9XA 2OXRA 2QQ0A 2F1JA 2W0SA 3SR0A 2ZAOA 2WIAA 1G16A 1RIFA 3KFXA 1I2DA 4TLAA 1W36D 4H9GA 2WIBA 1B0UA 4IVQA 1GM5A 3RS0A 3KUDA 4BLTA 1WA5A 3I5XA 5FL3A 2ZANA 1Q0UA 1VYTA 1NRJB 1UM8A 2QTHA 4TTQA 2ANCA 4BLPA 2V3CC 3K9NA 4F93B 5M04A 2O8FA 5GJBA 2FGJA 1TTTA 2G0TA 1X3SA 2ZI6A 4Q4AB 3C5HA 1W4CA 3ZVLA 4HI0E 2QM8A 1F2TB 3T12A 5H8WA 3OF5A 1VHTA 3ZIAD 4UQOA 3QXJA 1T3LA 3AVXA 2IL1A 3MD0A 3W8NA 4PHHA 2QZ4A 2IYQA 2WJJA 5J4VA 2JLXA 1NIPA 1XP8A 1W0KD 4RCYA 3TUIC 2ZRDA 4QBGB 3WBKA 1E2QA 4NDZA 1W5TA 2IHBA 1AS3A 1G8GA 1W2GA 2FZ4A 2IWHA 2ZI3A 5ELXA 1U9IC 4QKQA 3S1AB 5B57C 2RB4A 4Q1CA 4L9WA 1DAGA 4TSFD 3M1IA 3T15A 3C5CA 1VG8A 3THOA 4URZR 4NYIQ 1SVSA 3Q72A 4HLCA 4WAUA 3RRZA 2F3TA 1ZM2A 3ZD7A 4XVRA 1XFAA 1U81A 3CRMA 4M8NE 1RPZA 4POAA 4BGDA 2VF8A 4C0QC 2VSFA 4TLBA 3B60A 4Z8XA 1JALA 4Q1BA 3FMIA 3FE2A 1BYUA 2AK3A 3QKSA 4YMVA 2ZAMA 1NVVR 4BRWA 1IJFA 2GXQA 1FW6A 3MJHA 4B47A 1CJKC 1NY6A 4JT2A 4D26A 5F9FA 1XTKA 5J47A 3B8HA 5BWMA 4HAVA 4IHQA 4YDSA 1PVOA 1JECA 2ZIAA 4GOJA 1OFHA 2X8AA 1KO7A 3TH5A 2JCSA 4LWZA 3D3QA 1MRNA 1OFTA 3ADDA 3OIWA 4IEIA 2ERXA 4DDTA 3VAAA 4URXR 1E1QA 1RZ3A 1DPFA 1XD2B 2AR7A 1D9ZA 3AVPA 4FMBB 5KUTA 2XZOA 1NG9A 3NBYC 1HV8A 3CRW1 3RDPA 3VKGA 2GK6A 3WY9A 4KBFA 5JEEA 1TAGA 3CO5A 4URWR 1R0ZA 1U2RA 2J3EA 3SN6A 1LF5A 2QP4A 2IYSA 4LUCA 3VKHA 4ZDKA 1CRQA 1S0UA 1FTNA 1YRAA 4C7OA 3VU9B 1L7VC 2OCYC 1SKYE 3NWJA 1NIJA 1QHHB 4YXWA 2HV8A 3TSOA 4BWYA 2IYYA 2VQSA 2IUUA 4AKHA 3K0FB 1KTVA 2C9YA 5CITA 1KJWA 2F43B 4MKFA 3KB2A 2A5DA 4TL7A 1PLKA 3ZH9B 1E4VA 1TQ4A 4DDWA 5IT5A 4M0LA 2IHYA 1NF3A 4GMXA 5EE9A 3SJZA 2C95A 3AGPA 4A9AA 4KV9A 2R6DA 3T06B 4UNSA 5HTKA 1YQTA 3MCAA 2FPKA 2F9LA 1XX6A 4ACBA 4A2WA 1E9SA 3W9YA 4E5UA 1NY5A 1UADA 2J7PA 3EIHA 1R6BX 4DRZA 1V5WA 5C46F 4FMDB 4M2LA 1UBFA 1ZU4A 2FZLA 3RAPR 1RRFA 1T3SA 5AJVB 2HF8A 1S1CA 3DDCA 4IDQA 2ZE8A 4KLNA 3VR3A 4TYPA 4A8JC 2ZRJA 4DWJA 2WSSD 4TMXA 5KO2A 4Q4JB 2EU8A 1G21E 3QE0A 3UK6A 1G4AE 5JHGB 1I4LD 4OQNA 1HUQA 3F8TA 4Q02A 2Z83A 3LO5A 4H1VA 1TU4A 3PEYA 3SNHA 1ZM7A 3RRYA 1IM2A 2C99A 3LX5A 4JSYA 2AXNA 2WPDA 1N0WA 2W2VA 4MGYR 5C18A 4HUTA 2BBWA 3PEUA 4KHZA 4D2IA 2ZI4A 3MLEA 3CKLA 4AWXA 1NG1A 3U3MA 2ZXUA 1PZNA 4WIAA 1OHHA 4XD7A 4DUGD 3QOFA 4DSNA 2Q21A 1K8RA 4PO9A 5HPYB 4BLSA 1KI9A 2IWRA 2AK2A 3BB1A 2ZJAA 2GILA 3VHLB 5KNCA 1HT1E 2FPLA 4HUQB 2ODNA 4M9ZA 2H57A 4PSVA 6Q21A 1OE0A 3R20A 5E7IA 3KJHA 2GXUA 3W3ZB 2ORWA 4CEIA 4CW7A 2GCOB 3K0AA 4HAYA 1VHLA 4CEIB 3CR7A 3K0AB 2QAJA 4ZCMA 4G3XA 4L15A 4ZI2A 3GP8A 4CEJB 2R6CA 2BMJA 2GJ9A 1W49A 3HPQA 3L82B 2LCFA 4G5OA 3WMEA 1KI7A 1SVIA 2VHTA 4QHYA 1MR3F 2QNRA 4NYJR 3IIKA 4ZV4A 4OL0A 3U7GA 2QTVB 3EZ2A 1D2EA 4NZYA 3K70C 1GKIA 1X8LA 3DHWC 3M0EA 4DCSA 4URVR 2IX3A 1H8EA 1Z63A 1E2LA 2B6HA 1N6IA 5L3RA 4B48A 2XJ9A 2B8WA 4RD6A 721PA 5DE3A 1UEIA 4MGIR 3TVDA 4M1KA 2YWEA 1MO6A 1M74A 4ZPXA 1G3UA 3A1SA 4JL6A 4JLNA 2ZYUX 4IDHA 5CB6A 1WBDA 3SBDA 1N0VC 1RVDA 5FBVB 1Z2AA 3ASZA 1Z0DA 2HCJB 5DN6D 2ZSBA 3OE7D 4FIDA 3SBEA 3LW8A 1XCPA 4NYMR 5KOYA 4D0NA 1J7KA 4AKEA 5JWHA 1GP2A 2XTMA 4AKIA 2UKDA 1HURA 2QMEA 4NBSA 4NH0A 1KMQA 2FPMA 1DARA 3CNNA 3GJ0A 2B7BA 1VCOA 1VTKA 3KXLA 5FL7A 4XWKA 1LFDB 5A4JA 4CEHA 4LHYA 3R7WA 2ZREA 2J1LA 2JLZA 1BIFA 2V8OA 2GBLA 1P61B 2CVFA 2ZYTX 4JKYA 4LYAA 1R0WA 2QP3A 2E87A 5LBIA 1CU1A 1XTSA 4KBGA 4IW3B 1KYIA 3IDQA 3B2EA 2AL7A 1C4OA 1XMJA 1E9CA 5KTYA 2FFBA 4QM6A 1AZTA 3DOFA 3IO3A 3ZZ0A 3X1WA 2JGNA 2ZRKA 4BLRA 3F5FA 5H1YA 1S9DA 1CKEA 1VECA 2YNMA 1XTQA 2V7QD 3IPXA 4LBWA 2J0UB 5BQ5A 2JDIA 3BGWA 2GTPA 2JLQA 3NH6A 4LSGA 2NZJA 1R8SA 3CX6A 2C98A 3NBXX 2X19A 2O8FB 5DLQC 3AP2A 5FPTA 1PUJA 1NVUQ 2XTNA 3K0FA 2WWYA 2J41A 4FN5A 1F2TA 2HYDA 1KDTA 2BEKA 2K5UA 4HAXA 1G5PA 3KL4A 5FH9A 4KSCA 3O8CA 3B1WA 2REXB 3MG9A 4GZMA 2ZRAA 5L3VA 4LJAA 1EWRA 2RGEA 2O8EA 5HE8A 2WAXA 2WTUA 4LHXA 5AJYA 2ZRBA 5F3WB 5GJCA 5CDFE 1NL3A 1VPLA 1JR3E 3ZYCA 4KAXA 1N6HA 4P4TA 1XRJA 3DPUA 2YYZA 2N42A 4Q1FA 2JASA 3KKPA 1NI3A 3K9GA 1UKYA 2V6JA 1AS2A 3P26A 1TX4B 3PUWA 2O8CA 2DY1A 1GKYA 3QBVA 1E2HA 1T8UA 1U0LA 2C04A 2ZE6A 3GMTA 2R2AA 3S1AA 5HR5A 4JKIA 1Z6GA 2WPDD 1CULC 2GXSA 4OQFA 4W9MC 5AJXA 1SVOA 3A1VA 4IOMA 5IRCD 1E9RA 4AG6A 2OT3B 4EPTA 3O8BA 3PIRA 5CYOA 1Q22A 1W0JD 4JLDA 4LV8B 1KZ7B 1O3YA 3G5UA 4UXIA 4CZ2A 3WYAA 1G7TA 4RZ3A 3QKRA 3CF6R 1KY2A 3B9QA 3NEYA 3GLFA 3TVTA 4JLJA 1DAHA 1KKLA 1P9WA 2WJGA 3AB3A 3TIFA 2ZJ2A 3X1YA 1AQYA 1J8YF 4A15A 4G01B 1KAGA 3FYHA 4R2HA 3QKTA 3SJBA 3QEJA 4EPYA 2UZ3A 1GRNA 2VA8A 4BFZA 1ZUHA 2RGNA 4EQ6B 4YLGA 4LZZA 2ZI7A 2VP6A 1OLOA 5AJWA 3CIOA 1XMVA 2IYLD 2OSBA 2IUSA 2GBLC 1XD2A 3A1WA 2Q3MA 4LV5B 4CF7A 2D2FA 2CCKA 1CBUA 1XPUA 3IEUA 2GAOA 3M6AA 3ZDQA 1BMFA 2HXYA 3L0IB 4IFBA 5KDOA 3C4JA 4TL8A 4L4UA 3HYRA 4FWTA 3ZVMA 3CR8A 3KX2A 1ZD9A 4QOSA 1SZPA 5DYGA 4K46A 1RYHA 4G5QA 4ESHA 1CIPA 2ZQ5A 2R9VA 1DOAA 1OXTA 4P0TA 1UF9A 2FOLA 4DIEA 2G1JA 3VR6A 4TYWA 2CK3A 2LKDA 2MSCB 1IN7A 5BN5A 3C15C 4OHYA 4KITB 3I1FA 3AUXA 1W44A 2IYWA 1EFRD 5J4LA 1T91A 1UBEA 1DG1G 3NG1A 4Z54A 3K09C 2FWRA 4ASUA 2XSZD 1KJYA 3B1YA 1P2VA 3K0EA 1IN8A 1T9HA 2AN9A 2CL7X 4JLBA 4BFSA 1IN4A 2C8VA 4WOPA 2UZIR 4OK3A 4OBEA 2JLUA 4F92B 1PV4A 4OI2A 3KXIA 1P75A 1M2OB 1A4RA 4MKIA 1AM4D 4II7A 4PPGA 4Z51A 1XPOA 2GEDA 1SHKA 3QBTA 1ZD8A 2RGGA 1P73A 3N2EA 4US2R 3E5HA 4GBMA 5C4MA 4Q48A 2D4HA 2PZGA 2QY9A 2JLVA 1K5DA 2OCPA 1IBRA 2BMDA 3U61B 4NYIR 1VKJA 4UNQA 1T0HB 1ZNYA 3OE7A 1HTWA 2BCGY 4PC1A 5C1BA 4PC6A 3ZD6A 4ZDIA 4Q5IA 2JDID 2BHRA 4DCTA 3W5JA 4J0QA 4Q4JA 4DSOA 3GPLA 3OFND 3QG1A 4U02A 4DLTA 1II9A 1ZNXA 2DFNA 1Z0AA 1Z6XA 3KJIA 4BPBA 4TN1A 5KSYA 4G0NA 3MFYA 4I1OA 1U8AA 4XWOA 2XTZA 3QKRB 2NPFA 1XTIA 4D0LB 3THWA 3SFVA 4LBZA 4QBHA 2F1IA 1G4UR 1UKEA 1ANKA 5FOTA 3ZGXA 4AD8A 3ZJYA 5FUWA 2BWJA 4OJQA 4X8HA 1QG2A 1WB9A 4Q21A 2OCBA 2WWWA 1E1QD 4JL8A 2XJ4A 2Q9CA 2RGNC 4M9QA 2DBYA 1U9IA 2BM1A 3K9HA 4PR0A 2ZITA 3WRXC 2IXGA 4KSBA 4XVQA 4EQ6A 3UKDA 2IXFA 5EE0A 2WJIA 4PHFA 1IXRC 2Z4RA 4IDOA 3X1ZA 2JJ1D 3C8UA 1S3SA 1XB2A 3LH5A 5DIFA 3VX4A 4YDHB 1XCMA 1E9AA 1W1WA 2O8EB 1W46A 3RSLA 3GQBA 2PEYA 4O0MA 2NOAA 4GT1A 2HF9A 1NVVQ 4PO1A 1W5SA 2OHFA 1U0JA 1NLZA 1ELOA 1ZM4A 3C14C 3NBZC 4EKDA 4Z1MD 3U44B 3A1UA 1CJVC 2HCBA 4LHZA 3J81k 4CEJA 1EX6A 1G19A 2OLKA 5EP4A 4LX0A 4A2QA 2YHSA 1JAHA 3VR4A 1D9XA 2JLYA 3QKUA 2PT5A 3WYGA 4YMWA 3T34A 2GRJA 4DLZA 1X1SA 1P9NA 2PZEA 4A0HA 2JA1A 1E2MA 1BOFA 4HAZA 3TW8B 2C2HA 3GLGB 3CM0A 3CF2A 2RHMA 3MUFA 2W6JA 5JLJA 1J70A 3IILA 2VP4A 4FCTA 4M1OA 1GTVA 5DI3B 2EYQA 4C0HA 5DI3A 4B34A 1P7CA 5G40A 2J7PD 2R62A 3EASA 2IYRA 4MUAA 2P5TB 2V4ZA 1H8HD 1AK2A 4JLMA 2GVDC 3AP3A 5E95A 2JLWA 3R9IA 1UEJA 1NNEA 1G8HA 4G5RA 4TMWA 1YR9A 3CLVA 4QJ3A 5BN4A 2D7DA 4MRPA 4QFMA 3FKQA 5SZIA 3AVWA 1G6OA 1R4AA 2RH5A 4IFEA 3KQHA 2PBRA 1X8JA 1Z5ZA 1YZUA 4JVNA 1P72A 3R7WB 3WHLA 1J8MF 1OIVA 2XITA 3U60B 4MYHA 4QJ5A 2REBA 3CRQA 3I92A 1KK1A 1WMSA 4OKSA 1W0KA 2G77B 5P21A 3RC3A 3WBJA 5CLQA 2ZRGA 4TT3D 2WWGA 2W58A 3X2SA 2JATA 3RABA 3EC1A 1Z29A 3MAAC 3U7EB 4D80A 4DUGA 4Q1AA 3DKVA 3NXSA 2QRNA 4P4SA 5FPHA 1YZTA 4AYXA 2WOJA 5CDFA 1VDZA 5BYJA 1G17A 1AJEA 3AP1A 4GI7A 1OB2A 4ZIRA 5JI2E 3HP1A 1XJQA 3A4NA 1OIXA 4NCKA 1XJCA 4ABYA 4EUNA 4ZIRB 1N6NA 2ZRIA 2OEPA 4HDCA 1SKYB 5JMTA 3IEVA 2YOGA 1HE1C 4LJ6A 4M9SA 3U6KA 1ZW6A 2D62A 3CH4B 3E70C 4Q4AA 1MKYA 4QBIA 3BFKA 2I4IA 3IBGA 4Q03A 4DT1B 5C2JB 1OXXK 3LQRA 1R5NA 4Q7KA 5FI0B 1IXZA 2AFHE 3CPHA 3THXA 1T4GA 5GVSA 3EX7C 5IK2D 4XSHA 1F60A 3W90A 2QAGA 4O2RA 1TF2A 2QP9X 4A4DA 3TNFA 1A7JA 4V0NA 3SQXA 1OKKD 2YVUA 1KDPA 1SXJB 3Q5DA 4YMUA 1YRBA 1T5LA 5LPNA 2ZPTX 1GITA 3DEFA 4C30A 2ZM5A 1KSJA 4HLUC 5G3YA 8OHMA 5IHPA 4EJSB 4Q1EA 1Q21A 5AUPB 1N6LA 3DL0A 1ZBDA 4JS0A 2IF0A 1DO2A 1T3HA 2J46A 5LB4A 1HT2E 4PC7A 1Q1BA 5GVRA 1GL6A 2Q3HA 1KGDA 2YJTD 2NO9A 1GVNB 2ZRHA 3THWB 4TLDA 4B6EA 2MSDB 2RHDA 4BEBA 4Q4HA 2ZE7A 3TR0A 1Z22A 2YWFA 2PX0A 5A0FA 1L4YA 3FB4A 3ZZTA 4FW9A 4TQAA 2CLCX 3PEVA 2GHIA 1M34E 2WWIA 3KFVA 4AG5A 4C0JA 4KFTA 3U5ZB 5FBLB 2CNWA 3MRSA 2PH1A 2VHQA 3KB1A 2Z6VA 3KKQA 4JSTA 2CNWD 4A8JA 3EPHA 2X2FA 4M1SA 4PXAA 3OAAD 1G9XA 1G291 3SHWA 4CT4B 2FH5B 2JIZA 5AJZA 1OV4A 1FZQA 3MWKA 4RZXA 1Q57A 1OIWA 3U3RA 2ZJBA 3FKSA 1QG4A 5TVKA 4OK6A 3SDZA 1Q44A 3R8FA 3LFUA 2OAQ1 2ZSAA 3K8YA 2Z5FA 2YKGA 2IUTA 1MV5A 5JFGA 4A0RA 1QHNA 2ORIA 3VKWA 4MDFA 3UANA 1EX7A 5L3SB 3CW2A 4C7OB 3FMFA 3BB3A 3VR1A 3ZVNA 3AM1A 4V0MA 2OBNA 4NE2A 2YINC 5JSZB 1IOZA 3Q7PA 4LC1A 4AIIA 3B1XA 1QVAA 4E09A 4RSGA 2ZTSA 2JIZD 2FFAA 1R7RA 3U6BA 2CE2X 4RD2A 2I3BA 1GWNA 1E1RD 1E6CA 1QHSA 3IPYA 2VP0A 5AUNB 2ZSEA 4JT4A 2ATXA 3UWOA 1I4TD 1KI4A 1OW3B 3A6PC 1PJRA 5FUYA 2JAQA 4GOXA 4XTRA 2V55B 1E2NA 2B21A 1Q1EA 3KQUA 2ONJA 4D81A 4EFNA 1SXJD 4YC7A 4GDFA 1MT0A 4NP6A 3VNUA 2FG5A 1DBSA 2W2XA 4NCJA 3L2OB 1SXJA 1KSHA 3MSXA 1X6VA 621PA 1COWD 2XX3A 2ZJOA 2FE4A 1D2MA 1TUIA 2OE2A 5KYKA 4TZ0A 2J59A 1Q3HA 3Q9LA 2ZRPA 4ARZA 3QXSA 2PLFA 2ZJ5A 4NYJQ 3FDIA 2XNSA 4QJ4A 1OF1A 2F9MA 2O52A 3I73A 4LOAA 4PPNA 3H1TA 4JJKA 5J4YA 1CR0A 1QHYA 1E0JA 1T8TA 1U8ZA 1G3MA 4FCWA 2OXCA 5FBRB 3ZLJA 1ESMA 1Q1ZA 2B8TA 2EQBA 4DSTA 4L9SA 5CJ2A 3LX8A 1CTQA 3OEEA 3FMPB 5F2EA 2GWHA 1L2TA 1TPZA 5KHOC 3GJ3A 1Q3TA 3TUJC 2ZJYA 1LY1A 3RLFA 4BLQA 3OEED 2FNAA 4TMZA 3AV0B 5CLLA 1F5NA 3BB4A 4GP7A 2J87A 5DHAA 4B3CA 1P62B 1GL9B 2GF9A 2KSQA 2W6ID 2OFOA 2MSEB 2QQEA 1R0YA 3QXHA 4Q4HB 2YOHA 5JS8A 2JJ8A 1WBBA 4DC9A 3B13B 3RRNA 5JCZA 3VNVA 1N6KA 3VR5A 3EPLA 4CGZA 4FMDF 2HJVA 1VG0B 5DI9A 1Z0IA 3CWZA 4AY2A 2IEZA 1G5RA 1CEEA 4DLUA 2P2LA 3F0TA 3WRYC 2A7QA 4A8JB 4MUBA 1VYUA 4EJSC 4MYUA 5FOXA 1YR7A 5DH9A 4JLAA 3SJAA 1K6MA 221PA 4MRRA 2C96A 2OV2A 2RAPA 3HPRA 2YZ2A 3CNLA 4HB3A 2FJUA 3T5DA 4KI0A 1OXVA 2NO7A 3ZIAA 2IK8A 1XBTA 1G64A 1L8QA 1Y63A 2I1VB 2CDNA 1UJ2A 3N2IA 3PR1A 2WJVA 4B43A 1GFIA 1P60A 3L0PA 3EPKA 5EE5B 1SXJC 5FTJA 3D6TB 4PHTA 3GLHA 4OI0A 4BEJA 1EK0A 4MRSA 2CHGA 1TQ6A 5E7JA 1D8TA 4EPXA 2KBFA 1Z0KA 1U94A 2O0JA 3AH8A 2AFIE 2H17A 3GJ4A 3LNCA 5FTLA 2GEUA 4C0KA 1A1VA 4B2PA 4B3GA 3RWOA 4WZAE 3FGNA 2XOKD 2CBZA 4XD7D 1RE0A 2Z43A 2ZVQX 4I1VA 2GZHA 2RGAA 3GD7A 4LJ4A 5TARA 2YC4C 3EZ6A 3AQ4A 1CJUC 5FL7D 4D4JA 1FNMA 3AVYA 3K0CA 1E79A 1QHXA 3T1QA 3V00A 1NBMA 4ARZB 1A2KC 1ZCAA 1SQ5A 2PJRA 2O8BB 4GZLA 1SULA 2C78A 4QGGA 2WVJA 1GUAA 1IHUA 4KLZA 4DLSA 4GPTA 4R98A 2QBYA 2ODWA 1GZSA 3P4XA 1T0JB 4FD2A 5AR1A 1TEXA 2EFEB 4HAWA 3U4QA 3K09A 1ESNA 2QN6A 3REFA 5DN6A 3A36A 1P2TA 2FN4A 1OFUX 3TAUA 3KQLA 3SFZA 4LJYA 1ZMXA 5KDDA 3NHBA 2NZ8A 5J5CA 4K81B 5JWRA 2NO1A 1MRSA 1BKDR 1GSIA 3DZ8A 1JBKA 1GNRA 4TWZA 3U2QA 4YMTA 1E79D 2YV5A 4MRVA 4IOLA 3HU2A 1BS1A 4BUJA 1QHHA 3Q8XB 3L0SA 4A1FA 4IVRA 5BYKA 3N5CA 4TTPA 5L3QB 3PXGA 3KJGA 1KO5A 3LXXA 4LY6A 3SHFA 2AHOA 3SI7A 3NC0C 4DT1A 2A9KA 1HE8B 3ZZUA 1OHHD 1TEVA 1WRBA 5JCPA 1JXOA 3CRRA 3LA6A 1CLUA 1LS6A 2BMFA 2KE5A 2ZJZA 2B92A 4MH0R 1K5GA 1F3OA 2QAGB 4RCZA 5CK4A 5KNDA 1WDTA 2VHJA 2GAAA 3A58B 4RFVA 2OAP1 2WSSA 4OYHA 1NN5A 1LS1A 1E2PA 1TU3A 4QGAA 2IS2A 4LJ7A 4E22A 4W7SA 4XSGA 2A78A 4W5WA 2V6IA 2YWHA 1W48A 3I61A 2VP2A 1KI6A 2O8CB 2E9SA 2Z4SA 4B3BA 2HXSA 4PZLA 3T61A 3FFBA 3KUCA 1OB5A 3PUYA 1AN0A 3JVVA 2FV8A 2G3YA 3RVBA 1MOZA 3B1VA 1KI1A 1GRQA 4OHVA 3AKDA 3TR5A 3AF0A 3P1JA 1RFLA 2ZS9A 2HDNB 1II8A 4HB4A 3W5IA 3NDPA 1H8ED 4NCNA 4BZQA 2VEDA 5HCNA 1OH6A 4PQYA 4PSAA 5FR1A 4DDUA 1G18A 4AYTA 4HZUA 2JJ2D 5SZHB 4ZDJA 5JJKA 2GJSA 4LI0A 5KDLA 2EW1A 4B76A 1N5IA 2F55A 2NG1A 3DZDA 1XTJA 1J2JA 5EXSA 3KJEA 1Z47A 1G7CA 4TMTA 4BFYA 1IONA 4RZ2A 3ICEA 1GAJA 5TB5A 3GLGE 3IUYA 2D06A 1YE8A 2WJYA 1JR6A 2MMCA 2IYTA 3TRFA 1HEIA 3DKPA 3TQCA 4V0ME 4KVGA 2FDCA 1KSGA 3W6PA 4C3ZA 1C9KA 4D6PA 1XEWX 4M1YA 3L8ZA 4YMSA 3SYNA 5J40A 4C4PA 3ONWA 3WXMA 2PEZA 3O47A 2H18A 2Q0HA 5EZ5A 5FOWA 4B2LA 2GCOA 1D6JA 3VTKA 2GK7A 1NKTA 1XDBA 2VHUA 3WNBA 1KI8A 3W6OA 4BRUA 3I8XA 4LPKA 1SXJE 4GP6A 4WBSA 3BXZA 4CT5A 4KFSA 3LY5A 5L3SA 3MGCA 3O8RA 5DSZA 3EZ7A 3UG7A 2QMOA 1KO8A 2QT0A 1XWIA 4KODA 5B58C 3AGQA 3GEIA 3HDTA 1NMZA 5EQTA 1IN6A 3OFNA 2ODEA 3QF7A 2V1XA 4N3NA 4TTRA 4UNPA 2QPTA 1GILA 2DCUA 1ONBA 4R71A 3A1TA 1NBMD 2H7VA 3CNOA 1VIYA 2JJ1A 1FQJA 2KI5A 1E4YA 4RY2A 1CS4C 4OK5A 2Q9BA 3UMRA 3DM5A 4CIDA 1EESA 4FXPA 1PLLA 2V1UA 1ZD1A 3P20A 3U7HB 4CVNA 2PMDA 3JVUA 1XCGB 3D31A 3W8RA 1MABB 4DXAA 4UNNA 5EXPA 4LGMA 1E9BA 1Z8FA 2DWPA 2XOKA 2ZRLA 3AEZA 3QJYA 4QC2A 2HEIA 5JJIA 2OUKA 2Y8EA 3LD9A 3DM9B 3FHOA 1P2UA 4HSEA 4BE7B 4TYNA 3QEOA 4X8MA 3QXCA 1N5LA 3KTAB 3BAFA 5D3MB 2IS6A 2O0KA 2XZPA 2ZRMA 1YR6A 4Q9LA 5SZKB 1JEEA 2FMXA 4L5BA 3PUVA 2ZU6A 3GLFE 2RGCA 3EWSA 1RRCA 2WSMA 4FCVA 4B75A 3LLUA 2HJGA 1CR2A 1VMAA 2FU5C 3OIVA 2A5GA 4HYYA 4I4LA 4R9UC 1S1MA 2WMOB 4TMKA 1NMXA 3RS3A 3WNDA 1YHNA 4HDQB 4UXHA 2RCNA 1RJ9A 1RW4A 2QMUA 2CHVA 3T1VA 3FHCB 4Q9IA 4ZKDA 2RGDA 4QBFA 2J0QA 2CL0X 5FTKA 5HZKA 1UKZA 2VP9A 2VO1A 2KJQA 4ZCIA 3GJ5A 3OEHA 1E0SA 2FF7A 2D3WA 1KO4A 4Z8YA 2Z0MA 4AYWA 1BYIA 1JJVA 3RHFA 1EFCA 4URUR 1NVWQ 2ZU0C 3B6EA 3Q85A 1AKEA 4LYHA 4IOKA 3EIEA 1TF5A 2WICA 3RYTC 2VIIA 3AF2A 1XTRA 5CYPA 3FWYA 3E1SA 4F4IA 2G1KA 1BH2A 3BFXA 1CP2A 4WXRA 1LF0A 1ZU5A 2X2EA 2QL6A 5FUXA 2C5LA 5L8VA 4H1UA 1VIAA 1D5CA 1G1MA 2Q6TA 1NKSA 4OQLA 3THYA 3GLHB 4OI1A 4GRAA 3AF1A 5CIQA 3AF4A 1FOEB 4MYTA 1RYFA 1Z06A 3K9LA 4Q18A 4Q1DA 1WQ1R 4S35A 4B73A 1A82A 1YZNA 4V02A 3RS2A 3KZ1E 3ADCA 4JVMA 3VQTA 1S4QA 4RJLA 2IA5A 1E9FA 2QE7A 5EZ6B 2QROA 4BFXA 4ZCLA 1M7GA 4FMCB 3TKLA 1C1YA 1OXSC 4NKRA 1ZCBA 1E99A 2GZAA 2W2TA 3X1XA 2O8DB 2IC5A 2XSZA 5BXQC 5LD2C 2OBMA 3AF3A 3X1DA 5KU1A 1DEKA 3Q5EA 1E94E 2IEYA 4QM7A 1E69A 2H92A 2E1RA 1SKQA 4RD4A 1AS0A 4Q00A 4EAQA 5B30A 2FEOA 2PCLA 2PL3A 4BFVA 1XNJA 1FTSA 3Q7QA 3LVRE 3L8YA 3TBKA 3SJCA 5BW8A 2J5XA 4KFUA 3JZMA 4LV6A 5CK5A 1QHIA 1E2JA 1E32A 3H84A 2IS1A 4Z1MA 2CCGA 3WMFA 4QGFA 1G7SA 4MDEA 4AKGA 1OFIA 1AA9A 2PMKA 3EZ9A 3AVVA 1H65A 2HLDA 2ZR9A 2OM2A 1D2NA 3SU8A 1HA3A 4LJ9A 3ADBA 1ZNZA 2PX3A 3A4LA 3QNUA 3GEEA 4M21A 1AIPA 2KB0A 4ZO4A 2FSGA 2VL7A 2GJKA 4P4SB 4C9BA 1ODFA 5L3QA 4Q66C 3K1JA 3OIUA 1XXHA 1ZC3A 1KJZA 3LDAA 4B6FA 1S2MA 4LJ5A 1XXHB 3FMOB 2BVNA 1LTQA 2VYFA 3KQKA 2GVZC 1TQ2A 1CR1A 3IQWA 3KDSE 3RANA 2NMVA 3IHLA 821PA 1P5ZB 1AZSC 2JLRA 4IDNA 1JXMA 2WMNB 4O25A 1E9DA 2BBOA 2ZE5A 3BC1A 2BJVA 3I8SA 1W2HA 4A6XA 1U8YA 1QVRA 1FX0B 1DAEA 4PANA 2R6FA 2P67A 1J90A 1EXMA 2BMEA 3FFAA 2EFGA 2P65A 2ZUBA 2LWIA 4G5SA 4Q9KA 3T35A 4DCNA 2ZUCA 1GIAA 1NJFA 1QZXA 1YZKA 1ZNWA 121PA 2ZS7A 1S8FA 1MABA 3U3JA 2ECKA 1MO3A 4LJ8A 5JZVA 4A82A 4OHXA 1G3QA 4TYQA 4B2IA 1NP6A 2ZETA 3E2IA 5EP1A 4JVSB 3BS4A 1KI6B 2C9OA 1IN5A 2HT1A 3H2YA 3THYB 2FFHA 3DMNA 3KTAA 3BFVA 5JI3E 2QUZA 5D3MA 3B1ZA 4TLEA 1YZQA 5FPYA 1ZUNB 2VHCA 1ZRHA 1G41A 4DHEA 3SC3A 5EE3A 4B71A 1OJLA 3BOSA 1WE2A 1IY2A 1II8B 3OAAA 3P32A 4M1TA 1LNZA 3LVQE 4KFRA 2BBSA 2IW3A 4WA7A 1Q1QA 1CXZA 4KVAA 2J0SA 1DAKA 3K53A 5HCIA 4PPFA 5J4HA 3RC8A 3CB4A 3UXMA 1IAQA 1RJ9B 2J7KA 4HZUB 3PCRB 4B44A 1EWQA 3D7MA 5ANRB 3UMFA 3NKVA 1OH5A 2ANBA 4JLPA 4MRNA 5KPDA 2WKRA 4A92A 2EWVA 2ZYVX 4JLKA 1DG3A 1E2IA 2N46A 1RKBA 4RVCA 4TMVA 4OHZA 1G6HA 2J9RA 5CM9C 1CRPA 1ETUA 3SEAA 1N6RA 1DADA 2QGZA 3WHKA 3EWAA 4P33A 2VSOA 4CRWB 2ZS8A 4LDJA 4B3FX 3B85A 2WM9B 4IJMA 1E1RA 2A2ZA 2NO6A 4LHVA 1P4SA 1OKKA 4U00A 3EPJA 4GOKA 2H1LA 4Q01A 2H8KA 3VX3A 1U0HC 2DFTA 1HYQA 2YWGA 1WCV1 3LBHA 1NLFA 4DLRA 4PO8A 1ZP6A 2VBCA 4M22A 3SYKA 1UDXA 3OESA 1IJEA 4IKEA 3UATA 1ZJ6A 1CR4A 1ZYUA 2C03A 3W3AA 3EA5A 4MKGA 1DELA 2JEOA 3KKNA 4RD3A 5KSPA 4G5GA 1COWA 3GLGA 2V9PA 3LWNA 2A5YB 4I81A 2IYVA 4LBYA 4RFSA 5GJVC 1DTSA 1HY3A 3PFIA 5FR2A 3QY0A 4AURA 1MO4A 5FBWB 1YZLA 3MWJA 1ZVQA 4JLVA 4MYCA 4TSFA 2W83A 3K70D 5TXGA 4DLWA 4Q4LA 1XMIA 1XD9A 2VH5R 3MWLA 4IRUB 3V9PA 1Y3AA 1FP7A 5IF9A 1JB1A 2OCAA 2R44A 3QXXA 3CX8A 3LV8A 2BKEA 3TLXA 2SHKA 4YXWD 1OH7A 5HE9A 2FA9A 4EFLA 5EP2A 3PV0A 4LCBA 1XJ0A 2NO0A 4F4JA 1HQYE 4MA4A 1YKSA 5E4FA 3QIAA 4QHSA 4HZIA 5JS7A 4LHWA 2R65A 3R9WA 5LB2A 5EXTA 2CMKA 3SE0A 3C16C 5FI1B 2BKUA 1A2BA 4AK9A 1QHGA 1S96A 2FEMA 4PZZA 5EUQB 3UWKA 3ASYA 1NN0A 3EXAA 1FP6A 4Q9HA 4B3DA 3PUZA 2W00A 2QT1A 3EW9A 4EPRA 3AVUA 3SZRA 1FQKA 1FUUA 1KNQA 1W4RA 3QF4A 4K8OA 1AKYA 3RS4A 3TQFA 4D82A 4EIWA 4R7ZA 4XVUA 4U5XA 3TJZA 4WVFA 2B7CA 1P6XA 1E0KA 2AX4A 3CX7A 1Z0JA 3BWDD 4QGHA 5KPJA 4V0OA 4HB0A 4HAUA 1Q12A 4MITA 2V54A 4Q47A 3AVTA 3TUZC 3K0CC 1SVWA 4JMPA 4B74A 5J4KA 2XNDA 3CZQA 2ERYA 5EP3A 4TL9A 3U3KA 5FPKA 2A5JA 2FFQA 2QMHA 3GJ7A 5B64A 2BDTA 2DHRA 1KI2A 1SHZA 3MWYW 2ZEJA 2OLJA 2OILA 2H5EA 3P27A 4ZKEA 2BCJQ 3W6NA 2BEJA 3EZFA 5TV2A 1FX0A 4TT3A 4OI4A 2GJAA 2DWOA 1Z6YA 421PA 2QEQA 1JR3A 3LQQA 3GFOA 1J99A 5JJLA 5JRZA 2P3SA 5F98A 3T1TA 3PVSA 4UKDA 2YC2C 1VYVA 3TAHA 1OT3A 1II0A 4PSKA 4V0LA 4DLVA 1U90A 5DISB 1JQLB 5IK2A 3REGA 4PC3A 3I4LA 4ITRC 5GADl 3FKSD 1KSFX 4DCVA 4BFTA 2VSXA 4C0SA 1AQUA 1R2QA 4GSYA 3JZAA 2V7QA 1U98A 3GFTA 2FSIA 2WJHA 3B9PA 1N3BA 3QVUA 4JBWA 2RGXA 1E2EA 3AVOA 1B23P 4I1UA 5TMPA 3ZQ6A 5FOUA 4LPSA 5FTNA 3QSYA 1KO1A 4ACAA 4FINA 2DFLA 2PZFA 1TADA 3GLIA 4D4LA 4ESVA 2IYXA 2AKYA 3VR2A 3PENA 2J0VA 3M4YA 3LBIA 2IYZA 4NU0A 1LV7A 5HKKD 4QXAA 4IEEA 4PC2A 4M53A 4Y0VA 3ZS9A 2O0HA 2PJZA 3H0KA 4DB2A 2NIPA 1KK3A 2GDJA 4TQ9A 2AXPA 5D3QA 5H68A 4WZ6A 4XTCS 1IQPA 1FMJA 1DVRA 2HT6A 4KCGA 2ATVA 2X1VA 1NLYA 2REOA 3CONA 1EFUA 2GCPA 3UMSA 3GLHE 4Q19A 4BZXA 1E2FA 3B78A 3V4FA 2F1RA 2F43A 1FPMA 2OFXA 3NC1C 4XJXA 2QBYB 3U3OA 4ILEA 3ADKA 1JJ7A 1N5KA 1Z2CA 1TMKA 1FUKA 2VPPA 2IT1A 3LW7A 5EE1A 1VG9B 4LYFA 4AI6A 4O3MA 1JQJC 1F2UA 1G8YA 2QRZA 4BFWA 1W4AA 1IXSB 1X86B 1UAAA 1WP9A 3IQXA 4RKFA 3PUXA 3W34A 3GJXC 4OHWA 2QSYA 3FPAA 3CRVA 1DAFA 4O2LA 1G3IA 3BORA 5JEDA 5FTMA 1KDOA 2P0EA 4BLOA 3A37A 1GL7A 2NGRA 4RFSB 1XF9A 2QU8A 1QBKC 2F7SA 5KSOA 2R8RA 2PCJA 1CJMA 1KAOA 5H70A 4ZDWA 3ZQJA 4P31A 1Q20A 2GZDA 1QF9A 2BIFA 3WP0A 3CPJB 4I1SA 4A36A 3ND9A 2F3RA 5FBQB 1W7AA 2FSFA 1LW7A 2A30A 2RGBA 4BQSA 1G8FA 4MGZR 1VCNA 1R5BA 3BERA 4V03A 1TNDA 3ZS8A 1SGWA 4A2PA 1UFQA 1XZQA 4MGKR 4PHGA 4QNRA 4XIGS 1FNNA 1XPRA 1Z6TA 5LDDC 2ZRFA 3C7KA 1XEFA 2H16A 3HWSA 3TK1A 4U7DA 2FGKA 5IDVA 5EJEA 2F6RA 1TL7C 2I1QA 3QI2A 4HLUA 1XD8A 5JRJA 4YQFA 3L0OA 1KDRA 2ORVA 3B5JA 4M1WA 4YONB 3PG5A 3FHTA 5JBQA 1N6PA 1CJTC 3BH0A 1OSNA 5CB8A 3BIFA 1DAMA 3CWQA 1JNYA 2O5VA 3KQNA 4KYUA 5JECA 5EUMA 4N1AA 1YJ5A 3TSWA 1JI0A 3QPVA 4PZYA 2P6UA 2PLRA 4HDOB 4ASUD 1N2CE 1KY3A 2FX3A 2VLIA 4D0GA 1NN1A 2QGNA 4JLOA 2QENA 3SOPA 3RNLA 2CVHA 2ZYWX 2DFKB 1US8A 1KNXA 2OFWA 3BK7A 3QPWA 1KK2A 1VCIA 3GJ6A 2EFCB 1UKVY 3RS5A 3PITA 4RZUA 4D25A 4TZ6A 3LAWA 1GNQA 4JZKA 1Z83A 1CF4A 3KKOA 3RSOA 5G41A 4B35A 4LK2A 3NEJA 3PEWA 3QQ5A 2ZUDA 2D7CA 4KO8A 5DGXA 1HQCA 5FOSA 5AWFC 2OZEA 5K8TA 4M1MA 1ZM3A 1AGPA 3BBPA 5K8UA 4QHTA 2ZR0A 5K8IA 2MMGA 4PAMA 3CPEA 1YU9A 1MO5A 4GMDA 4BFUA 1M7HA 1DE0A 4XWAA 2Q9AA 1TF7A 1DO0A 3KKMA 3WYFA 4NONA 4IXMA 1NVXQ 3NIBA 4V0KA 5BN3A 3G0HA 3B7GA 1GNPA 4UXJA
chains in the Genus database with same CATH superfamily
2B2XA 4I8DA 1DHTA 3LI2A 1V4VA 4KYIB 4U2CA 3T9FA 3KG2A 1FZTA 2D2IA 4FFSA 3TW6A 4QO7A 5HKKA 4BMOB 4CIXA 3ID6C 1KH2A 3WLJA 1DJOA 1OY1A 1H9AA 4F2WA 2C7VA 1SNYA 5HHTA 1N1GA 1SBCA 3BTVA 1Z0SA 3MTQA 1DOZA 1N8KA 3MBKA 3TW4A 4MQFA 1SBYA 3JVDA 5ECYA 5F5LA 4Z0NA 3W0LB 1DC6A 1SIBE 4HRXA 4YO8A 1LBHA 1XRPA 3OD5A 3ZQ4A 4TZTA 3F6CA 5A5EA 3UPUA 4NARA 1EVYA 4UREA 4ZGBA 3PHGA 1YS6A 3MTGA 1I4DD 5REQB 3VMFA 5E1DA 1KDYA 3V55A 5REQA 3DVLA 1OASA 2EARA 3HS3A 1J2UA 5U9CA 1P7PA 1GG2A 3EW7A 4R9RA 4OAPA 3N70A 5DM70 3EXG2 1H2RS 3QPUA 5I5EA 1UBMS 3QUAA 1LI5A 3TGLA 1UBLS 3D3JA 5JMPA 3T99A 3G9ZA 2DUMA 4WVLA 3IR5A 4D4MA 2GM4A 4ISBA 1T8PA 4J9UE 2QI9F 2XVXA 1Q0ZA 1KP3A 1VPTA 2VDUE 4FK8A 3F4BA 4M36A 4NL4H 5F4BA 3DOEA 5CFOA 3I30X 4IY1A 4XX1A 5IDWA 2UZ0A 4GFDA 2WJZB 1PT7A 2BC9A 3FXAA 4XYGA 3U4QB 1D4ZA 1UXOA 2H3EA 1G20E 3LDHA 3LIIA 4RNCA 3RTGA 3V33A 3ZYZA 1UJMA 4WXYB 1SHTX 2EFHB 2Z1NA 1B93A 4WCFA 3PB3A 4A73A 1CG6A 3EQ6A 2EWWA 3ZJUA 2V98A 5COBA 2H5IA 1OWPA 1TLTA 4AP9A 3VBEA 4DBLC 1XZPA 1D6MA 3R0JA 3UWSA 4GXQA 4O3FA 3H65A 3NBFA 2CHQA 1K63A 5KNDD 2VCHA 1C7ZA 5K51A 2Y77A 4RTQA 1C3XA 1NMYA 2DYKA 3DGEC 3IHWA 4QRHA 3I9V6 1BMFD 3DV2A 3K92A 2ISSD 1SPBS 1MTZA 2AI1A 1H1LA 2E6KA 2W6QA 4AZSA 5IN5A 2VOJA 4C5BA 4P3NA 5HM8A 3A6LA 4L4ZA 4G1VA 2ZRNA 4I99A 3FUTA 5LQJA 1NXWA 1GLVA 3BG5A 3R6WA 4EVRA 2Q99A 1KMMA 1TMYA 1U63A 3EC2A 3IV7A 5C4GB 3IV9A 1OLUB 4UDOA 1RWVA 3REQA 5BOSA 5LLSA 4X91A 3WIOA 1XLVA 1UBKS 3WISA 1PD0A 4FMPA 4H7JA 3E7DA 2OKGA 2WLTA 4NNOA 1RP7A 3REQB 4WV3A 1D4OA 1ZY2A 2CEAA 3QHPA 3VGPA 5A9RA 4EMTA 2A3RA 4HCJA 3LY8A 3DFKA 1E8DA 2OUIA 5MF6A 5LBUA 4DNPA 3NTUA 3AKEA 4F97A 4FOOA 2VRWA 4OHPA 3KNZA 3BRQA 2XKAA 5CLFA 1Q14A 1SIOA 3N6XA 3NIGB 1PG0A 2XRFA 5FLXA 1J5PA 1EB9A 4JCCA 4Q6BA 4J2TA 3GIDA 2NUPB 3IUJA 1BA2A 1NW9B 3Q40A 2Y0EA 5TQVA 5KOHA 4CV3A 1MIOB 4XM2A 3IKMB 2BEWB 4RKEA 2F1HA 3HU5A 4Y18A 3ND8A 3ZLTA 3RVSA 1J5XA 1HDZA 3F3YA 3WB2A 4D43A 4E3WA 1SCKA 3U39A 4DBVO 2HBYA 2FEWB 2ID9A 5JZMA 1A7KA 3GLIB 1DC4A 3I72A 1U1CA 3N0VA 3OLCX 3IQZA 1NW3A 2B3DA 2GTHA 4JJZA 3E0XA 4DIDA 1I2MA 2CF6A 2RCYA 3ZDCA 1KHTA 2DR3A 5K5EA 3L6UA 2Z8YM 1TIPA 3FVRA 3SSNA 1E3MA 1R8YA 3P9NA 3P7MA 4CM4B 1P1IA 2YVQA 1PUIA 3O8DA 3T4EA 1YFLA 2WV9A 2FVYA 4WK6A 3DMGA 4F3KA 1G5TA 1P3Y1 3ZV6A 2D1RA 2IYEA 2ZYDA 2ISCA 2XUOA 2ZT8A 4M86A 1BJKA 3JAWB 4EG3A 2OFPA 1NP3A 1E1DA 3EY9A 4I19A 4NHOA 4F38A 1UFVA 2I2WA 2W11A 4KQCA 1IH8A 1MB4A 1WY5A 4H1HA 1NBME 3NHLA 4LBVA 4LVNA 4XOIA 1T36A 1JR2A 1YR8A 4XM1A 3T41A 2EEZA 2AKAB 2I2CA 3BD8A 3E6AA 3TG2A 3QH4A 4X8OA 1I3LA 1KVTA 1ISJA 1YRLA 2FRDC 5CXXA 4KPFC 4DJDC 1GGKA 2CNLA 3AONB 1RWQA 5HS4A 1H4SA 3DONA 3GLIE 5JVDF 3BXHA 3C8HA 2F8TA 4BLUA 3PFHA 2Q6LA 1O8CA 2PM8A 3UW1A 1TTHA 4IDEA 5AJTA 3T7CA 2WBLC 1M2EA 2W2KA 2VF7A 1C0PA 3QYFA 2C2BA 3ISVA 7GPBA 1DQRA 2WAMA 2AUMA 2VHVA 2QDKA 4Z2AA 1SXPA 2PL1A 4ID9A 3GX1A 4HK4A 4JITA 4DEXA 4JT9A 3NHAA 3VFDA 1PAUA 4HJXA 4PW0A 4BTLA 5A9SB 4DEYA 1SCUA 4UPEA 3IE2A 1DC8A 1SHUX 3FJOA 1Z6PA 2ABWA 3GP3A 3IBCA 3IGFA 4HTFA 4RTKA 2G07A 1H42A 1E7MA 2C58A 5KI6A 4ZCTA 4OHCA 2N75A 2I3DA 2XUGA 1QU3A 4EJSA 4NJMA 4HEA1 3H2ZA 3U48A 5D1HA 1AKTA 2X0IA 3K5PA 4S24A 1B41A 3DW3X 3W9SA 4NXMB 3ORFA 3S44A 3EF0A 1V6CA 3SYLA 4C2UA 1JEDA 8MHTA 1FFEA 1KYZA 1MC4A 3EDYA 3LCRA 4KPUA 4MX8A 1EQ2A 5T3UA 3TQRA 3Q8WA 3QUSA 3P9CA 2AJTA 3WGMA 2G9RA 2ZT6A 3P9ZA 4RPJA 1EM8B 1USIA 3EGDA 1XGKA 2R4UA 3EDQA 2CCJA 4H7IA 4M0FA 4DW8A 4BVAA 8ADHA 4H7FA 5FWXB 4DLBA 2EG9A 3B70A 2I3ZA 2AWNA 4U6NA 5LXTF 1OMOA 4HLQB 3GFPA 1FTQA 5B1SA 1EDOA 1KPIA 4NBTA 3OZEA 2X2OA 1FRVA 3KKLA 2FZVA 4IO1A 5F9HA 3I3SR 3GLSA 2FDXA 2FSPA 3DF9A 2E21A 4F6CA 3H9BA 1JQDA 3NKLA 4Y2TA 5JR3A 3ICQB 1XROA 3A3KA 3QVVA 1Z75A 5CIWA 3DV0A 4RX1A 4JHXA 3EARA 4ZJUA 2XMDA 2FRDA 3RS7A 1YKFA 5FB3A 3CSUA 3K72B 3RUPA 4D8TA 1SD2A 1KY4A 4F5ZA 2JCBA 2EJUA 3LECA 1U7TA 3CMMA 3DNMA 4G81A 4L74A 4LOJA 3I5YA 3U7FB 2FFRA 1KY5A 1Z07A 3IIJA 1SU4A 1XKLA 2O3QA 3N3BC 3IE0A 2BFMA 4DB4A 4URHA 1SEVA 5EXXA 1NAHA 5AVTA 4F46A 3M6LA 2DF8A 2G0NA 4TMYA 1JIQA 3NWBA 5FPSA 1B3BA 4PGGA 2ZR7A 1YOVA 4M60A 2C59A 3JX9A 3P2YA 4MVYA 1GPLA 4L8GA 1WSBA 1RCUA 1J9EA 1A2QA 1AK9A 1T35A 1Z6AA 2HMWA 4C0LA 1TUEA 2QTWB 4EVQA 1E2GA 4J0CA 3HJNA 3WNCA 2VP5A 2GF0A 4HEHA 4BIIA 1XQXA 4DR6B 3SHTA 3DEZA 5K8JB 2WU4A 4K40A 4TYYA 4PYQA 1O87A 3BGDA 1SVLA 3UQYS 2R66A 3P9QA 3HVKA 2Y4NA 1I10A 2OO7A 4EL0A 4TKUB 1M6NA 1R15A 4RABA 3ZU6A 4R2MA 2GA9A 1T1IA 3EIXA 4FBLA 4CLEA 2I54A 2JIMA 3NPAA 1GG8A 3ZE8A 2PV7A 1MA3A 1SVKA 4LC0A 5BO5A 3ZE6A 1GU7A 2HLDD 4L78A 3CF0A 4XYBA 1R8QA 3O8QB 4UAJA 2PIDA 2ZYSA 1BRMA 1P7VA 4FYVA 4NMLA 4N9WA 3L43A 4OOFA 5SZJA 2WWXA 4P3YA 1C8KA 3O90A 2Z9BA 1HZJA 1SWVA 4RYLA 1Z4JA 4CG1A 4QG7A 3LPLA 4FNAA 3GEHA 5L6LB 2YIMA 2AD1A 4IKPA 4KRYA 1I0IA 1YNOA 2BM9A 5T4FA 3C3XA 3DBRA 2CFOA 3ZWWA 5AUOB 1A5TA 4TV8B 1CUSA 1KYXA 4MVJH 4NQRA 4Y6RA 5DOVA 4UDNA 3JWPA 3O84A 3OLXA 3ZVRA 2R6GA 1VKNA 3FCCA 3JWIA 1INLA 3KWMA 1QG0A 1DIOB 4P86A 3NM4A 4PAQA 3TCKA 1PSDA 2X77A 1E6KA 3PEEA 1Y3DE 2WKQA 1PZFA 2OXRA 2UZ1A 1M10A 1V3UA 2XPCA 3S28A 1C9JA 2C1EA 3K8QA 1R9GA 5IDYA 1RIFA 1F1BA 1H0KA 1I2DA 3DFIA 3KFXA 4L8WB 3WV4A 4BB9A 5AVSA 1W36D 4EFDA 4YP1A 5K2MA 2XUDA 5FX2A 3JQBA 1U4SA 1Z4OA 3I2HA 3C6ZA 5FL3A 4F21A 1HSOA 3L41A 1M2FA 4BX3A 3A0UA 2ANCA 3HI6A 4ABTA 2V3CC 3B3AA 3DD1A 5M04A 1BHSA 5H3CA 3OCXA 2Z2XA 4W5RA 3BQNB 3NXKA 4G8JA 4RM2A 5EJMA 1LTKA 4JGIA 4LEIA 4OHOA 5DNCA 3FNRA 4JZYA 3ZIAD 3FFWA 4QTXA 1PR3A 4JQYA 4NBLA 5SY6A 1OI2A 1DKRA 3KLBA 2O05A 4JB3A 2NZWA 4QBGB 2X4IA 2C7QA 1E2QA 4UEWA 1T8RA 4KZKA 1R8JA 3NHJA 2IQIA 5DF1A 1W5TA 1G0NA 1ZRNA 1JA1A 4ZQHA 1Y3FE 2IWHA 1X87A 1YUMA 1XE3A 2FLVA 3V8BA 1PFQA 1CX9B 1L7PA 4ZT5A 4QKQA 1DAGA 4NE9A 1ZJWA 3X1JA 3QA3E 4Y1GA 2VFAA 1YQ9A 4QQKA 3KBBA 1R50A 1M72A 1RKQA 2QIPA 4EUHA 1J8FA 1K4KA 1VL5A 2RC6A 2Q9UA 3P0JA 4MRMB 4NYIQ 1FDRA 3AETB 1GADO 4MB2A 4PNHA 4DM3A 3EZLA 4MROA 2JHCA 1UT6A 1UK9A 3K2BA 3K8OE 1U81A 2ZCVA 4A3SA 4G0PA 4POAA 1W4LA 4BGDA 3MTJA 3MLAA 5TC4A 4D1YA 1E77A 4BO6A 1X1EA 3ENZA 2WHQA 3PXBA 3O38A 5A04A 3QKSA 4ZT3A 3O4RA 4BRWA 1E3WB 2Q45A 2XD4A 5K0SA 4KE6A 1KOLA 5MDHA 3LMKA 1W19A 3M5WA 2DBZA 3JCZA 3QFFA 2A0XA 4KGDA 4XPIA 1NY6A 1U8CB 1XTKA 5P8WA 1CVIA 1ECFA 1WB6A 4MVJF 2PMBA 1DQYA 4XB6B 3ENNA 2B4TO 4YRQA 4BJ3A 2QAIA 1NURA 2X15A 2AJCA 3I8OA 3LOQA 3AT1A 1QWOA 5CBKA 4WY5A 2H9YA 5IMBA 2H6EA 4PX3A 2XECA 3NM5A 3VR2D 4D97A 3IC5A 3OIWA 4DDTA 4URXR 4BMYA 3G7NA 4OL9A 3N9IA 4LXIA 2FZGA 1DPFA 3DMYA 1NF8A 1XD2B 2PA3A 2AR7A 4W63A 2G71A 3RDPA 3CRW1 3OICA 1T25A 4JI7B 1UIMA 9ATCA 2P9CA 3UJHA 3VOBA 1R0ZA 2CLOB 3VAYA 2QP4A 2IYSA 3NGLA 1E1CB 4F0JA 4D8WA 4B7XA 3URMA 2VYCA 2WYVA 2CWDA 2B61A 1TJPB 2PBFA 3VU9B 4WN3A 5JCJA 3WWZA 4EEKA 4F71A 5JUWA 2OCYC 4X3OA 1OQAA 3NWJA 2GLUA 1S2GA 1QHHB 2SECE 3TSOA 4RH1A 5ITVA 2VQSA 2QMQA 1YMVA 1KTVA 3MGAA 5CITA 4NATA 3MINB 1KJWA 1FYWA 1WVMA 2F43B 3MS4A 4IDGA 1XWFA 4MKFA 1PLKA 4PGHA 3KK0A 2AFVA 5AVUA 1Y5IA 3AZPA 3ET5A 3GJRA 4DDWA 2JFFA 1ZICA 3T3EA 3B3FA 2SICE 3R09A 4GMXA 1PQUA 3FPFA 3HABA 2C95A 3U7RA 1T0UA 1K8ZB 3D4PA 1TO1E 4KV9A 4JEUA 3T06B 1YQTA 3DVAA 4YJ3F 3UNXA 1LX7A 4NFHA 2OCDA 1RWOA 3QYPA 3RV3A 1WMEA 1GD1O 5DU2A 1NZJA 1DL5A 1XX6A 3K1AB 4JP3A 3M6FA 4A2WA 1FXSA 1E9SA 3OZ7A 3W9YA 4HRAA 4W99A 2PO5A 2JG3A 1UADA 2J7PA 1FLVA 5GQSA 1P0QA 4AQDA 1V5WA 3COYA 4H0CA 2VJBA 1LUAA 3IBTA 2KPOA 2I8AA 3AERA 4P35A 4C2AA 5F2NA 4M2LA 3EEOA 3BE8A 3L1JA 4GKAA 1S2LA 2IHTA 3GW8A 4DNFA 1S1CA 4KO2S 4M38A 2QLNA 3DDCA 4HPXB 4IDQA 1WB5A 4KGZA 3VR3A 3T3NA 4RPCA 2ZRJA 2V03A 4OA5A 4TMXA 1JBEA 4FFLA 4MVXA 3RVMA 3A05A 3ICPA 5CVDA 4RH0A 5T57A 3T3HA 1MMFB 5K4GA 3QE0A 2B25A 1UODA 2ETVA 3AHHA 1G4AE 2Z1MA 3GFFA 4LXUA 5LA6F 4OQNA 1IBKB 3ACBA 1TU4A 3E9QA 4A0SA 2C99A 3EJWA 4B8ZA 4OUKX 1AU9A 3VZCA 4AT1A 1V5EA 3GBPA 1JHUA 3BQ9A 1S2OA 1MX3A 2W2VA 2WPDA 1MPXA 3GGGA 4IDDA 4ZQEA 5A5DA 2XYQA 1GUFA 2HNKA 2VYNA 3MLEA 1U1DA 1NG1A 3U3MA 2P8JA 1UKCA 1OHHA 2OZLB 4L28A 2BLLA 4XD7A 4DR7B 4PS0A 1K86A 4KN6A 2QXUA 3ON5A 4N0PA 4D46A 1EDZA 4V3BA 4UE2A 4EYGA 3UMYA 5CT6A 1ID1A 4BTVA 2OC4A 2OB2A 3O8OB 1KI9A 2VN8A 3C3WA 4KUGA 1XP5A 3BB1A 4BLSA 5KJCA 4N48A 5TVGA 5IS2A 3LXUX 3VHLB 1EGQA 1HT1E 1MPTA 2V4UA 2LGJA 1TD9A 2JRLA 1WPGA 2H57A 1T1SA 2OHJA 3PFBA 1XDGA 4QDTA 5FA6A 2WU8A 2F3UA 3AR7A 1LPNA 1XHEA 3EGXA 3VPAA 4J7XA 2VHWA 3C1OA 1AKMA 1VHLA 3EGXB 3HG7A 2VDNB 1FSPA 4FNOA 4KQWA 1RI4A 2VPIA 3K0AB 1SKAA 3QV1A 3QFCA 2HH9A 4XEHA 2CNNA 2P4EA 1MU0A 2VJMB 2W70A 5F64A 4NBVA 3RFTA 4IGEA 3WSWA 1KEEA 2R6CA 3JRXA 2VZ8A 1W49A 3HPQA 3L82B 2LCFA 4G5OA 1Y7HA 5B53A 4BFLA 4YX9A 5LN1A 3WMEA 1UC4B 3HBAA 3KB6A 3ZXSA 1KGSA 1VP3A 4EKGA 5I8WA 5C53B 3OTHA 3TCNA 3RKUA 2QNRA 1CUJA 3GBVA 1QMPA 1DTEA 1L7EA 3JQGA 3G0CA 1YJAA 4IIJB 4NDNE 4RFLA 2V6GA 1AH2A 2J6IA 5JEEA 1QIIA 1D2EA 1KETA 2EZ8A 4AXXA 1JSLA 3M0EA 1X8LA 2I80A 3DHWC 4P92A 3PR2B 1KERA 1ZK1A 7MHTA 2TYSB 3RQIA 1IWOA 1N6IA 1R18A 2JFWA 3QBJA 4YCAA 4B48A 3FNGA 4RD6A 3GC6A 3E9MA 3DXFA 721PA 1UEIA 3FNQA 3TVDA 1IXYA 4M1KA 5AKHA 2IPMA 4D8XA 5LP6F 1C2YA 1M74A 4LTDA 3TOVA 3HP4A 3A1SA 3LKZA 5SYMA 1QP4A 2WUFA 2ZYUX 2GEJA 3R7FA 3SBDA 4L85A 2AOXA 3BBLA 5I4KA 4MV4A 2GD0A 5FBVB 3HCEA 2I5PO 3F8WA 5CBPB 2ECOA 3DEJA 1O5TA 1JJBA 4YGXB 2OTCA 1QGDA 3JQDA 3SBEA 4GYYA 2NUPA 1GT91 1J7KA 4AKEA 3ANTA 3AMVA 3L4BA 1NQXA 1V37A 4DLAA 1GP2A 2XTMA 4QECA 2QMEA 3MTAA 3KKEA 4NH0A 4OATA 2FPMA 5SY4A 3CNNA 2AN5A 2B7BA 1VTKA 2XQIA 5FL7A 1W96A 4MHOA 2WNSA 3MFQA 4Y3UA 1ESEA 3VR6H 1P2DA 1S3FA 1CW2B 2J1LA 2V7VA 1YRYE 3SSOA 4YWHA 4O33A 4YV2A 4DJAA 1RAAA 1P61B 4ZYLA 4JKYA 4LXXA 3O8LA 3E5RA 1IRXA 1OX6A 3O93A 3WK5A 2B0JA 3TIVA 4KBGA 1KYIA 4NS4A 3FJYA 5AKGA 5BR4A 1C4OA 3CWCA 1VL1A 2IIPA 3QWIA 4TLMB 3ZW7A 3B1FA 2FFBA 4QM6A 1BVYF 5IVPA 3IO3A 4ZC8A 4NOKA 3ZZ0A 2F8MA 5GTDA 2PZAA 4KE9A 1N5OX 4OLBA 2ZRKA 3EWIA 1VKHA 5JBIA 1BE8A 1VECA 2V0NA 1DXYA 1KVRA 2V7QD 2YNMA 3DXYA 3R3YA 4LBWA 2J0UB 4LNUB 4L7QA 4PZ0A 3LCMA 2PUCA 2VDQB 3NH6A 1RYDA 2EIXA 2O3SA 4MARA 4RY9A 4GKBA 1R8SA 3CX6A 1QONA 2X8LA 3LX6A 3NT5A 4M9UA 3RVNA 1F4LA 2X19A 4JVOA 2O8FB 2IOFA 4X6YA 5DLQC 5BN5B 4BMPB 3DPSA 4G97A 5FPTA 1NVUQ 2WI8A 3HB1A 3WGOA 5EZQA 2WB4A 2CB9A 1WDKA 4HAXA 5IAKA 1RQPA 3FWHA 3QMVA 5A7FA 1CYEA 3TG8A 3D1JA 3PNKA 2QKYA 2VZEA 2E4AA 1E8NA 4Z5XA 2RG7A 5L3VA 2H2DA 3UJDA 2A33A 2RGEA 4CG2A 4DIBA 3HA5A 5BV2P 5SYNA 3SX0A 2AKEA 1QNFA 4XGQA 4KUHA 1NL3A 5GJCA 3T1YB 1JR3E 5F3WB 4BKPA 3R41A 4LGVA 3MN1A 1CNEA 4HPJB 5L4SA 4A6DA 3KKPA 1LK5A 4LDRA 1NI3A 4LF8B 1SC6A 2O48X 3C3KA 1AS2A 5A9SA 2XRMA 2GTIA 2G70A 2JIOA 2NO4A 4YRKA 1RMQA 2DY1A 4BNXA 4IPTA 4TS9A 5HR5A 3BQMB 3CBGA 3S1AA 2R2AA 2P7HA 4JKIA 1XUOA 3R40A 2WPDD 3JQ6A 1F2DA 4CTKA 4NJMB 1FJXA 3NKFA 5CA1A 3O3MB 1WKCA 3V2HA 3ZUPA 4NZNA 1CZKA 1T2VA 3CKYA 3KYCB 3O75A 1SVOA 2HJWA 3A1VA 3JWEA 4IOMA 2ZB3A 2HMAA 3NJ8A 2AH5A 4QUKA 5D2CA 3DF7A 3HRIA 2OT3B 1HPLA 3EAFA 3PIRA 3GRRA 3O3OB 2J5RA 1W0JD 3EEQA 1MC8A 4GI3A 3ZGLA 1JQEA 4FS8A 3EGDB 1CC1S 1R0SA 4DQDA 4KMSA 4H15A 2XF8A 4XQ0A 2WKWA 4GM1A 5IVKA 4G89A 4MCJA 4P34A 4BKRA 2G4CA 4OF4A 3B9QA 4C06A 2FF5A 4AY6A 1DAHA 1IIBA 1YJBA 2Q1TA 4BVGA 4E70A 1SCQA 2DP4E 2ZJ2A 3WAGA 1ATZA 1QPBA 1Y6FA 2W4QA 3UO8B 4G01B 4UTXA 5JZOA 4R2HA 3FYHA 2GWRA 3KZMA 3QEJA 4FFOA 1PFGA 3EXFB 1RU3A 3Q88A 4BFZA 2XCQA 4YLGA 5HSGA 4UHEA 1ZX1A 3NCHA 3R3JA 2ZBEA 3TI7A 3KQSA 1A5AB 1TW2A 3H5WA 1J8QA 3HBJA 5CB4B 3N2KA 3TN7A 1ZN8A 3R76A 3E7WA 4LV5B 1Y1QA 2M32A 3H11A 1JQ5A 1XFDA 4YT5A 2CDRA 3OPXA 3LBFA 2OQVA 5JD3A 3RGWS 1BMFA 2IE0A 1XZGA 1AKVA 4TL8A 3I5MA 3EHDA 3PTLA 5HUQA 2GAFA 3JQAB 1PGJA 4BGIA 1REQB 3C74A 3IA7A 1VC2A 1E1CA 2E7ZA 3L1KA 1RYHA 4G5QA 2R8EA 2ESRA 4ESHA 3QU2A 3WWPA 1ZH4A 3V6LA 5K8CA 1DOAA 2WWRA 4EW1A 7REQA 1I7QB 2FOLA 2EQAA 1EE2A 2CLFB 2QLTA 2YYSA 2G1JA 3QELB 2B6NA 1YRQA 3L5OA 3S1LA 2P9QA 4FYHA 4KDRA 4ZOQI 2BFBB 2LKDA 4MOWA 3A28A 2VDOB 4B09A 3VR6D 3I1FA 1QCYA 1CHDA 1GKKA 3O4IA 5HIKA 1EFRD 2IYWA 2QRLA 1BQ3A 2EZ9A 5FBZA 3NX4A 2YMPA 3BE6A 3K09C 2FWRA 5DSXA 1BQ4A 5I9NA 1KJYA 4FYYA 3V8QA 3KDAA 1GVHA 1NRXA 5JANA 2C8VA 5CH5A 2P2SA 3LZ6A 4BX2A 1M2OA 1SZCA 3PXXA 5JFOA 4JOCA 4OI2A 1M2OB 2BHLA 4KRGA 5THKA 4RENA 1LNSA 5ALPA 4Z3OA 4MGHA 4Z51A 3PL1A 5D7NA 3ZDAA 4EWLA 2REQB 4YYEA 1KZHA 4US2R 1YK0A 4H6WA 2YNMC 5JFTA 1TKAA 3E5HA 5C4MA 4QXRA 3J81A 3QOWA 2R4QA 2BMDA 3DMFA 5IWAB 1A8HA 3U61B 4TS1A 1FE8A 3AERB 1Y48E 3ILXA 1OTHA 4TMFA 3RUAA 1LDEA 3U9TA 1LU9A 1OFUA 4BO5A 4CM1A 1RAIA 4LWOA 4P83A 4H3HB 5KCZA 4DCTA 5K4HA 3KAQA 3LPCA 2QR3A 3NLLA 4JEIA 2I4MA 1CZRA 1HYHA 4TS4A 4KOAA 1D2GA 3GZJA 3ROXA 3SIXA 2CVOA 1XRLA 4JR0A 5M5BA 1II9A 1XF1A 2B83A 2FZWA 4Z53A 5DYTA 1Z6XA 3HP7A 3P9KA 1SOAA 4K6GA 4TN1A 4LWQA 2C4VA 3ZWVA 3TXXA 4N47A 5I9MA 2IOHA 2C07A 4KLRA 3ZCUA 4IYJA 4LCJA 2J3HA 2JZOA 3GZTB 2QYOA 1GQ2A 3UJPA 4D0LB 4L5YA 2GZSA 3SFVA 4LBZA 4PZPA 3ZBPA 4AQ7A 4EY8A 1ANKA 2OHVA 5TQ0B 2OQRA 1KL7A 1UMBB 4ZOEA 1M8FA 3E1KA 3L07A 5JDCA 4YBRA 3L0BA 3RIHA 4X1IB 2VAWA 1U3TA 3HUEA 4M9QA 2BM1A 2Q4RA 4CCYB 1ONPA 3DP9A 2P30A 4XVQA 4H7PA 3KS9A 3W3AD 2RK6A 2C29D 3IAS1 3Q6NA 3S3TA 3UYKA 2IXFA 1NNLA 1YOBA 5EE0A 5CAEB 5JW6A 3D0QA 3GT3A 3D5QA 4OCZA 2JJ1D 3K2QA 1S3SA 1XB2A 3LH5A 3TVYA 3PI7A 1X0VA 3LOPA 4IVNA 3VX4A 1XCMA 1ZD4A 1U3UA 1E9AA 4E7PA 1EVJA 5JS1A 2P41A 4TWJA 2D0OB 3FA2A 1W1WA 5B7QA 1HF3A 4JBNA 2CYCA 3W3AH 2BGNA 4KX3A 4DG5A 3OPMA 1RXIA 3LKBA 2J9GA 3FYCA 4KO1S 8AT1A 1VJ0A 1W5SA 1U0JA 5EIAA 4TVBA 3E61A 1GSHA 3RVJA 2AG0A 2MR5A 2YIDA 4QU0A 3SQLA 3A1UA 5JIBA 1EK1A 3DWFA 1C29B 4NC9A 1SB8A 4LHZA 2XVYA 3J81k 3HYLA 1X74A 4CEJA 1G19A 4J4HA 3AR2A 4LX0A 3ZU3A 1J1ZA 4COKA 4K6MA 2JLYA 2FN7A 2DLDA 2IYOA 3FNHA 3QKUA 2ACWA 3HB9A 2R25B 4XUGB 1XCBA 3C5VA 5C31A 3URKA 1SXIA 2HHJA 1YU6A 1XK6A 2JA1A 1E2MA 2PWBA 4A0HA 3F6BX 4O4JA 2L18A 3GPDG 4CLDA 3WOVA 3CF2A 2FUG1 4O4HA 3RFUA 3R7LA 3RRFA 2MHCA 3WNVA 5ESWA 1NF2A 4MYDA 4RY8A 4I3FA 5I7VA 3FHJA 4DSZA 1J8VA 1JKIA 4GIBA 4FCTA 1P8AA 2TSYB 1NV9A 2B4YA 2C31A 1GTVA 2HLNA 3FROA 4M1OA 4MS1B 4R2JA 4EY4A 1QBGA 4ER3A 1G20B 2NUTB 3PCXA 3JALB 3KOMA 2H48A 5BYBA 4B34A 1JT2A 3HFRA 3GG9A 5G40A 3K16A 3FPKA 5C8ZA 5IJAA 5K09A 2ZUSA 2PZBA 2JCVA 4GKKB 1JLMA 4MUFA 2CLMB 3FFXA 4M6WA 3DLBA 3QX3A 4XPIB 3AP3A 3PDIB 5FKJA 1OI7A 6PFKA 2P9GA 1UEJA 1NNEA 4QJ3A 3HKBB 4IXWA 4QFMA 3BWMA 3AVWA 1KP9A 4D9CA 4IFEA 2HA5A 4EATA 3KQHA 4U0JA 3LC1O 1ZN2A 1U11A 2O7NA 4JVNA 1YZUA 5CYFA 1VA4A 3FOWA 4B85A 5JQGA 1NRWA 4WRRA 3VJKA 3VJLA 1QF7A 4F1WA 1Y6GA 2PGXA 1Z6QA 1OIVA 3S2GA 3BKXA 3V8VA 3ZY5A 1HQKA 3P9PA 3I64A 4QJ5A 3UB2A 2GPSA 3PSHA 5JCOA 4R5MA 2C00A 4LVOA 1WMSA 5EYPB 4OYRA 3RC3A 4CM8A 2H7YA 3RJ5A 1YT5A 2XHEA 3GPIA 5TX7A 2WWGA 3KR0A 1TKCA 3AQIA 2JATA 3DOIA 3RABA 3ILVA 1GTL1 1IZ0A 1Z29A 4DUGA 1HKUA 1LLFA 3GNQA 1ULTA 2D7JA 4NV0A 1VI2A 2PRJA 2X8JB 2XGGA 3F3KA 4LNUA 4U2BA 3ZCTA 1YZTA 1J2EA 8GPBA 1JYEA 5CDFA 4F3RA 4FTWA 1JG3A 1G17A 5LQSA 4K7JA 3DB1A 1FXWA 3EZGA 3HEAA 4YREA 4ZIRA 4ZV4A 2VJCA 3H9UA 2A0YA 3EVZA 2QYSA 3IP9A 3JAKB 4YFVA 2F1OA 4JB2A 2CKMA 2ZBUA 4G8DA 5JMTA 3WKAA 1U2DC 3F9IA 3MB8A 3L92A 2D62A 3HE3A 4TV8F 3E5NA 4IKOA 4Z7JA 1KE1A 1TECE 3LQRA 1YIOA 4FFMA 2XVAA 3WGJA 1IXZA 3WK8A 4JC5A 1MNAA 2J3MA 2W2KB 3F6YA 2NU8A 2DWUA 4YRRA 4XSHA 5IK2D 2NXNA 1C8BA 3D4LA 3V1NA 1C0KA 2V3VA 2QAGA 1EHYA 3U3ZA 4BN4A 1BE6A 3DBHB 2CDCA 1Q77A 3TNFA 4QSHA 1KDVA 1YCGA 3T9EA 3DBHA 4NESA 3RF6A 4V0NA 3AL2A 3SQXA 5DCUA 5KTSA 1R0RE 5MN4A 2RK4A 2XEDA 4ZQIA 2ZPTX 4Q3NA 2W2MA 2VYVA 3DEFA 4TXNA 4WKOA 4MKRA 5JS2A 3K6SB 4HLUC 8OHMA 2H9AA 4AP5A 4WLNA 5H7XA 4QDXA 4LFCB 3ZWBA 2VNHA 3BULA 3I39X 1KJ9A 1P0CA 4F3YA 5ALUA 3AK4A 3T0FA 4EG0A 5AUPB 2XDWA 1P2GA 2JJQA 3DL0A 4MLCA 1ZBDA 1ZAYA 2IF0A 4MPJA 1DRKA 3GXOA 1U2EA 2I4NA 5EC8A 1XLTA 3OHPA 4FEEA 3NYRA 5GVRA 4ZYVA 3W5BA 4IIJF 2OCKA 1L3BA 2C4UA 3IMCA 2ZJFA 1JKMA 3THWB 5AVVA 4FHZA 5A1TA 4IQ0A 3P9XA 2BTEA 3GVCA 2IOFK 1K7XB 4KWTA 1QYXA 2ZBDA 3SSMA 1E6UA 4J7AA 4EB0A 4QQ8A 5KVSA 4ZQFA 3TR0A 1Z22A 4TKVB 1IY8A 4K9SA 3RC7A 1DCFA 5FI3A 1GRVA 1M34E 2WWIA 1KU0A 5GP1A 4WT7A 2CNWA 2HNBA 2AZTA 3ITDA 2PH1A 2SKCA 2XBLA 3KB1A 1EDBA 1XJ5A 2Z6VA 1QFZA 1YHYA 3C6YA 1P33A 3F8SA 5KAMA 5ETJA 2HK9A 2X2FA 4M1SA 5G02A 4CT4B 4EGFA 3MT9A 1KYYA 2JIZA 5CU7A 5AJZA 2J3KA 5JS6A 3JASB 4LX8A 4S0XA 1RWWA 4E2YA 1OIWA 1XTBA 2DQZA 2XUQA 2ZJBA 3H11B 4ZT7A 4OK6A 3SDZA 4RO0A 1LWOA 3R8FA 3PD1A 3BRCA 1H0HA 3RSHA 1R4NA 4YUXA 2YKGA 4A0RA 3C6KA 5EVCA 4IZ6A 3VKWA 1SH7A 2BD0A 4HGYA 4WKBA 4B17A 1JHOA 3R5HA 1E92A 3OQ6A 5CVUA 3BB3A 4C7OB 3SZOA 5CLHA 3EYAA 2OBNA 5AHKA 4Y2RA 4Y9SA 1OAKA 1Q91A 1WU7A 3ORRA 4LC1A 1QVAA 2IY9A 1ULAA 3HL4A 4LQDA 4L5JA 4FHCA 3U6BA 5BQFA 2I3BA 2WU3A 4Y30A 1GWNA 2JGAA 1Z33A 1VHQA 2ZTUA 3VNBA 5IJ0B 2VDMB 1AMUA 4FONA 4X1KA 4DG8A 4LMPA 2QLMA 5ERGB 4H7KA 4CETA 2J6HA 2GH1A 1LLCA 1K8XB 1OW3B 3A9WA 1XDDA 3O91A 3AU8A 1GNVA 2P90A 4IMPA 3NRJA 1NR7A 5DHSA 3S99A 3KQUA 1ISHA 3G9QA 3D0KA 2DKNA 1B7GO 2FR8A 3OQPA 1B26A 1SXJD 3AEKB 3K31A 1VRVA 4D81A 3RHZA 4GDFA 1P0MA 1FBTA 1QC5A 1QWSA 4F5WA 2IYFA 2W2XA 2XUKA 2YXPX 5COQA 3HJFA 2YHIB 3ICVA 5A3QA 4MS3A 5KJ1A 4KYTA 2AI2A 3IDSA 2FE4A 3I0MA 3N0XA 2GPJA 4RAOA 5KYKA 4TZ0A 4R05A 2FWIA 3D2CA 4DXDA 2ZRPA 4ARZA 2QW0X 3KEOA 3QM1A 1V8BA 2O06A 3HYNA 1YJ8A 3F7OA 3FDIA 2H07A 4L8LA 1ULHA 4MZXA 4GLFA 3W05A 4QJ4A 4B45A 3FUCA 4LISA 4RMJA 1CY1A 3A9RA 4NBNA 5F76A 1U8ZA 2YHBA 3DTVB 4PN7A 3BM5A 1JAYA 2H5JA 2OXCA 4FBMA 2DHCA 2B8TA 2EQBA 1JHXA 4G1EB 4Y1RA 5CJ2A 5F2EA 4QTUB 1TPZA 1J8DA 4JFAA 4EX6A 5DLDA 4CU5A 4FQ8A 1FRQA 3Q7IA 5BW5A 3RLFA 4BLQA 1GXSB 3SIWA 4BZWA 3D8UA 4GNRA 3E7XA 2WF6A 3B36A 3LPNA 3W5DA 3ZNNA 5FWDA 1V1MA 5DHAA 1VHDA 2V45A 5B4VA 2W6ID 3QXHA 5HF9A 1JHRA 1VLHA 2XTJA 4G9EA 4Q4HB 2I62A 3SWWA 2C4WA 3TQQA 3RRNA 2E4XA 1XZIA 4X60A 3ZDYB 2HJVA 3NDIA 3BIJA 3IEPA 4P22A 2JLCA 2E0IA 3BDIA 3AG5A 3A2LA 3CWZA 2IUYA 3N3AC 2QRMA 3K35A 1A72A 2PGOA 3WRYC 3M5DA 4BNIA 2A7QA 4J3FA 3WL4A 5E9WA 3WMWA 4UTRA 1FRZA 1SAYA 1UPAA 1EA7A 1TVEA 2OQ2A 5FAKA 2FQXA 1YR7A 2JL1A 5ARDA 1FTGA 5DLPA 3JQEA 3SJAA 1V11A 5CDUA 221PA 2I2XB 5TS3A 3HPRA 2AG6A 5K6AC 1XZJA 2QUBA 3OIDA 3CX4A 4HB3A 4QDUA 3V8PA 4BCDA 5LL6P 3AB7A 4KI0A 2W42A 5LQUA 2J0EA 3M1LA 1VIVA 2A57A 2IK8A