2JCBA

The crystal structure of 5-formyl-tetrahydrofolate cycloligase from bacillus anthracis (ba4489)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
HHHHHVREEKLRLRKQIIEHMNSLSKERYTTLSEQIVFSLYEQKEWAEAKTIGITLSMENEVNTYPIIEKAWKEGKRVVVPKCNKETRTMSFRQISNFDQLETVYMNLREPIPALTEEVNADEIDLQIVPGVAYTERGERIGYGGGYYDRYLVHYKGKTLSLAYSFQMVEHIPVEPFDKNVEKIITEKGTMVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-FORMYLTETRAHYDROFOLATE CYCLO-LIGASE FAMILY PROTEIN
publication title Structure of 5-Formyltetrahydrofolate Cyclo-Ligase from Bacillus Anthracis (Ba4489).
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Ligase
total genus 63
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 2jcbA00
1YDMA 1SBQA 1U3FA 3HY4A 3HXTA 1U3GA 1SOUA 3HY6A 2G40A 1WKCA 3HY3A 2JCBA
chains in the Genus database with same CATH superfamily
1CEQA 2V7PA 3QXSA 4OQLA 4B2LA 5JVDA 5F7OA 1PQWA 1UBLS 5JPIA 3B9PA 3PXUA 1QBKC 3DZHA 3DV2A 4EPXA 3IL2A 3RYIA 4CMJA 1JA1A 3HJUA 1YKGA 2EX0A 3PWTA 1D4ZA 1GUYA 1QGUA 2WMDA 4EJFA 4RZ2A 5FWYB 2XZTA 1W1IA 5J2TA 5SY9A 4OQYA 3QXJA 1LS1A 3L5KA 3ZH9B 4U3JA 1S4MA 5ADHA 2OZVA 2NXJA 1BKDR 1E6KA 1R0WA 3EYWA 5J2TB 3RRZA 1NRXA 4Q3AA 1E1KA 1HTBA 5IMBA 1KY5A 1JJFA 3OURA 5HKKD 2A0WA 2GHIA 2JBAA 2Q07A 2PZFA 3EVEA 4H6PA 3ZV5A 3QOYA 5LOVF 2DPXA 2FSFA 2UAGA 3GY0A 5J59A 3U7EB 1SWVA 4JLUA 3WHKA 1Q3HA 1C7EA 4B2PA 4H27A 4JGBA 4ARIA 1PAUA 3EGXB 4ZDIA 3ML1A 2AOTB 2CMDA 4X95A 2IXFA 1DTWB 3QEOA 4OK6A 3USZA 2ZJ2A 2GCOB 1IXSB 1E5DA 3QK7A 2A5YB 3S5JA 1UDRA 3NC4A 2FG5A 2HF9A 2BUBA 1T8YA 1P19A 2FP4A 1OA1A 2CDAA 3IAFA 4JBYA 4LVOA 1NBWB 4XKJA 1TTHA 3KSAC 3D4BA 4RK6A 4Q3OA 2QZZA 5KJEA 3TRIA 1U2PA 2GTIA 4BWVA 2CJWB 4D3FA 5LQJA 3FETA 2W2OA 2WPDA 1IXYA 1CDDA 3T3PB 5B64A 4IKPA 5JS7A 1RZRA 4QUDA 1KYXA 3G02A 4HGOA 1KEWA 3U40A 1A5SB 4BB6A 3AOEA 3DAPA 3GGOA 4XQCA 3WIEA 4K7JA 1ZH4A 4AJ4A 3TECE 4H17A 4QDKA 3QE3A 4AF7A 1FFSA 1WW2A 1IM5A 3IBSA 2ZLBA 1CW2B 4M1TA 4MK4A 4XCQA 3T9EA 4RS3A 3ZHXA 4UJ3A 3RS4A 2YDXA 2ZJBA 4FX5A 1LLFA 5LA6B 1KZYC 2C4NA 1D5CA 3PE3A 2HPZA 4LZAA 3MVEA 1PD0A 3W7AA 2VDMB 3BL8A 3MMSA 1NVBA 1WCIA 1ZUIA 1PTKA 2Q8QA 4UUBA 1CB0A 1P3Y1 2VG8A 4OM7A 1EUZA 2FSSA 3LQ1A 5LQAA 1KXZA 3Q10A 4GC5A 3NTLA 3AGQA 4N5DA 4PQEA 5FL7D 5G4LA 4UMFA 1KEEB 2PPVA 2AG6A 3EB9A 4GF5A 5AJZA 5JE8A 3HFSA 4YAEA 3UHJA 3WXBA 3ZOKA 4WX2B 4ENVA 2XE7A 3QU2A 2O2ZA 1O94A 4CRWB 3A06A 1ISIA 2Y1EA 3PZRA 5FQOA 1CJMA 5I9MA 5BYBA 2OZLB 3U4HA 2XBUA 1NVAA 4CKEA 1SUBA 1H4QA 5TQ2A 3D4LA 5JCZA 1DBSA 4JJFA 2GN2A 5JQGF 4D9IA 3IAEA 4Q4AA 1IMJA 3WADA 5DV9A 5EZYB 2IYPA 1XTBA 4UQPA 5F4ZA 2O2DA 3ABIA 2W6JD 3KR2A 7YASA 1L4EA 2IPLA 2X2OA 5AW8A 1AKEA 1F2TB 4B7CA 1YNSA 1OTHA 3OETA 5J4KA 4FILA 4OJKA 3KB1A 5BW5A 4U0KA 4AN4A 4DWOA 4BEWA 3I23A 2WYUA 4HEA6 3UAGA 3NH9A 3DBIA 4REQB 4X5OA 3TUZC 4B83A 1TKCA 1Y7PA 1M3SA 2NO1A 3R3HA 4NJMA 4D8UA 5A4FS 1DJNA 3OJCA 1FP4B 3TXXA 3EZ9A 3K8OE 2BKUA 5I45A 1ZCJA 3A4VA 5AHRA 4MW2A 3AC0A 1ESZA 1NBMD 2HEIA 3C8UA 5AW3A 2IEDA 2I6GA 2WTNA 1EUCA 1OYYA 2B82A 2OHHA 3KWMA 4M86A 3IE1A 1Q50A 3KTOA 4NKRA 3KR9A 3LBNA 1OZAA 4PPNA 1BWSA 4ME6A 2CB0A 1H94A 2KX7A 6Q21A 4A8HA 4RFSA 1R9JA 3SM9A 3TGPA 3R0QA 1NBHA 3OLXA 1OFIA 2XE8A 4RZ3A 5AK0A 1VZ2A 1VBNA 4O4IA 2GPWA 3I1FA 1TKBA 4D3XA 4DE5A 4HEHA 4GLOA 2ZJ6A 2I8LA 2R6CA 1PEKE 1C9YA 3EY9A 3JVIA 2HNKA 2RH5A 4PLWA 1CSEE 1EZZA 4J2OA 5LMCA 4JJ4A 4CTMA 3G6KA 5CYGA 3QHAA 4JJGA 4KK4A 5DZSA 1TEVA 4HWKA 3K1AB 1J0AA 4NATA 4R0NA 2P78A 1NXSA 2BDTA 2Z56A 3AWDA 3MIIA 3QVUA 1QH1A 3RAPR 1JMVA 3UIEA 2GPNA 3VSCA 2DQ4A 2ECQA 2MINB 4QLBA 4ZARA 2H1VA 2ZRLA 1EGQA 1IOZA 1PT8A 2WF5A 3WA7A 4F6RA 4KDEA 4AJLA 1DDIA 4YAUA 1VKHA 4F6LA 3T6KA 3I0NA 4R3NA 4LZPA 4YB8A 4E12A 5IJ0B 1V47A 3HYSA 3JQAD 2P8SA 2Q5JA 3ITNA 4CV3A 3K3PA 4MKGA 5AM3A 5JMOA 4DWJA 3N9IA 2QM7A 2LW7A 3PDHA 3BVPA 1R18A 4ZVTA 1I2MA 1R88A 4QBTA 1II9A 2HOQA 2JLBA 3W8DA 2D06A 3IKMB 3O74A 1MLDA 4LYFA 1S2LA 5FI3A 1QJ4A 4KLAA 4ALNA 5BQFA 4WLFA 3TM4A 4QGGA 3AIKA 3TVDA 3AF5A 1Z2DA 2R7LA 1GUDA 1PNQA 4C4XA 1HUQA 1ZK2A 4KWHA 4F3CA 1J2EA 1ZUHA 4DHWA 1F4PA 4HLUA 3HKDA 3DEIA 1TFRA 2Z58A 4TKZA 5CAEA 4RPCA 5J5AA 5JXWA 3F8SA 3O4JA 1XNGA 4GOMD 3SWWA 1RAFA 1AZLA 3LP8A 2C7OA 1Z6QA 3F7NA 3P9NA 1DG3A 4NULA 3NRJA 2WILA 3VZPA 4US2R 3KJZA 1SVWA 4DSZA 3Q1LA 1XTVA 4ZAYA 5AW7A 4IRXA 1HKHA 2EHJA 3LDUA 1HXHA 5B1HA 3LQYA 1P60A 1S89A 4G37A 2ZYGA 4ZYTA 4MAFA 3T5MA 5IN4A 4NS4A 4P33A 4GMGA 3RBZA 4EYKA 1SCAA 4M0EA 1J7KA 1V7PC 3DLCA 2G5CA 4M1SA 5J43A 3LY7A 1K7CA 2B4KA 3D7KA 4TLBA 5A5DA 4TLCA 1D09A 2QMEA 3B7GA 1E5TA 4NYIQ 3WJAA 4YEDA 5KI6A 1G8GA 1BWPA 2YFYA 3A05A 3A9UA 1KC1A 2FZLA 2X0NA 3P32A 3FFXA 4FKZA 4X92A 5EMHA 5JSZA 3FWYA 4R8KA 2P5UA 1RFGE 2OCYC 2WYOA 3F5SA 1X0VA 3HNRA 2Y1OA 4BFZA 4KR0A 2P9FA 1E2GA 2J07A 6PFKA 4XW2A 1H05A 4RMJA 4TMKA 1A9TA 3MTGA 4TSKA 3ZJYA 4DJFC 4IJ6A 3HRKA 3VZRA 1KMHA 5EP4A 2GPTA 3M6MD 4ZO7A 4LYEA 3U7GA 3BDAA 3OJXA 4GI3A 1D6MA 3E2IA 2RC6A 2O57A 1ORVA 1ADCA 4NBWA 5D5HA 2G0AA 5AKJA 4U9IS 3W1WA 3UH0A 5TMDA 3Q2IA 4LJSA 4OPMA 2EBHX 3O8NA 4FYWA 5E4TA 3WDLA 5CFPA 1DWUA 1FU7A 2FR8C 4IJWA 4HX5A 4MP8A 1F9AA 2ZIZA 4DJDC 1DLJA 4F8JA 2J5QA 4R68A 3EXFB 1G38A 3BC1A 2XQFA 4AJ2A 2A0YA 1H8ED 2WAOA 4DV6B 3RJ9A 4R2LA 5TLSA 4QBHA 3ZLBA 1IBCA 4GVPA 5LDHA 5T8KA 3NBXX 3HZZA 2KPOA 1U0SY 4PE5B 2K2WA 3N8HA 2XMRA 1TZJA 1DUSA 3QP9A 4EPYA 3OIGA 2Y4OA 6ADHA 1KTVA 3ONVA 1B00A 4BX3A 5C1BA 2WDPA 1TAUA 1K06A 2G70A 4BMXA 5BP7A 5ECDA 3ICEA 4QXAA 3JVEA 3CLUD 2JGAA 3OJOA 4LPKA 1T1IA 2QPAA 1RZVA 1PIWA 2JLRA 1H2BA 2H4HA 1R6TA 4L02A 2MTBA 4RVDA 2IV2X 3H2JA 4U7DA 4EHKA 3KVOA 2JA1A 5D1HA 4O3FA 1AMOA 4MI3A 3LS2A 4C21A 2EW8A 3AHDA 3QF4B 1W2WB 3ZW9A 1C1XA 3EW9A 3G5LA 1IDOA 1TC1A 2IKSA 4BWYA 2YKGA 1LW6E 3H97A 3NM4A 2WW8A 4FR0A 3LDGA 2ACVA 2C82A 3ORYA 3ZDFA 2XECA 4K9QA 4AT1A 1UEIA 2Z4SA 3E9DA 4IHJA 4Q3KA 4HWTA 3S2ZA 3PF8A 1PR9A 4P93A 4XVRA 5F73A 3BXXA 4JQOA 5MN6A 1EINA 4IJMA 3PLRA 4CEIA 4XSVA 5GZ6A 3ZY3A 5BN1A 3AOGA 1KMHB 4NDZA 3MA0A 1Y37A 3VDNB 4EFMA 4U7GA 3U3OA 4LY3A 1DIGA 3T7KA 3V3TA 4E03A 3S44A 5IJ9B 2JGLA 1NYTA 2IZ7A 1BVRA 4G0XA 2VTVA 4S24A 1L7BA 5DIFA 1OTXA 1R2QA 1T26A 2DETA 1RWVA 1ZUD1 1KU0A 3FXAA 1T5TA 1OX4A 2R1UA 2O8DA 2NXCA 3KQWA 4U7JA 4BB0A 4F86A 3PXCX 5A2GA 3TSZA 5C4IA 2W2QA 2Y3IA 1KOGA 1PJSA 2ZYWX 3DXZA 4JBXA 3MHPA 2GK6A 5JYBA 2PZMA 1JHPA 3SZRA 1WNFA 2C9DA 3EC2A 4JOBA 2HDHA 2JHPA 2IODA 2JW5A 1K9VF 3ETLA 4RUKA 3UJ9A 3VH3A 3RSCA 5JS8A 3URMA 3LRXA 4HYYA 4YASA 1XJWA 2PNFA 3RTGA 4V24A 3VA7A 2HNBA 1A96A 1SY7A 1CRWG 2QZPA 4QYWA 1HORA 4J3JA 3BEDA 3FLAA 1BD3A 1XDDA 4I5IA 3B89A 2OESA 2PUFA 5LP1A 1PEDA 2W6OA 4C4RA 2UYOA 3BE5A 5LYJF 4IEFB 4M8SA 5B2ZA 3H0KA 5IWAB 1A4IA 4PX3A 1G5RA 1U8ZA 3EYAA 3ZV7A 4UZEA 2ZWVA 3GP3A 2EW2A 5DM4A 1Y6JA 2H52A 3FOZA 4RVNA 1M67A 3PHBE 2DFTA 1VG9B 3GELA 4NPCA 3BWVA 3KE8A 3WS7A 3CN7A 4QRIA 1F4VA 2X8AA 2YIDA 2MSDB 1N7GA 4S1VA 2FEMA 3H5WA 4M6WA 5FADA 3V1UA 4CIAA 3CEMA 2QPLA 2DR2A 3EBLA 1G8HA 1O54A 3HY6A 3Q7TA 1DT5A 4B3IA 3TPCA 2O8FB 2WUGA 3CFYA 1F7UA 1NE2A 2XIJA 3HU2A 4Z4EA 3H3XA 1RWPA 4CM9A 5EEHA 3A6GA 2R00C 1UEXC 4NHOA 4A2PA 2ZRQA 4M0LA 2J7PA 1BJKA 2R6R1 3K1JA 1P5JA 1MU0A 4M87A 4E2FA 3L8CA 3CU5A 2YWHA 3ILYA 2Z8YA 4QPCA 5I3ZA 1RT9A 4PGAA 4V0NA 4I6GA 3A1DA 4OMFG 4EB3A 5BRNA 4N39A 3LECA 4BUCA 3IQGX 2I66A 4QJBA 3VU9A 1XAGA 1GTL1 5TEWA 3A32A 1BMFD 3NHWA 4WUTA 3KZXA 4HYEA 4MLCA 4GPTA 4XYBA 1RXCA 4URWR 1RLOA 2PYDA 5JY6A 3TGLA 2R751 3QV1A 2ZCVA 1NGSA 3W7BA 3B60A 1N0UA 1XEAA 3ABSB 3PNVA 2QMOA 3D6TB 2WABA 3EFOB 4DIKA 4IMJB 1PK7A 5I7FA 4LGYA 1L8LA 4Z9YA 4L1KA 4OJNA 1YZ3A 4J9UE 2RHTA 3AILA 5G0SA 4ROSA 4HTFA 1FDIA 1TJ5A 1THMA 4YP0A 4HEQA 4AWBA 4UJ5A 3LQ2A 1O77A 3BHMA 4GO1A 3QENA 4MWZA 3IEMA 1XCMA 3MRVA 3ISVA 2P9ZA 1G5HA 2ZEJA 4O4JA 4HVTA 1LK0A 4DV3B 5ESWA 1RBZA 4IAOA 1DJLA 1FBNA 3HKCA 2EKDA 4LYHA 5K3FA 4E5KA 3EARA 3H4IA 2REBA 2OY0A 3D3NA 1R0SA 1T5IA 4XYMA 5CTAA 4E32A 3H5LA 5JT1A 4PRYA 5LXTB 1W29A 4KO1S 1NONA 3LT0A 4IF6A 5TY0A 5EMJA 3SN6A 4BFVA 3Q98A 3IOCA 3SQNA 5EIAA 3R1IA 1O87A 1SG6A 1SC4A 2UDPA 2XWBF 1X80B 4YAGA 1AHIA 3ZGZA 1CE8A 1SNYA 1ORHA 2YS6A 4LMAA 1BX0A 4XXHA 2DSTA 4OBWA 1SXJE 1FVXA 2I1LA 3QOXA 4HMPA 4HRAA 4D9FA 2BJWA 5CM9C 1DCKA 3DOOA 1M2FA 4TV8F 2DUMA 2QTBA 4OJMX 2WF6A 1KNXA 2LNDA 4DAEA 1VI2A 4CKZA 2NT3A 1SXJC 2FPGB 2TYSB 3KQTA 1QRDA 4WLOA 5T4HA 4ENQA 4Q4DA 3MJSA 4OH1A 5EJ5A 1LCIA 2WWFA 2W11A 3F98A 1ULZA 4YACA 4DV0B 3PKJA 4Q4HB 2ZRHA 3B8EA 3DP9A 4UULA 3WVNA 1P9LA 3WTBA 2BGWA 4RLHA 2B98A 5IMSA 1CTQA 1FLVA 4P1ZA 1G8AA 3E27A 1QH8A 3HRIA 3NEJA 1KY3A 2W37A 3GFBA 1LUAA 1Y6GA 1ZW1A 3ZHTA 3KYIB 3K0FA 2Q1WA 4L8LA 5F5LA 3CO5A 1L7OA 2C00A 4I50F 2ET6A 3R4VA 4AZ3A 4AQYB 3VJKA 3P5BA 3UGTA 2CLCX 2CY0A 1UWVA 3CRVA 1PWYE 3R74A 3FCUB 3ZQUA 3RW9A 1T9HA 4A8PA 2EIXA 3CVOA 1F8YA 2KLHA 2IZ5A 2VH2A 5EKXA 5KTOA 1GTZA 2KWIA 3AHCA 1XO1A 4L73A 4M0MA 4XFJA 3SF8A 3UH1A 4E1VA 3IB3A 3HHPA 2C58A 1X1AA 2RBKA 1RZUA 3CPSA 3H5OA 4K9MA 5TJHA 5I4BA 4LAFA 4ITVA 4DLAA 5DTEA 1P9WA 1NN0A 2F9MA 5HIKA 1WDMA 2CXUA 2GB4A 3BTSA 3GQVA 2IEGA 3HR4A 3QU9A 4IZOA 4RMGA 3TTVA 2YXEA 2XMDA 3PHJA 4Q1EA 3L0CA 4PLTA 4TRRA 1ZBDA 1XZEA 4Z6KA 4K88A 3P0JA 2GA8A 4UFNA 2CBZA 2RONA 3G7SA 3QHQA 2RGBA 1RD4A 2VFAA 2DBZA 4QPNA 3W9SA 5JYEA 4O4IF 2CNOA 4POAA 2YXBA 3ZZ0A 5BSWA 2FP3A 1O89A 3C3WA 1GPLA 1TDJA 2DYKA 5DTRA 2ZWMA 1KFBB 2V3VA 3FTEA 3I2HA 2AMFA 2FSVA 4GG1A 4OSOA 1Q77A 1SXIA 1MV5A 1XRNA 4MPRA 3TX2A 1K2VN 4X1OA 3WYDA 1NR1A 4CQJA 2UUBB 2P77A 1G291 3R2JA 3AYXB 4MR9A 1UEJA 1C4XA 5LQDA 3UB3A 2PUJA 1Y8CA 3HZRA 4YHBA 1LD3A 5BN3A 4Q6WA 2RJ3A 3HEMA 1G42A 3MWGA 1N78A 1WXHA 1PW5A 5KPDA 4R71A 1X39A 3EDQA 5FUMA 2AJ8A 2XDQA 5KDOA 3BL6A 3GCZA 1W5AA 3JWEA 1HZZA 1IVYA 1FFWA 4MITA 5HM8A 1XSEA 2D5CA 1CIJA 3L0YA 1DJPA 3LUCA 4IDFA 4MW7A 4BP3A 3THYA 3SM3A 1KBZA 1RACA 2XY4A 2VVTA 3PSAA 4X8LA 3CEAA 3LT1A 5DTMA 4DQVA 5IUJC 4YJ2A 4D4LA 2ZYTX 1QGUB 1WO8A 4HEA1 3TRDA 3ZCPA 3K31A 2XB2A 1AO0A 3DBHA 5BWNA 2ZU6A 4Z7JA 1K5PA 4M1EA 3AB8A 3IP8A 3PC7A 3ZKWA 3NANA 2BHLA 4FIZA 2OWDA 3ZIAD 1F17A 3U7RA 2VEDA 1IVNA 1O5IA 2HJWA 1PU2A 5DNWA 2P5TB 4JLBA 2V59A 4BU1A 1WIWA 2EAUA 1NLFA 5IPFA 3UXMA 4CQLB 3EPKA 4BP8A 3ETHA 1U3VA 3CNQS 1R4NB 3B5JA 1G7TA 1CF4A 4AYTA 2QKYA 2PJUA 4N7RA 5H9WA 1WY7A 1CYEA 1Z7WA 4QBIA 1FX0A 5AHWA 3JCZA 3DT9A 5K0ZA 3J81k 1F7VA 3DVAB 1V7QA 4K26A 4M3NA 4QNRA 4LVNA 5JH7B 1OLSA 3DVQX 2JCSA 2OV3A 1MDBA 3DZJA 3K16A 2O1WA 5MFPA 1P6QA 4JC4A 3UGJA 2NVBA 4O2RA 1ONOA 1FDSA 2BCEA 3UANA 4ANFA 1KYVA 2WSLA 2YIMA 2GXUA 1AUXA 1NDQA 3EFOA 3FYCA 4KQ6A 4G01B 4RAOA 3UGQA 3VNAA 3CZMA 4CXMA 5I3CA 1QFSA 2X86A 1SURA 1QIIA 3KHTA 5ALWA 1YTLA 1ZSNA 4KUHA 5IWCA 4LDZA 4MQUA 2AZDA 4D9KA 1PQYA 1MF7A 1AM4D 2HDWA 2Y0CA 3K0BA 3IP9A 3KJIA 2PX0A 1PWEA 3V4SA 1H5NA 2EF0A 2C04A 3GH1A 1QVWA 1L5MA 3SR0A 3U5ZB 4XR9A 1TGVA 4OJQA 3UJ8A 1YJXA 1XPUA 1R4MB 3SZOA 1Y89A 3QUCA 5M34A 1B0ZA 4J43A 4L27A 3KLPX 1PR6A 1CUXA 1MTZA 2E6KA 4KDRA 2G17A 4MKRA 5FRDA 5LD2B 3VPHA 2HHLA 2A1TR 4EH1A 1NW4A 3VYSB 2DC1A 4AROA 4G0ZA 4K2AA 4P86A 4O2AB 3THYB 1U1FA 3EAGA 4MR8A 1C1HA 3R6LA 1SCIA 5CDTA 1HFJA 1SA0A 1H5QA 1W87A 2ZWIA 1WM1A 1Z2PX 2ONZA 1IUKA 3IDAA 4H35A 3S2EA 5FNZA 1UWCA 1KIAA 3NHFA 3CEJA 4EOGA 1S1CA 2A30A 3Q15C 4MQ5A 1OBFO 2AMJA 2EQ5A 3CTMA 1J2YA 2NZXA 3RABA 3JARB 3NUQA 421PA 2CJPA 2J48A 3LLSA 5DNYB 1BYIA 3ID6C 1Y48E 1P6XA 2VYQA 4QFCA 3DE5X 3R6GA 4KXMA 4KJZA 4Q1CA 4OB8A 5EIHA 2QX8A 1W49A 1P0QA 3KEFA 3VKUA 1VFPA 2HY7A 1XD2A 2FXIA 2H4YA 3VU0A 3II6X 4PAGA 1P1IA 3H65A 3AI7A 3QTTA 2XR1A 4ARSA 4AS2A 3THXA 2BGTA 3K2QA 3DOEA 2YXPX 3E3MA 3GJ6A 3DBRB 3HO6A 3SQOA 5DM60 2NXNA 4ZYZA 5THKA 1L7NA 1U8AA 1JN0A 4M0DA 4NCIA 4KNYA 2BKXA 4AUEA 1YGYA 4GBGA 1UKVY 4DUZB 1WZ2A 1MPTA 3GPBA 1BD4A 5EJAA 4X9XA 3U1BA 4RTNA 3PJRA 2V6MA 3RVRA 1GZVA 2LUOA 3S6JA 1C8LA 2V58A 4WEOA 4BJ6A 1U7UA 5BN4B 1AN9A 2G9QA 1XNHA 4OIMA 1XC7A 4UREA 1PWXA 4LRWA 1DB3A 3K0HA 1XHEA 2HUNA 5EMKA 2Q0QA 2WA1A 3BCUA 2NG1A 4TTIA 3H9BA 2PYZA 5DYNA 1OX4B 2Z2XA 3TNJA 3U39A 3K15A 4WBNF 2BELA 3FVVA 5HKKA 4KBYA 5AVZA 2B1QA 3N2GB 4AX4A 2O06A 4RK5A 1DBRA 3K0FB 4UTXA 1SCQA 3VH1A 5CH5A 3ZU4A 1OWNA 4D8XA 2ZG6A 3HB1A 4BV2A 3HI4A 4QYIB 5H59A 4PG8A 4GUAA 4B4DA 4JJ6A 5ENZA 1KK1A 1XWFA 1S5PA 4QXRA 1BMQA 2BFCA 1T3SA 2H2HA 2JFZA 1AN0A 3P5SA 4J16A 4C7OA 2EJWA 3OBIA 1A7AA 4UBMA 2ICAA 3G1UA 1KXJA 2RHCA 5D01A 5DSTA 4DLVA 4TKUA 3H17A 2Q5LA 1I2CA 1P62B 2PK3A 4Y1EA 2NU8A 3VJMA 2JG3A 3OUZA 4NU5A 5THXA 5IW8A 3UMSA 2XVZA 3VVCA 1LBSA 1DAEA 1GZUA 4MB2A 3WSVA 5FR2A 2XQKA 2F8SA 1CP3A 4DY6A 1B0PA 1M74A 1OXXK 1MOQA 4A5SA 4MZXA 3WLQA 3AHHA 3AR9A 4GFDA 1ODKA 1VE9A 2YV5A 3CUYA 2IUSA 4PZEA 4PRKA 3TW4A 1N2GA 3JZDA 5LQUA 1HGXA 3X43A 4U4AA 3HO8A 3IPCA 3SVLA 1EFPA 3G0BA 5C46F 4GSYA 4XUEA 3N0VA 4RULA 1JXAA 3TMKA 4Y2GA 2ALJA 2GEBA 4E13A 3DL4A 3RJTA 3OPMA 1FUKA 4RM3A 1B6GA 3S28A 4XJTA 4FFBB 2CBXA 2VK8A 3E2PA 1HX7A 5CM8B 4OGWA 3QU5A 5TPWA 4HNGA 1GOTA 3DA8A 4RXMA 4Q4LA 3FSRA 4RD4A 3NEYA 2BMJA 2QTWB 3ACCA 3UHAA 5GWXA 3ZCQA 5J3JA 1I5RA 2GZDA 3RRBA 1EBFA 1GG2A 3UMRA 5JI2E 3HI6A 3HYNA 1JBQA 2G1JA 1SVMA 3TUIC 1N5RA 2CD9A 4FD3A 3DUFA 2WWXA 5FA5A 4LF6B 3QWFA 1KJ8A 3BN3A 1I6MA 2C94A 4EG6A 4BTEA 3RIGA 1GPAA 2P75A 5B6JA 4IIJA 4ZQEA 4Q9NA 3GCWA 5EZSA 4LMRA 4H0CA 4U63A 3EVAA 1WMAA 4H0FA 4M8IA 1FQKA 3G2KA 2XT0A 3GFSA 3M5CA 1YOVB 4QO7A 2DLDA 3G8YA 5KVVA 3LLCA 5DH9A 2CHVA 2D5IA 1RTTA 2EDAA 3KQKA 5I7EA 2ZSKA 3QEMA 1UK9A 3I6ZA 5TQVA 5K9ZA 3GPDG 3RC9A 4MVJA 4KG7A 3X0DA 3ZQKA 2P9GA 1TQDA 4BKOA 4IXTA 2BIFA 4GRIA 1HWYA 2O8EA 1T3GA 3EH1A 4J4TA 4AO8A 1NF8A 1R0LA 3G2JA 5CK5A 4KWCA 3M70A 1KVQA 1VBKA 1C0KA 4TV9F 5DBIA 3WLJA 2ZR8A 4JYMA 2WU4A 3LPCA 5CB4F 3RYCB 1UWLA 2ORIA 4NZ9A 2HRDA 2KS6A 2TMDA 3U09A 4JLKA 5F7XA 1NI4B 2JFHA 1LRJA 3KWLA 4MWCA 3QBEA 2QB5A 4DM3A 3P2KA 2CGEA 2EKQA 4IR7A 4XGKA 1IOVA 1E20A 1F06A 4JJAA 3E58A 2WYIA 4IDDA 2IWHA 3AF2A 4MQ6A 2IFTA 3KKKA 5ERGB 2GF9A 3GNQA 1Z0IA 3IUBA 4FSDA 4H3SA 2O7RA 3DD1A 4WTOA 3FUUA 2HHJA 2C0QA 4XWAA 5BXQC 4IF4A 3VSBA 4ACAA 4JMLA 2FPWA 1YQTA 5LUAA 1XN1A 3V55A 3WWPA 3EGCA 3DPIA 2ZTUA 3K0KA 3DAHA 4QU8A 5ILQA 1YDWA 2VAMA 4NQZA 2OCBA 5ALKA 5L4LA 3AYZB 1K2WA 1E9SA 1U0JA 4GQIA 3BWMA 4MRAA 3UK0A 2YJ6A 4RJKA 2IITA 3HGQA 1S4QA 5REQA 1II0A 3MCAA 4DCJA 5JWRA 1YR1A 3M8KA 4CF5A 5IU6A 4G5SA 2QRPA 2LKDA 3RKUA 4ZI2A 4J7CA 4PYKA 4KQMA 1SXHA 1X70A 3KOXA 3P4UA 1Q12A 4IM7A 1RJGA 2DUJA 1KKMA 1IIRA 1LNZA 2PMCA 3Q40A 3COWA 4FFNA 4KXWA 4B75A 4CWAA 4JB2A 3G23A 3DQZA 1JVSA 3AUAA 4UEJA 3JYQA 4PCUA 1X74A 3AUFA 1FFHA 2YIJA 1DMRA 3NHAA 2YYSA 3NJ8A 5J2UF 3WYFA 1TUBA 4OXXA 2P91A 2XUZA 3ES9A 4JI5B 3R75A 3W3ZB 2HIAA 1JG7A 2HUPA 2SKEA 3MJ4A 2I03A 5HMLA 3T9DA 1OPXA 3UV7A 3RAEC 3O21A 3LRTA 1M2KA 2OO7A 1JKFA 3K9LA 5HCNA 1TEHA 2OP0A 5I8WA 3K94A 5FWYA 2IEIA 3R5KA 4NLLA 1UCFA 1IZ8A 1BYUA 1AB5A 2Q4BA 2DLNA 2HLPA 4RVFA 4TT3A 2C3MA 5GJWC 5TR9A 5ITVA 4K9LA 4WDQA 4F21A 2FW9A 4MIKA 3QU4A 2HI0A 2IPOA 3UT5A 4NG5A 3VR6A 2O23A 2AHRA 4RESA 1CY6A 1RSZA 2VYFA 4CMCA 1ZU5A 1PF7E 3EDCA 3L4KA 3BZBA 1CDOA 2ZS9A 2XB9A 3JQGA 1T9ZA 5DB4A 4PONA 1CEYA 4G81A 3EPRA 1RZ3A 1NVKA 3TX6A 1M33A 4O3MA 1IZ9A 3HSSA 3O3CA 5C4GB 2D2XA 2H7CA 5SYNA 3HKBB 1QHNA 3T7JA 3ZWBA 4MKXA 3NTXA 1LNQA 2H9YA 3SAJA 2XWQA 3GFVA 4KODA 1XZBA 2ZS7A 1JKJB 5BSGA 2HK9A 4X66B 2DFNA 2YJ3A 1HH4A 1GFIA 4OSPA 1XRPA 3KZCA 2VPTA 1VL1A 3EX7C 3NDJA 1R0KA 2RAFA 4BBJA 3E1KA 4URUR 3ITDA 1JF8A 3U1VA 5HFNA 2ATCA 2R8EA 3A70A 5MHTA 1KORA 3CY6A 3ESXA 4GW3A 4I4TB 1LBEA 3NPMA 4EABA 3SLKA 2GXAA 4W63A 4X20A 2ABWA 3NOXA 4X8HA 3FR7A 5E6SB 5ELXA 5K3OA 1KGSA 1F4LA 4ER5A 2AW5A 3LX5A 4D7AA 1TJYA 2C92A 2ZOSA 2OLJA 3FPSA 1XZDA 1YS9A 2YRXA 4B35A 3VC1A 4CBVA 2H00A 2DZDA 1NVVQ 3KOYA 2WHPA 4MI1A 1Y8AA 4PHHA 3W2TA 2GJKA 2VRCD 4Z9AA 1B73A 4KIFA 5LYYA 1SO8A 4R16A 3U9SA 4BEBA 1AKRA 3DMFA 3OIYA 5REQB 1C2YA 4GVLA 3S40A 3T8YA 3F6SA 2XCLA 3GLIB 1NW8A 4ETNA 3RYHA 2ZBRA 3EEIA 1A1SA 4HB0A 2CC2A 4U2KA 4UXJA 3GJXC 5F5NA 5JWHA 2QT9A 3LHDA 5CT8A 2VF4X 1QR6A 2PDAA 3HXQA 4Q39A 2F48A 1KAMA 3CW9A 1YDHA 3BMOB 3A25A 2HCJB 1W1UA 4TV8A 4TUYA 4Q3CA 1NJ2A 1YKFA 2HRQA 3L46A 1BFKA 5U9CA 2ARKA 4BFLA 1I8TA 2Y0PA 1KYZA 1LBQA 4DLYA 1UZAA 2QLJA 2FG6C 3H5TA 2FMKA 2W6PA 4K86A 4EHHA 5LWHA 1G3IA 3CUUA 1KZ9A 3GDOA 3ICOA 3QW2A 3UXHA 2PMKA 1G4AE 3B2QA 3L02A 5K7SA 1RZRD 1JQKA 3T3NA 2L18A 4IH4A 5EJGA 3QLVA 4WCFC 5M7EA 3LT5A 3D3WA 1X1CA 4L72A 2JARA 4AKEA 2BONA 2MYTA 2XAAA 2O2HA 3VXKA 3HBFA 5JISA 4RD1A 4GS5A 5IP5A 3UPTA 3BXPA 2YY6A 4OHOA 5HQJA 3R76A 2BEJA 4CDMA 4D9EA 4D0LB 5K4GA 1GRQA 3BULA 3O0TA 1QPBA 3KYCB 2YQ4A 4XWKA 1MABA 4M4SA 2DY0A 3OIFA 4LOLA 5BNIA 5JCOC 3RTCA 1RMQA 3BJEA 5H70A 1XDWA 2FZKA 1I3LA 3DQQA 2PL9A 3SC3A 4DNXA 2EFCB 4CM6A 4Z2AA 1HE5A 1A69A 2OYSA 3NBQA 3DYBA 3NI2A 4GWKA 4JI4B 4LHVA 4OHFA 4XJSA 3S3TA 3N0WA 1K98A 3LY5A 5HJ2A 4DMGA 4HT3B 2AN5A 2BR4A 2HKIA 3OQBA 4J94A 1JHOA 4FGKA 4OQEA 4YUVA 3CJQA 2Q9UA 2VJKA 3IQEA 1RM5A 2N1BA 2A88A 5L7WA 1NQVA 721PA 2LRHA 2JIOA 3VISA 3BH6A 4NONA 2O2CA 4QQFA 3AL0C 4N48A 1T4CB 1M2OB 3KKNA 3NDPA 4MPJA 1IHYA 3G2IA 2VP5A 2Z9CA 3HU5A 4Y7DA 4LJRA 2AOXA 3EZNA 1GILA 3P9QA 5BV0A 5JSQA 3D7RA 1FFAA 3KT8A 2HTEA 1EK0A 2VYVA 3CX7A 4EW2A 4LSZA 4C0WA 4J0EA 5FUYA 1ZHFA 1JB9A 1UJMA 1RQRA 1KAGA 1Z4PX 4P0TA 1DIAA 3ZU6A 1JKXA 2VAPA 2WAMA 4CEIB 2C8KA 3T0FA 2Z5GA 1L7MA 3AEYA 1Q0LA 2CF5A 4PSUA 3SEZA 4NE7A 3GLGE 3JR7A 3A1FA 1UZLA 3G6WA 4D5GA 1JXMA 1U02A 1QRSA 5F3RA 2HNAA 3SQLA 3BMQA 3DLIA 3VR5H 3UJNA 5CEFA 3BRQA 3OOHA 4HZIA 4RJJA 4Y6OA 1KWKA 2ZQYA 1WSAA 1G2OA 1R12A 4JX8A 2PGLA 3KKMA 2RK6A 2WYWA 1OBOA 3FGPA 3PQFA 4QRDA 2PBRA 3QXHA 1O5TA 4J3FA 5KSYA 5MF6A 3QE2A 3UOGA 1AV7A 1JHAA 2PVCA 2WG2A 4GLLA 3G13A 2FYTA 2Z08A 1WUYA 2VWHA 3DR3A 3DUWA 2J32A 3OMLA 5DWVA 5DYGA 3D2CA 4ZTBA 1ZICA 2EWWA 2R8RA 3O9ZA 4S0ZA 3GFPA 5E7QA 1D1PA 4FZJA 3HADA 4IIUA 3LBYA 5K2OA 3LPLA 1RC8A 1UDWA 2C97A 4KQ9A 4W7SA 4MV3A 1E59A 2W2PA 4LSWA 1RIFA 2BHSA 4B4UA 1MQSA 4JC5A 3V4ZA 2WM9B 5C80A 4XEHA 4H1HA 4HMOA 3ZWOA 1UXGA 1DXHA 2ONCA 3N5KA 3WHPA 2WC1A 2JRLA 3DAYA 4DDTA 5JAUA 1YGPA 3ND6A 5CJPA 4D56A 4B5KA 4C04A 4O1IA 1VG1A 4LXGA 1AK2A 4DZRA 4TWRA 1JIKA 3UW3A 1A97A 2FPUA 5GPBA 1SUAA 4PX5A 1EP2B 4JI6B 2BH9A 5A4JA 4A82A 3ANNA 3H7IA 4C5AA 5JAZA 5GJVC 1X7WB 4JJ7A 3QWIA 4D6YA 5BV8A 2TS1A 1O58A 2EKLA 2CXTA 5M29A 1B6TA 4C5BA 2WFLA 5DXFA 1YVEI 1N8NA 1IWOA 3U61B 1F2TA 2L69A 3W2GA 4PNEA 3C4VA 3P0FA 2HHHB 2YY5A 3IPAA 1GJRA 5M04A 1RC0A 3L1UA 2VXOA 4DA6A 4Q4CA 2XF8A 4K40A 3T41A 1S8AA 3HJCA 3K30A 4KH0A 3CT6A 3QMVA 4W1QA 1Y6RA 2CXPA 1KSHA 1R0YA 4RV5A 3FOEC 2FQWA 3DR5A 3LOQA 5CLLA 1EUYA 4C89A 3PQDA 2R1TA 1LA2A 1K8RA 3IPXA 1EWRA 2RGGA 1Y6FA 1DZIA 3BE8A 3CF2A 3TLEA 1FY2A 5DSXA 2G7ZA 4BZQA 4BCDA 5K3CA 4DG8A 5KZMB 1TVKB 4IDQA 3RV3A 2AR7A 1LV7A 2C8JA 2ID4A 3UY4A 3CJRA 4YFYA 4LQLA 4E5MA 4FJ2A 2RHDA 1N3LA 2O1EA 2P9CA 4O4LF 1UBUS 3HN2A 2QJWA 3ZS8A 3A31A 1TO1E 2E89A 4MW0A 5EMLA 1X8JA 3X1JA 3BZUA 4DQUA 1Q1GA 3K6JA 3GLGB 1KDOA 3D0OA 3PNQA 1ZOIA 4P9NA 4Y2JA 2PSDA 3H4VA 2EZ4A 3PGLA 5AVOA 1BDBA 5IM4A 2C5LA 3DEFA 4GKBA 4S1OA 3IUQA 4TTQA 3LXMA 1A5BB 1B0AA 2HWWA 4WKPA 4XA8A 5KB3A 3EGIA 2IYUA 1T9KA 1VA5A 2ZJAA 1XZLA 4FBLA 3TBFA 4KN6A 1LK5A 1RKXA 1XJCA 1KE2A 4LRUA 3OSUA 1B26A 3M6AA 2PJZA 4S35A 5LPNA 1JQ3A 5IZCC 4KHPB 1Z25A 2TSYB 1PS8A 4EF5A 3HG7A 5F1KA 3GMIA 4TTJA 3U4MA 1NRJB 1O94D 1S7CA 3E7DA 4YV7A 3U16A 1XNRB 5AKLA 2FFQA 5C8YB 2QZ4A 3PNOA 5AK6A 1E3DA 2B1JA 4ZCIA 3HP4A 4PV7A 4C5CA 1P80A 2BM8A 5FOVA 1ZUNA 2AI1A 4HX2A 2FXVA 4D96A 4FOPA 3AUTA 1TW3A 2QN9A 4M22A 5LWQA 1ZA1A 4WZAE 3BSSA 3F78A 5BPFA 1YVPA 4E3WA 3LUGA 4RVHA 3TD2A 4G4SP 3A3OA 1A7KA 1E9RA 2O0KA 1NXXA 1SN7A 3SR3A 3OZXA 4I5EA 4UEOA 3SFTA 1PFWA 1EVKA 1JP7A 1OXBB 2A5LA 5ARBA 3OTOB 2PQMA 4FFMA 2QYSA 3U2QA 2HQOA 1E8MA 1BX3A 2W2XA 4JJEA 2A92A 3E03A 2EJTA 1JDTA 3MLBA 3WA6A 4N03A 2BR3A 2DOKA 3E0XA 3NBAA 4CV2A 5LYJB 3FN4A 2IT1A 2F90A 2WHXA 2BOVA 5A7GA 4RPJA 1JQ5A 2ORED 4FXPA 1I7PA 5FLKA 4YXWD 1JEDA 3CZRA 4N76A 3QKIA 4I4CA 1MGPA 2PZ8A 2R7MA 3AB3A 4N5IX 2O19A 2J41A 2WU3A 1EDEA 4NX2A 4LF7B 1IBMB 2PHZA 2IY7A 1EXMA 1X1TA 1UIRA 1ULSA 4M1ZA 4E0BA 3FCYA 2ZDGA 2BFEB 3IUJA 4WLEA 5CHEA 3R3ZA 1SXPA 2CE2X 2Y0BA 1VHLA 3NDRA 5BMVB 4HUJA 3F97A 3TWOA 4BKQA 5I8PA 1EK6A 3JQRA 4Y9SA 1ZK4A 1KC3A 1KP3A 3EG5A 4MVYA 4NPAA 1Z0SA 3VO8A 2GLTA 1ZD9A 3VZDA 2DUWA 1ZAKA 3G5TA 3TOXA 1GTRA 3GLUA 4JZKA 5HF9A 1YQQA 1KY4A 3M1LA 3C5VA 1BVUA 4FHZA 3BT7A 4UNIA 4PPQA 1EB8A 1IY2A 1VKJA 2JZCA 1A95A 3K35A 4MS1B 3QXGA 4N82A 5MFZA 1FXUA 3RSSA 4B3DA 4UMEA 5BVGA 5C2JB 1DV2A 1TM3E 1LEHA 1R15A 4WZZA 3AY6A 2XGJA 3H5AA 4BWFB 4ZANA 3RE1A 1CBUA 3LUHA 2B83A 4BECA 1GPMA 1TM5E 1DWQA 2PSEA 4YJ3A 4DW8A 2LCIA 1ID1A 3KT3A 3IDFA 1G1MA 3PI7A 3B6MA 4Q7LA 2FPPB 1KZ4A 4BB9A 2G07A 1SC1A 3AHIA 3QFFA 4RKRA 5A04A 1JFRA 2RHMA 3PC6A 4HUQB 3D8BA 4H3VA 4YBRA 1RYMA 3P71T 4NK5A 1PGQA 4QT4A 5C7OO 1XNQB 1Z29A 3X1DA 4EFNA 1ZAYA 3SGLA 3PRHA 5A02A 1W94A 2QL5A 1ESCA 4YUAA 5JS2A 2IS2A 1GGFA 1RYFA 3ASZA 5TRTA 4YUWA 4UCXA 5IKPA 1A50B 4BRSA 1DDGA 1L8AA 4MPTA 5TT1A 2FWIA 1O94C 1ADJA 4MHOA 4Y2SA 2TRSB 4L3VA 4V0OA 3WRWA 4Q4HA 4Q9DA 3HGTA 4FCTA 1XRSB 4R5HA 1NVVR 3HA3A 1WETA 4EG8A 2VYNA 1NC3A 3GU3A 1KNQA 3UYLA 3V97A 3KTFA 3HVRA 5CW1A 4LFBB 1EESA 1M83A 1UBJS 1WY5A 3INTA 3KSDO 1YCFA 4MLPA 3G82C 3P2EA 3T4EA 3GB9A 3KDAA 3RWBA 4R2XA 1RJ9B 2PJRA 3OWOA 3UATA 1JJIA 3LF1A 2M2IA 3VMMA 3QUSA 4ZPXA 4RIGA 3WV4A 4OBBA 5JNTA 1M1ZA 2FHPA 5HS6A 3LT2A 1U6KA 2OZKA 3WZMA 1MA3A 2MT9A 1FSZA 2B34A 4OOFA 3BKXA 3F90A 4EY8A 3BIXA 4B4VA 3DDUA 2ADFA 3BOSA 2CDRA 2WRZA 3I45A 1T5SA 1UF9A 5CJ2A 3AIIA 1E58A 3MOIA 1F3OA 1CUVA 2ZAOA 2H4XA 2QQ5A 5E6RB 5LXTA 3H99A 3IGFA 1NT4A 1E0JA 4B6SA 2NADA 4YUYA 2D5AA 1ZCAA 3DCYA 4TRMA 4C2BA 2CXXA 2Q2OA 1X3SA 1W6UA 3EGDA 3GEDA 5K0BA 2G63A 3DO8A 4X60A 3NV9A 4OU5A 1ICIA 2Z3WA 1FOEB 1TOAA 1TZBA 4QXMA 3TLCA 2JCGA 3BWDD 1YS6A 2JFBA 4CLHA 1Q57A 5DIZA 1CQIB 1NUHA 2A9FA 1YULA 4U7WA 3NHUA 2OV2A 4FMDF 1HDIA 4PLHA 3TGWA 3WGMA 1M1YB 2OO5C 3WAKA 3VPFA 3BBLA 5I7SA 4HS4A 5H8WA 4CIVA 3MTQA 2A78A 1E2HA 1SCUB 2HW8A 3DDOA 1RXUA 3ENNA 4UVHA 1QPZA 1YI0A 4MLZA 4JI0B 3DLAA 1BS9A 4R2JA 3CN9A 4DZZA 4CJXA 4Z3KA 4NQRA 5A1JA 3Q8KA 1IZ0A 3RVJA 2PMWB 4LNUB 2O59A 4E1BA 5JJKA 4F3TA 2E18A 1K6EA 1WE2A 3VSAA 4KE9A 1QNLA 3G59A 1EK1A 2HMVA 4N0EA 1D2HA 2DKNA 1I36A 1DWOA 1FQOA 1S2MA 2D4HA 2JVJA 1L8QA 3IVXA 2ACEA 1Y4ZA 5FPYA 3UCXA 5LIRA 2CNLA 4JV5B 2X7HA 4PG6A 3UWOA 1C3OA 1RQGA 4ZQGA 1HE4A 1XP5A 3PS9A 1VHQA 3AJDA 4B09A 3IB6A 3PVSA 1WZEA 1ZCFA 3IP3A 4RPGA 4Y98A 3U1TA 1HRDA 4UCQA 3R9XB 1WMSA 4DSAA 2HWXA 3CG4A 1G20E 4BNTA 1RAIA 2WT9A 2Q8NA 1U2QA 1KL7A 3NTRA 4YMHA 3V8EA 1QZXA 1GG9A 4EJ6A 1F38A 2HADA 2IYRA 4AQ7A 4BZXA 4ZQHA 1V5EA 4YMGA 1U3WA 4YRFA 3TW0A 1I1OA 1M8KA 3VR6H 4F5WA 1RKUA 4WERA 1ZN7A 5IK2A 2IHJA 4RK4A 1N2CA 2SKDA 4DB4A 2V7XA 3JPYA 3PUHA 1M1UA 3KQYA 2GFIA 3U3MA 3PQ4A 1BRMA 1DUVG 1AKTA 4CKCA 3VO2A 5CXSA 3S27A 4IHAA 1X38A 2IYZA 5IHPA 4KI0A 4UM9B 4CCYB 1J0CA 4WASA 1JHRA 1WUJS 4KYUA 1FP1D 1OFGA 4ENSA 2ZCUA 4RTMA 3P9CA 5J2TF 3MT0A 2PZKA 2KMLA 3PD7A 4L0CA 4L74A 3FCSB 4A8JB 4JLPA 1MJNA 1XRLA 7ABPA 1P2SA 1H8EA 4M89A 3T3IA 4C87A 5IYZB 5KWJA 3DO5A 4X62B 4D9GA 4IX1A 4DCPA 3JQCA 3P4YA 2QXUA 3GI1A 1ZGHA 1YR8A 2HXYA 2J3HA 3BXOA 3K9CA 2DPHA 3OCJA 4X24A 2DH6A 3LX6A 3T5DA 2X42A 5CLGA 4NOKA 3QFRA 3MMPA 3TZLA 1Z2EA 4JVNA 5F23A 2AOUB 4UTRA 2WD8A 3ANSA 5C8XA 2EP5A 1YIOA 2OQRA 1LRKA 1N4DA 3WK4A 4PHCA 5IJ9A 1OSNA 1P2BA 2NO7A 1CUAA 1LSSA 1O4VA 2BP7B 2GD6A 3EZ6A 1ST2A 3PJGA 3PU6A 5G1OA 3NETA 2BEVB 3H75A 4B44A 2CDNA 2OV8A 4IHJB 4EY7A 5LLTA 4BJHB 3WMXA 3ROMA 5AJUA 4MYUA 4EY4A 4UM9D 5C31A 3R0XA 2BFNA 4O1HA 4WESA 3VPSA 5GZ3A 2FR8A 3ADDA 1ZMOA 4F0JA 2DPMA 2H17A 3E4CA 2VHTA 3EMVA 4H59A 4TMYA 3I73A 4P6VF 1XMQB 3COJA 4AKTA 2H3HA 1R27A 4OL9A 3ZHCA 4XUDA 2DP4E 4UHDA 3C3AA 4I6EA 3F1LA 1WHTB 4WWHA 4NZZA 4EVSA 1H4TA 3OEHD 1GUBA 1CVRA 4L75A 3FGZA 1WF6A 2QUBA 1KMMA 4B8YA 3RROA 3EIXA 5KTKA 1Z6AA 2ZSJA 3VKWA 5M2QA 3OUTA 5EUCA 3SE0A 4FJ1A 1R0CA 2V7QA 4OG2A 2VJAA 1GCIA 2C2OA 2VUSA 3U3JA 1VLVA 3BIFA 1JILA 4B6OA 4JZYA 5JO9A 3OPXA 5HRUA 2QTVA 3L9XA 1JEYB 1T9DA 3MC1A 3UMBA 4BU0A 2R47A 4I3GA 1VSQA 2DHDA 1XJ0A 2D0IA 5F64A 1JLRA 3NG1A 2ZREA 2PH7A 2ZTSA 2QE6A 2RIRA 4NWIA 4PBSA 4TN5A 2V5UA 1HOTA 3LYHA 3E1SA 2VF7A 3PNSA 4MQ4A 4QELA 1DC3A 4YN3A 1UPUA 4D5EA 4NVRA 3CIFA 1D03A 3URKA 1U8FO 1M2VA 4RK1A 5J1SB 2V98A 4WOKA 4UNNA 3KQVA 3WJ2A 2DPGA 4BNDA 4N12A 4MWBA 2YWFA 2OUIA 2QN7A 3DC7A 3ESBA 2ZE7A 2DB3A 2JFWA 1VHTA 1IBKB 2XYPA 3MWLA 2I4TA 4MR7B 2IZ0A 5AXBA 4C7VA 3Q0TA 1M34E 2D1FA 4KKXB 4W6ZA 5JI3E 1B15A 2CL6X 3A3YA 3FX2A 4BX8A 1FNMA 3GWZA 4FT2A 2ZJZA 1XELA 2OSVA 5CVVA 1SUCA 3RHFA 3Q72A 2VCEA 1WZIA 4JB0A 2DY1A 3CRZA 3QG5A 1OGYA 1TTQB 1Z5VA 3V7FA 3FPKA 3QZUA 4BMSA 3UA4A 1PL6A 2ZQZA 2WVAA 3CINA 4PINA 2VN8A 3MS7A 1OB2A 3L07A 2VDUE 2XNCA 5KJCA 3PXDA 2E4AA 1HY3A 1NBIA 1WA5A 4LCBA 3MIZA 3QELA 1OA0A 3JY6A 1QKJA 3K8QA 1K8YB 3GJ7A 3IR5A 4WGGA 4L5BA 4Z8XA 3PX7A 3ADCA 3I05A 2YFHA 2FEKA 2Y99A 3OZFA 1TD9A 3WGGA 4D3DA 3GNTA 1BFDA 2EFJA 2BTQB 3GLHE 5AVVA 1K6JA 1U6JA 2R85A 4FK8A 1QF6A 4RELA 5GVRA 1A2QA 2WDZA 3O4GA 4JFRA 1NT2A 1UT5A 5JJCA 1K6IA 2VHWA 3T5TA 2PZJA 8ATCA 4OXQA 4XIFA 3AVXA 4IHJF 2J5RA 3AFNA 4JYCA 3ZHOA 4NYMQ 4TX1A 4JLAA 4EGFA 5JZSA 1U3CA 2AH5A 3ZYZA 3T5AA 1SOWA 3W34A 3FYHA 4FNGA 4ZICA 3VH4A 4OP3A 1C3XA 1LF5A 2GPSA 1RMYA 1X15A 1ZL2A 1Y82A 3DDNA 3NWJA 4RK0A 4EAAA 3M83A 2Q1UA 3GD7A 3C6YA 3R6DA 4OATA 3C6ZA 5LIPA 3NVAA 2HU2A 5IVHA 1IL0A 2OYRA 3ENWA 2WYVA 1Y4SA 3LLMA 1CETA 1EVYA 2K6GA 3LZ6A 4H77A 5AKGA 3H8VA 4IIGA 4ZU6X 4P98A 1G41A 1UODA 2NYUA 4UZSA 2P3LA 4ZU3A 2Q7DA 1YONA 2NSLA 1NI3A 2WIKA 4XWGA 3WE7A 3BRWA 2Q4DA 3C74A 1E6EA 3LVQE 2J6IA 2PU5A 3WSTA 4CETA 2C78A 2UZ4A 2R00A 1IB6A 5HBRA 5JDIC 1FMTA 3LLVA 2QX7A 4ZOQI 4W1PA 3FYSA 3AHGA 3NIWA 4D4JA 3H05A 3LNCA 4F6RB 5EYPB 3RK4A 4B48A 3V1KA 2P27A 2VK4A 4D9HA 1L7RA 5KHOC 8ABPA 2Q3MA 2WD7A 5ERXA 3GLQA 3N53A 4JASB 1PV2A 4M8NE 3SIXA 1D2CA 4J90A 5JLAA 1J4AA 1OF1A 2Z04A 4U7FA 1NNEA 1WBJB 3B1ZA 3ZLTA 1OLOA 5HKOA 3IAS1 2B8WA 2ZUTA 5B7NA 4BUJA 3T5GA 1G8MA 1PBTA 3FGOA 4BEVA 1XZHA 4DA7A 3C6BA 1V1RA 4U2CA 3O1LA 5CR9A 3M7IA 2GLXA 4EGSA 1P0PA 4W8OA 2PRIA 1BHQ1 5I5GA 3MK31 1AOXA 1UADA 5JIBA 3U7HB 3R7WA 2QBYA 3LCRA 2O3JA 4KQGA 4V3CA 3VJLA 4PFSA 2QD3A 5PNTA 2IELA 5KTPA 1BA3A 3TFWA 4ROTA 4RCYA 3DMNA 3RGWS 3F6CA 5LZ2A 3EFHA 4PC7A 1AQ6A 3CE9A 4GXTA 4L5JA 3SXUA 3NOVA 2WWHA 1NU6A 4EB6A 4N3NA 4EIWA 3JWJA 4EYEA 2ZB4A 4WKNA 5CT6A 1SWWA 3STVA 4DDHA 1Z26A 1ZJWA 1CR4A 2GPBA 1BHJA 3N8NA 1QO0D 1NQAO 1NVUQ 1CNFA 4K6KA 4OHCA 1Q14A 1G3MA 4WXYB 5KTSA 1K08A 1YA8A 4L8WB 1QC5A 4JI1B 4DCSA 4TZ6A 4AJOA 4EBFA 4GOOD 1FZTA 2BMFA 1KU6A 3OA0A 1VP3A 3DGFC 3LWNA 3DMPA 3IP5A 3IULA 4MVWA 4OQXA 4X3OA 2GAFA 2PRSA 2W6IA 4WT7A 3WMGA 3PIRA 4GWLA 1NG1A 1A98A 3NIDB 1FDUA 5B53A 4HSEA 5CPFA 3V6MA 1K7EB 1RR6A 1M8PA 2IDJA 4PZYA 1PYOA 3TIGA 1K89A 1OE0A 1WWKA 3BEOA 4ZRDA 4Z4HA 5AI0A 4WLUA 1HQYE 2CNWA 3JAKB 3GDWA 1WP9A 4MQFA 3RVQA 4C0XA 1VCOA 2M6RA 2R8BA 4B6RA 4NFSA 4F3RA 4RQAA 5ADVA 4H0NA 1M0EA 1SQ6A 1S8NA 4YGYA 2XB6A 4WEQA 1UJ6A 3AI1A 2OOSA 2Y71A 4LSMA 2CFTA 2ZKIA 5CYOA 1SXJA 5AVTA 3K72B 1UOOA 3IIKA 1AUPA 1J1IA 1NUQA 4J91A 4NU0A 1I7NA 1WUTA 2XWJI 1OLUA 3GJ8A 4IUBS 1BS2A 5DOVA 1CUBA 1R8YA 2IXDA 5TQ2B 4E46A 1A8QA 2PY6A 4JY7A 4PAOA 3GUYA 5CNIA 5DWQA 2RKBA 5FV4A 4MTCA 3ZCVA 4MX8A 2FJPA 5ESXA 3N05A 3IQIX 1GR0A 4RKYA 2RI0A 4Q24A 5DHAA 3O8RA 5TPZD 3MB8A 4IW3B 4U2FA 3PA8A 4OOEA 3CLRD 3FUCA 4OX9Y 4IH9A 2P0EA 4RIIA 1KKLA 4P4LA 2QYHA 3N59A 3OM1A 4UUMA 4WBNA 2GCPA 3WIVA 1UBEA 2DKFA 3O92A 3JAWB 3RFFA 4ZZ3A 4BLPA 3FNQA 1ECJA 2ZWAA 4S05A 1O6CA 4FHEA 2EG9A 3BMXA 3VZBA 3AFMA 5FR1A 3SZLA 1P7WA 1AE1A 4KOAA 2XH8A 2E4XA 1LZLA 4ZPJA 1I0LA 1VJTA 1V9CA 5CDUA 3KXDA 1U5CA 1ECFA 4XFKA 4HUTA 3ESZA 1MX3A 1ABEA 1ORIA 2R79A 4X44A 2PZGA 5DM2A 2Q2WA 4KFCA 5HYVA 2PH3A 3K73O 1KAEA 4GYWA 2QW8A 4WY8A 5A0TA 3NOQA 2ZANA 2X1HA 4RS4A 2DTEA 3B13B 4FMBB 4EHIA 1I3KA 3IIEA 2H06A 1K63A 3WB9A 5IXYA 5LMUB 3F3YA 3A9RA 4QBKA 1GPBA 2VK1A 1HDXA 3ESYA 6GPBA 3OD1A 3FSEA 1H85A 5JS1A 2ZDHA 2CDCA 3EEBA 2CZGA 4MCJA 4V2IA 1J22A 1DBQA 2Z5VA 3N87A 2D7CA 3UJDA 3H1EA 3H4TA 2RHOA 2WM2A 5BSRA 3FDZB 1SK9A 1N8TA 1WBDA 3LIIA 3PFGA 1FXWA 2FSVC 2L19A 3HO1A 2YJTD 2Q6IA 2GGSA 4UPDA 1MX9A 4DA0A 1U11A 5LOVA 1FRQA 4BVFA 1MT3A 3B1FA 1G9SA 4K05A 1HFKA 3D2LA 4MP3A 3NC1C 2C4KA 1U6IA 3G7NA 2B5WA 2HF2A 2JH3A 4IDNA 4JUIA 4FD2A 4CG0A 2I6TA 5LR6A 4V1CB 2VXCA 4U5XA 1NVTA 2X19A 4ALKA 3PC4A 3KQUA 2ODAA 3I30X 4QNNA 5BT9A 3CNHA 3KSUA 1C41A 1NMEA 1HZZC 2R6FA 3IJEB 2MR5A 3GFRA 2DH5A 3I1YA 4MCIA 2JASA 1YTUA 3OQHA 1VSBA 2Q4RA 1UJ5A 3E9NA 1U90A 3QXCA 4KQ1A 4U3JB 4HH3C 2Q2NA 3GRUA 2OXIA 1QANA 1ZGGA 2QG9A 1EFCA 3MB5A 3NAGA 3WNQA 2YICA 1LPMA 1WEKA 3WWYA 3Q2KA 4B3MB 3Q3CA 2QM8A 4D6XA 5J47A 5KX5A 2OXTA 1CQJA 1F0PA 4YA6A 4ZZ0A 2L42A 3DBVO 1W52X 4Z1MA 1DKNA 3D6UA 3FVQA 1ZRMA 3N2EA 4QREA 4LYGA 3OLYA 4BVEA 4E30A 5C5IA 2IZ6A 3QF7A 3PEWA 2DUUA 2F9FA 1P91A 3KUUA 4HAWA 3TLMA 3ZDCA 3R3YA 2O2GA 3LK6A 3FTFA 1E1RA 1EQ2A 1AKVA 3ONEA 2Z1MA 1O95D 2OD9A 4MH0R 1WPRA 4CUJA 5LMZA 5HWSA 3NORA 2VYVD 3OFJA 1RMTA 4JSTA 1HE8B 1XKXA 1J2UA 2X2EA 1D7OA 3FE2A 1REQA 1K1EA 4ND8B 4BFTA 2ZSDA 4F2PA 1CUUA 5BYAA 4B3GA 2BI7A 2CWDA 3GLSA 4OXNA 4DGQA 1DGQA 1ZRSA 1Z0UA 3T54A 3I3SR 2HIMA 1G8KA 2UUPA 3QW4B 3DEZA 2F67A 4GECA 4C30A 1KR2A 5DGCA 4C7MA 2WU8A 3OP1A 1W9HA 2GZAA 3IYLW 5C8VA 3NKFA 1JDNA 4RA6A 4A26A 4ALMA 3A7EA 1WVMA 3LUAA 4LOKA 1R8SA 2FW7A 2X6RA 3IUSA 5KCZA 2UUOA 1NG9A 3ZZTA 1W1WA 2V6GA 3IE2A 1KR5A 1JBKA 2YBEA 1XI2A 4PAWA 2HA2A 4AG5A 1MW8X 4DSTA 3C1UA 3G79A 3LYLA 1Q21A 4IQ0A 1ETUA 5FCDA 2GJSA 3FPBA 1P3JA 4QGFA 1V96A 4LK3A 3CMCO 4CM8B 2WOJA 1YQ9A 1QU2A 2GJAA 3PLAE 3H5VA 2CFRA 1Z37A 3ANXA 1LI7A 3DOFA 4BN0A 2X8BA 1QQBA 3SEAA 4Y6GB 2G77B 3KXIA 5BYKA 2P30A 4ZIRA 2X0RA 2DM6A 3I92A 3LC2O 2B21A 3ITKA 4MVCA 4IDBA 5JNRA 1O08A 1OLXA 1W0JA 1GKUB 2RGUA 4PO8A 4U2GA 4Q1FA 4YP1A 1FW6A 4JB3A 1COZA 1H6CA 2D8AA 3PQ2A 4I2VA 4DPMA 2DHRA 1M76A 3BG5A 4PQYA 3ZJUA 1MAAA 1TE2A 4YAWA 3X1MA 2JF0A 4TVBA 1K75A 1QO0A 2AN4A 1XYVA 3E2MA 3LXUX 3QU7A 1MIHA 3MQ4A 4G24A 5ALNA 1GZ5A 4UFOA 3CNNA 1TA0A 2GM3A 5IJAA 4Q19A 3SI7A 4ER0A 5JR3A 2PSSA 1SIWA 2QG6A 5DE3A 1XZFA 1SG9A 2FB9A 2VR1A 3PPIA 4OFZA 4FYMA 3HB7A 2EYUA 3B12A 4Q9IA 5ICFA 3U7QA 2DR3A 1JB1A 1QX3A 1C8KA 3SXPA 1GQOA 1L8OA 3LYAA 3OCVA 3AM3A 3QSYA 3DH0A 1SMKA 1JIJA 1Q7CA 3LBFA 4IGKA 2QUZA 2X9QA 4P4UA 5YASA 1WPQA 3SDZA 2C1XA 2DBQA 4DV2B 2IYTA 2WWIA 4ENTA 1BAPA 1VB5A 3HB5X 3H0CA 1I6KA 5ICSA 3ESAA 3WB1A 5KSWB 2WJ3A 1XVVA 1DEKA 3JQ9A 4PYMA 4O4LB 1N7HA 2FSPA 1U0RA 4GPIB 4UQOA 2ZAGA 3WIOA 4DGSA 2RH9B 3QY0A 1JA9A 1YWGO 4I1YA 2REQB 2ST1A 2VA8A 4X7PA 3TO5A 3WLIA 5SY4A 5KVSA 1V4NA 4OB6A 1W0KD 3AL2A 5K3BA 1VBFA 3X1ZA 4NABA 2IS4A 5KNCD 4K8OA 4QUJA 3BPSA 5FF9A 5TT0A 5B1EA 4LZLA 3X1XA 3NRBA 3I6MA 4F71A 5CH8A 5B7QA 1WOMA 2XRYA 1LZKA 3THOA 3WGUA 4X0EA 2HBRA 4Q7KA 4KUEA 3CR7A 4ENUA 1NJ5A 5LA6F 1T4BA 1H6AA 4GKJB 3L6DA 2P2LA 3PCXA 2F1RA 1I4WA 3IPYA 1TCVA 2FFAA 2H4WA 3KVRA 4QFDA 5FT9A 3OUUA 4TVKA 4CEJA 1AIPA 3SC2B 4D74A 3QVOA 3GG9A 1P72A 2B4AA 1JLSA 4ER6A 3QIAA 4KB5A 3DKRA 5CVDA 1CJUC 4PLZA 1OV4A 2VSQA 3BSYA 1U0LA 3UYKA 2JBWA 4NZNA 4DARA 2FGKA 3TSWA 3GZJA 3I8XA 4G1EB 4M38A 3G9QA 3P9PA 3G2MA 2XBLA 5A6SB 5LDDC 2PS0A 4RQBA 3K70B 1G6OA 3U3DA 4DADA 1W88B 3PB3A 4JBLA 2XGOA 4P4SB 3W5UA 2XA9A 2YOGA 2HQBA 3L6UA 2BF4A 1MEJA 2CHUA 3BGOS 4RTKA 1SKAA 3M9XA 1A4UA 3T7AA 2D1SA 3K8YA 4TTRA 4DRXA 2YZNA 3MT8A 2MU1A 3RVSA 3I6IA 2F1JA 3QEKA 3DWFA 1CP2A 1BQEA 1TRKA 2I5PO 3E8SA 3UV3A 3DC2A 1H4SA 1BXGA 1CJTC 2NQTA 3PDIB 3R5HA 1Y3FE 1P1RA 4FSXA 4M60A 4R1UA 3I64A 1MJFA 3JQAB 1NQUA 5E4JA 2KYRA 2G1KA 4MMYB 5L7TA 3DTTA 4OHVA 3O4IA 4GKAA 3NMUF 2HIHA 3K6SA 4EUNA 1P7CA 3L01A 4GE0A 5HXAA 3KZMA 5EZ6B 4CLOB 3MGGA 3UC5A 2YXDA 4G4GA 4M54A 1Q11A 5HM6A 4LRQA 2QVZX 3RSQA 3WK9A 1NUAA 1RYNA 2IP1A 2RK4A 3COSA 4QQNA 4ECEA 1ODJA 5BNTA 5JBNA 2I7VA 2OL4A 3WGZA 2PMFA 4LCJA 4MEJA 3Q8LA 4CUKA 4ABYA 2R86A 5CU7A 3LXXA 4F3NA 3FLBA 2A0UA 5JH7F 5DP2A 1XTSA 1AS2A 1ZWKA 4OYYA 2EFHB 5JS6A 2W0SA 2B8JA 5KSZA 4JI2B 1Z8DA 4FEEA 1FTQA 4YI3A 2IYVA 3R5FA 3CVWA 2WSIA 3M1IA 2VXYA 3R9KA 1VJDA 3L79A 3CW8X 5I9SA 1FB5A 4IILA 5KYXB 3IURA 3OLZA 3C8HA 1QYDA 3KKOA 3TSCA 1WXDA 4B7AA 5ICCA 1RQLA 1T3LA 1YRWA 2PZEA 4LXXA 3PD1A 4NBKA 2A9RA 4R84A 1V1MA 3HB9A 3GP8A 1RRCA 4OQFA 3TZEA 2G1PA 3BCSA 4G41A 2M6SA 3ABZA 3ZXSA 1XTZA 2XDYA 1X1BA 1E5VA 2ZUCA 5EN4A 2OGTA 4MYRA 3RKSA 4QODA 4GQAA 4EGCB 1JSCA 1CY0A 3COPA 3LD9A 4GP7A 1L7QA 1O95A 1V8DA 3ELWA 4XAQA 5AM2A 2M32A 3R7SA 5KOJB 2V7WA 4BXOB 4RWZA 2V7TA 4EA8A 4YRBA 1KAQA 2GI4A 3BBPA 3KD3A 3I2YX 4K6CA 4QQKA 3AEUA 4XZ3A 1X7GA 3H1AA 3OT1A 3ZCTA 1NVFA 4MSUA 2H9AA 4GZ6A 4HDAA 5T41A 1GNPA 3ZH2A 3UAXA 3HS3A 2IPXA 1F6DA 4R98A 1CNEA 1YCDA 1AKUA 3BZWA 2G9NA 4ZI5A 3UM9A 4W1SA 3VYTB 4HK4A 3DKKA 4HOYA 3ZIUA 5IDYA 1ISSA 1F1JA 3AO0B 2CVHA 3BORA 3QFCA 1PT6A 1FP2A 2VNKA 4L28A 4DKXA 2JFUA 2AMVA 3ZWVA 3VNSA 2I3DA 3DZ8A 1M8JA 4MJ7A 4EJSA 4KIGA 4X1IA 4LBWA 2FN8A 5C0OE 1A2BA 3DZCA 5AOAA 2LIVA 5HUQA 1XEXB 1T2FA 4MUAA 2AQIA 1LBHA 4PWZA 1UDCA 3O4VA 1UIMA 4TM7A 3ZY6A 3D1VA 4QUAA 5CFNA 3QX8A 2MMCA 3RSHA 1XX6A 4WCDA 3RVNA 3UUFA 4LKOA 4FEAA 4KEAA 4V0RA 4UVGA 1SD2A 1XB2A 3MUNA 3CRW1 1OQAA 5ALYA 3FDIA 4WLVA 4LPSA 4C03A 3EVBA 3RAFC 1OMOA 4XCXA 4PGFA 3IPLA 4XJXA 2A86A 4Z54A 5AVQA 5FOSA 4J0QA 1I14A 1ZI9A 4H3HB 1BXRB 2UUAB 4OHYA 2PRKA 3OE7A 2HWUA 1QHHB 1U5BB 2EFDB 3AERA 3KSRA 1E2LA 1PS9A 2B99A 2II6A 4K1LA 4XLZA 1FFXB 2A0XA 5B1IA 1JS1X 1IHPA 1J09A 1YBVA 2EBUA 3U31A 1TW2A 1FDWA 1QB8A 1PLJA 5EXPA 4KQ2A 3WB2A 4C4AA 2OFPA 2FN3A 3DOJA 5U4QA 1WSDA 4D0SA 1NXOA 4RHTA 4KVFA 1UQTA 3STWA 2PE5A 1VLLA 4XD2A 1GP2A 4DG5A 1EJ6A 2E49A 2RCNA 3HMKA 4M9QA 1QHFA 1VLMA 2Q4OA 2PSHA 4QGHA 1O96B 3R7AA 4JIGA 4PNHA 3RODA 3S7ZA 3JW8A 4YV2A 1R0RE 1W46A 2I99A 2PO7A 3H11B 3OKCA 4Q1DA 1XZCA 2Z1NA 5K0EA 1GGVA 2WJPA 2P7IA 1VP9A 1DIHA 2FUEA 2RI6A 3C39A 3E82A 3KEQA 3QBVA 1PZHA 4I19A 1GYQA 5ALPA 3VYWA 1PE0A 4NF2A 4CDGA 1IHOA 2QJOA 4YX9A 1VPWA 4MRSA 1ZY2A 4KWTA 3DW1X 1MO4A 4S2UA 3WNDA 1E6MA 1G9TA 1DG1G 2OCPA 2PFSA 2IIVA 4DLPA 3LCJA 2UYQA 2QI9F 3MTBA 3TM5A 5B4VA 1VMIA 1XZIA 4NH4A 5KQRA 1RQXA 3CSUA 5ULLA 3BF7A 5BSTA 2AEJA 3T3GA 5JYDA 1HT3A 4HAZA 1G8YA 3ZE7A 4ZMRA 3PQ3A 1LPOA 1PV1A 2QTHA 4IIJF 4D3YA 2ZRDA 1H0SA 3KQHA 3EPHA 3ASYA 4DCMA 1VCMA 2C4VA 3DFIA 2AMLA 3I9OA 4XUCA 3O75A 2EWMA 1D8TA 4YJHA 1XZQA 4W82A 3OJLA 1O2DA 1YL6A 1Y7IA 3NP9A 2OMEA 4GLFA 1JU3A 3BGSA 4IZ6A 5AICA 5FI1B 1KO7A 3JQ8A 3G0IA 4M9XA 3TAHA 4NYMR 1IBSA 2BFMA 2RKOA 2P2YA 1TU3A 4L0DA 4PW0A 3F67A 3DFKA 1M6YA 1VDMA 1MW9X 3RYTC 3VO9A 1FFBA 4CM4B 4HNSA 2Y66A 3MCTA 1XLUA 2C2KA 4NSNA 3PGVA 2IRWA 4YCDA 2IHUA 2ZBGA 2CL5A 2ZRJA 4MYSA 4PYNA 5DHFA 1IJFA 4NCJA 3LC7O 1RADA 3V8VA 1QF9A 3DJYA 1AGPA 5AVKA 1XFAA 2ZTVA 2PRZA 4TMTA 1NKVA 3NBYC 4B3CA 3ZHVA 1TEZA 3T7SA 3O4RA 3UMVA 4DT1A 2AJCA 5KQMA 4F06A 2V97A 2Y0DA 3PUIA 1Y8RB 3PX2A 4G1UC 1T35A 4ZYVA 3BD6A 2C9OA 3FZYA 1OB5A 2V1XA 1JDBC 2QVYX 2QRGA 2IK8A 1GZSA 1U3FA 3NKLA 4YRIA 4IY1A 2VWGA 2OC9A 4CFZA 2BSXA 2R5WA 3AVUA 4ASUD 1MTOA 4KXLA 5ECGC 4KE6A 4DNFA 1WMDA 2PH5A 4DLZA 5JFGA 3W90A 3V7WA 3QWHA 5TC4A 3SCZA 1T43A 2R65A 1GARA 1NBEA 1VLJA 3V4FA 1ZN9A 4PU0A 2AXEA 4PZ0A 4Q93A 1P2DA 1SBIA 3IHKA 4KSCA 4LNHA 2J08A 1T5DX 4D81A 4GDFA 1FXWF 1OFUA 4L16A 5AOCA 1MFZA 2BJVA 3ONDA 2FEOA 4D4IA 4RHFA 2WUEA 3U5TA 5FPKA 3LVRE 3JD4A 3SICE 3O4FA 3HJGA 2AYZA 5JCOA 3UFXA 3K71B 2C5SA 1I7QB 1HDZA 1J99A 1OXKB 4X54A 2WP8J 3ENQA 1ZEMA 3L1JA 1KI2A 4MTLA 1PFYA 2GBLC 3BJRA 4S1WA 4CHGA 5KOHB 4I1UA 4OHRA 1K0FA 3PC3A 3ZX4A 3K5PA 2B4YA 3FA2A 5D3KA 2OV1A 4PCVA 4R54A 1TIPA 2ZIWB 5TEVA 3TZHA 4GBJA 2RGCA 1SBHA 2JKVA 2AEEA 1PZMA 5DTJA 3Q9LA 3HA7A 4MVJH 3T06B 1M8GA 5HVNA 2BH2A 4ZOLA 3FIUA 1NSTA 3QKRA 2VBFA 1V3QE 1GYPA 4MUXA 2Z6AA 1MO3A 3LBIA 1YUMA 3B6IA 3ZXXA 1HNNA 4LEIA 1D0SA 1VFNA 4LKRA 2GD1O 3RHTA 2C2WA 1LQTA 2Z83A 2NT4A 5FUWA 3G9UA 4ZO4A 5EIXA 4DR6B 2E5FA 2GKGA 2CCGA 3FAKA 2XGSA 3B38A 3L2OB 1KRHA 3MT7A 2VPZA 4K6MA 4NMWA 5LJIA 3PENA 3GG2A 2ZAMA 4B6FA 3S8YA 3C8MA 3FPFA 3SS8A 4XLTA 1OHHD 3ZDQA 1DCFA 3PVZA 1I2AA 2VHUA 3IXMA 5AJYA 2NZWA 3ZWYA 4LF8B 4P2GA 5JBQA 1NYQA 3VTAA 2GERA 4JODA 1O9GA 3Q6IA 4HPXB 4R6XA 1QCCA 2VWQA 3INGA 1D4FA 1F2UA 2LPMA 4XIGS 5AJTA 4UCWA 2YYAA 3IVCA 3VU1A 4CE6A 1YB7A 4BAUA 3CB2A 3HCFA 4DJJA 10MHA 3CRMA 1OIWA 2I1VB 2JIBA 3N74A 2JVIA 2CV0A 1W5BA 1KVTA 1XA3A 4UBOA 1QTQA 2HIGA 3O91A 1W581 3J7TA 1RBMA 1F6BA 1OI7A 3Q5EA 4JQZA 1VYTA 1XZJA 3P2JA 4KTTE 5DYYA 3FTQA 3IUMA 5A9TA 1AH2A 4TYMA 3TZCA 1HDYA 5K20A 1LNSA 3IDOA 2VL7A 3IS3A 4X1KB 3ZU5A 4C76A 1XNJA 2H1WA 2PBLA 5JG7A 4C05A 5JW6A 4MGHA 4Q16A 3GFFA 2C4UA 1VKNA 1DQYA 1HEIA 4FIDA 1ZNZA 2C7PA 5B1YA 4EHBA 2AF3C 1IN7A 3WBBA 2G36A 1NW5A 1FUYB 1FQWA 4XIIA 4KTVE 3L1HA 4G0YA 1I5OA 5AVSA 2JLVA 5WRFA 2P9HA 3ASVA 3M2PA 2CZCA 1Z82A 3KLMX 3P9ZA 1AS0A 2O7SA 1BO6A 3B53X 4JBIA 2G88A 3Q4GA 4WZBB 4Y2VA 4E6EA 2XJ9A 2Z57A 3FMFA 3WL5A 4CTJA 3HR7A 1CRLA 1D8AA 3O8LA 5CVTA 2QT1A 1VSTA 3R8XA 1QKIA 2R9VA 4AN1A 4ETWA 4R6WA 1OBCA 3LDFA 4EHDA 1IY9A 1FMLA 4PR3A 4R3WA 4RF5A 2P2DA 3L05A 5E1BA 1TPYA 1KS2A 3EDRA 1JDJA 1F20A 3GRVA 2OCAA 1BC5A 4EPTA 3OCUA 1Z06A 2X40A 3AW9A 4TN1A 3VNVA 4D0GA 3GRYA 2UXBB 1TT5B 1NWHA 3LXRA 1QIFA 4P08A 4I5FA 4D97A 2ZJ7A 3V8NA 1EG7A 3O2SB 3UCEA 1H4VB 3OF3A 3E5RA 3MWDB 1FU8A 3Q1KA 1YS2X 3LKDA 1V8OA 1MB2A 2PKWA 4QXQA 4ZU1X 4YRAA 1G98A 4KYVA 4RXTA 3H8JA 3O47A 1GAWA 1Y4AE 5KCMA 1CRQA 3AXSA 2PUEA 1NNUA 1MUUA 1YU9A 3KVVA 3LH5A 2C8LA 1WUIS 4QDOA 1D3AA 1Z2NX 1FTYA 1H69A 2X8JA 3DLPX 3LFUA 3ZQ4A 5JXGA 5MGNA 2NSDA 2H1FA 2J7KA 3SC4A 4LWZA 3IKJA 3MFYA 3OPYI 5FOQA 4Y6SA 2R7KA 4IYRA 1RXSA 3MELA 2WJIA 4RPKA 4FE7A 5BN5B 4HAOA 1DXQA 2QAGC 2YFQA 3EEQA 1WU7A 3NIBA 3OCXA 3F4BA 5BWCA 4I1OA 1CYDA 5CA1B 2LWIA 1KPGA 2B1GA 4M1YA 3MD9A 4DA9A 1OT3A 3K5WA 3ZKAA 4YCNA 3DHWC 4C07A 1ZRHA 3KE9A 4DV1B 1FRNA 1T91A 1MC8A 2D2EA 2BKVA 2EOAA 1YA4A 2LVBA 3CNBA 3QYAA 9ATCA 4QM6A 4KGXA 3TTTA 2BZ0A 3TB4A 4IXMA 4R8MA 1DX4A 2JC3A 3Q2OA 4AYXA 5E6UA 3OZAA 3I5XA 1JT2A 1Y3AA 3I34X 5E9WA 5DBOA 3ER8A 1EFRA 1RS0A 3OU2A 4W8HA 1F8UA 2F43A 3K0AB 8AT1A 1BW9A 1ZVVA 2BFFA 3CCBA 1EM8B 5EJ4A 3JTMA 3T7CA 4P3NA 3FPGA 5F33A 5I01A 2YJGA 3I61A 1M8FA 1VJCA 4ALLA 3T1OA 3M3DA 4NICA 3WLHA 4B46A 4AFNA 3OQJA 4C6TB 1ENOA 3F2IA 3BK7A 2Q5HA 3DXYA 3OZWA 4UHKA 5FL7A 3GRFA 4CDRA 4NU6A 4E5DA 4IXWA 2Q5EA 2Q2QA 1OTYA 4HMQA 3PFFA 3GUCA 3WFIA 3GO4A 5CA1A 2J3JA 1HNWB 1BIFA 1KO1A 3KL2A 2O7QA 3V2UA 4B6GA 3H1TA 2XNDD 1QVVA 3HBNA 5HP4A 3F8WA 1HC7A 4JWKA 4WK0B 1X7ZA 1YU6A 3GJ4A 3NR2A 1TCAA 5JHGB 2YOHA 4ZRMA 4TKLA 4AF6A 2JJQA 4ZOLF 5B3AA 5KKCA 4BY9E 4BO8A 3O8OA 1J5XA 3Q11A 1HR0B 5CFRA 4N5LA 4R8VA 3AEKA 2BGKA 1L5KA 4WFJA 1I0ZA 2GN1A 2HLDA 3CBQA 2X3UA 4NEGA 3GMTA 4TV9A 1TF7A 1JTEA 4OX9B 5AW4A 1JZTA 3ECAA 2F17A 3SP1A 4HNTA 1UMDA 3MCUA 3EAFA 3QV2A 4W6QA 2PQ0A 2WIBA 5GJCA 3P2YA 4YT8A 2PUVA 1TRHA 4TSRA 2EQAA 1U28A 1S2IA 2ZT7A 4KLNA 2Q5CA 1SXGA 2OBFA 2ZE6A 4NU8X 1LK7A 4F1KA 1QOZA 6AT1A 5CLHA 4B4OA 4N0DA 1YV9A 2VBCA 2IP2A 2WIJA 2VUUA 3KXPA 3SC6A 3ZV6A 2BMEA 2X7JA 3A1EA 4ZA2A 2PWBA 4I2NA 1M10A 3WLFA 1JEQA 3WWCA 5C8ZA 4Q15A 4JYBA 3G8AA 2HK8A 5K0GA 3NDBB 3RFXA 2DT8A 4ALJA 2CV1A 1L5HB 1LQ2A 2G3YA 3B9QA 1YMUA 2G09A 2OWEA 5HTOA 1GEGA 4AIRA 1JFTA 1X3LA 2XB4A 1DS6A 1QQ7A 2BBTA 1GNQA 4WFQA 2PTGA 3AL3A 1G6KA 1N9GB 1D7AA 3BQ9A 3CLVA 4I50B 1QV9A 2RBEA 5ALEA 1JZSA 1U0TA 5DW0A 3CWQA 3LUJA 2Z4RA 1E1YA 2FNAA 3D6FA 3QEAZ 4R1QA 2QV0A 2XADA 4HDQB 5D86A 4A16A 3S2FA 2AGVA 1WP4A 2GZSA 2JFNA 4QJ4A 4GI7A 2YC2C 2VA9A 2FSIA 1M5UA 4HL6A 1MKYA 4IDGA 3KZNA 2OGZA 3WLAA 2W2NA 1C1DA 4TL8A 4LV8B 4UARA 5CMLA 2FLKA 1QVRA 1GFSA 2JL1A 5C5EA 5FPQA 1W5SA 2N3ZA 3AETB 5IAAA 3WO1A 4JA0A 2QNIA 2G5TA 1F2UB 4DCTA 3WK5A 3JYPA 4BQOA 3GVIA 4QOIA 2PS3A 1VZ3A 1WD7A 3K2BA 3LE8A 4LFCB 5KYKA 3DDWA 1LDGA 4NBSA 2QN2A 4Q4JB 5CLQA 2OG1A 3FNFA 1TYCA 3RK1A 1JPUA 4MUJA 4J0IA 2O9JA 3A6FA 1HK7A 5E4FA 4GXNA 1X42A 4KQXA 1E4VA 2QE7A 5D2CA 2VDJA 3M6IA 3D59A 3RHZA 1D2GA 5C4MA 1DT3A 3S8EA 4MVJF 5KO2A 2PQ6A 4CKWA 5L9AA 4N6NA 2C2XA 2R84A 1SULA 3CLKA 2R1ZA 2AD1A 3W9YA 2W2KA 3H16A 4BV3A 5JEDA 3W2FA 3KYJB 3OF2A 3PDUA 3PIDA 1RWQA 3S2YA 4LWQA 4HBZA 2H2GA 5GY7A 3ZWAA 2IQIA 1G21A 3TLXA 4YBZA 4H08A 2YYYA 4JVMA 4WA7A 5IEBA 4ZHSA 2VHVA 1Y8QB 3TLGA 1YRQA 2IF2A 1GUZA 4LXYA 4BC1A 4EELA 1Q7EA 2I4NA 5EE3A 1Z4QA 1P45A 3TUJC 3ZE1B 5JATA 4D43A 3PUZA 4FTWA 4XASA 5J40A 2C84A 3WK6A 1A82A 3LBAA 5AJVB 2JFXA 1NAIA 2JJYA 2H9IA 4QOHA 4YJ2F 4L7VA 4Q12A 1JJAA 4C7BA 3KYBA 4R9NA 3PKIA 3KBOA 1YK1A 2WJZB 4ZCPA 4OKNA 3Q87B 1T2CA 2OQ2A 3PQ6A 5JXHA 4J0HA 3ZDBA 1ZHOA 4R9RA 3AVOA 3QUTA 1EFAA 3AV3A 5FB3A 4DLBA 3UOWA 3CQ9A 5I6DA 3JTEA 4K6HA 3F5QA 5CFOA 2FA9A 4G2NA 2HMAA 4ZAWA 3MAAC 5FFMA 4DYDA 1ECCA 3FWHA 3SVTA 4QVIA 4QL3A 2AKYA 2IOFA 5I5EA 3GUHA 1T0IA 5E8RA 1TCBA 4NOLA 2G4VA 2W2MA 2I3ZA 4K03A 1DC6A 2ZYAA 3BDVA 5KYUB 5E7MA 1MB4A 4KH1A 2IH4A 3E22B 2QRHA 1VI6A 3AV0B 5INTA 1KEKA 5IAOA 2ZS8A 3EF3A 2HAEA 2NSJA 3WLMA 3AVWA 1AMNA 1ZMTA 4MS3B 4W9MC 1LWNA 1PSDA 3JASA 2I3BA 2P4UA 3LP6A 2F00A 2OO5A 2ZVJA 4IDHA 3EQ8A 4LE0A 4RVSA 3T38A 3ULKA 3GLHA 5IJXA 1FYXA 1Q22A 2JI4A 2VDOB 1RDFA 2I8CA 4OMDA 4PCLA 2GBFA 2EHDA 4O6VA 3V8RA 1E63A 5EZ5A 1N0HA 4IRMA 5IC6A 1SB8A 4K28A 4AI6A 5TDHA 3HVKA 3PE4A 3DG9A 4REMA 4YVFA 3A1VA 3MMNA 3WB0A 1T36A 2OC4A 2R5NA 3LUDA 3BA6A 3ZDZB 3SEQA 1SCKA 4BVBA 3F7MA 4MW1A 4CEHB 3D3JA 1Z0DA 4MA5A 3RO7A 2O3SA 5JZOA 1GDTA 5IZ4A 5F9MA 1RQ7A 1YFKA 1OI3A 3CLSC 4HDSB 5CCXA 2HFJA 2J45A 4KC0A 4WSOA 1TQ2A 5HFJA 4AMYA 4DJ5X 2AQKA 2Q45A