2KE5A

Solution structure and dynamics of the small gtpase ralb in its active conformation: significance for effector protein binding
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
174
structure length
174
Chain Sequence
LALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGLEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Ral-B
publication title Solution structure and dynamics of the small GTPase RalB in its active conformation: significance for effector protein binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 33
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2009-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ke5A00
3LBNA 4XSHA 4DDUA 2W2VA 4TWZA 3MWYW 2UZIR 1H8HD 1P62B 2ZI3A 3NIBA 4A2QA 1X8LA 5EE3A 1A1VA 3TIFA 3CX7A 1N3BA 5EP3A 4G5OA 3B1ZA 1W4AA 3IHWA 4RD3A 4OHXA 1QZXA 5EE0A 1C1YA 3EPHA 2NO6A 3KXLA 4XSGA 821PA 1WDTA 2G6BA 2PBRA 1C9KA 4Q4JA 2ZE5A 5BWMA 4KI0A 3NC1C 1Z0IA 3U2QA 2JLXA 4JVSB 2QSYA 2PEYA 3CRQA 4FINA 2CHVA 2QI9C 1T5LA 2W00A 4ZDWA 5TVKA 3WHKA 3KUDA 1QHYA 5HCIA 1DEKA 1XMJA 2OXCA 4CDGA 1Q57A 1T0JB 3RC3A 2WTUA 3R7WA 4RZ2A 3QENA 2Z5FA 3T34A 2P6NA 2OLKA 3RRYA 1LY1A 2GDJA 1ZUIA 1NY5A 2R6AA 1IJEA 4GSYA 1GG2A 4QRHA 1OHHA 1ZC4A 4QHTA 3L43A 3OZXA 5JEDA 2GVDC 2O8BA 4UXJA 4B6EA 2Z6VA 4KVGA 3VNUA 2VTKA 3UPUA 5FUVA 3SE0A 1R0XA 1YZTA 2J5XA 3D3QA 3F0TA 3LAWA 4IVQA 4JYBA 4B34A 1DPFA 3IIMA 3SR0A 2DWOA 4B3GA 2RGGA 2L0XA 3SJCA 4B3BA 1TEVA 1NI3A 1P7CA 1PLKA 2QRZA 5E3HA 1IJFA 4PZYA 1CLUA 4POAA 3I72A 4CYMA 4AI6A 5KDOA 5L3QA 1KO8A 3FVQA 1Q1ZA 1S8FA 1ZUNB 2PX3A 3LXXA 4RSGA 4MDFA 3CONA 2EYQA 4QGAA 4DWJA 2DR3A 4G01B 2X2EA 2V7QA 3AH8A 1CJKC 1G6OA 4WBSA 2ZS8A 3V4RA 2GEVA 2OXRA 2XJ4A 3EC2A 1E9EA 2JLSA 4BFWA 4JBYA 2ZRPA 1SXJB 1N6HA 4JBWA 1M6NA 2P5TB 1KOFA 4YXWD 1JALA 2XSZD 4EPWA 4UNSA 4DUGD 4C4PA 3HJNA 5JI3E 4Q1EA 4WZBE 2J1LA 2BMJA 3QXSA 3GJ8A 2OBNA 3N2EA 1XJQA 1Z2AA 2H57A 2G3YA 4NKRA 1R2QA 4A8JC 2UVQA 1OHHD 3HYRA 3D6TB 4D80A 1W0KA 2NMVA 4BLRA 4PC6A 3QF4B 2YZ2A 4B32A 2YWHA 3Q7PA 3KQUA 3UMRA 1XMIA 1W36C 1T8TA 1MRNA 4F92B 1T0HB 1W4RA 4GP7A 1ZVQA 2BM0A 2QT1A 2VF8A 1OIVA 4QGHA 1WBDA 1GTVA 2IYUA 2FZ4A 2RKOA 3CPHA 2HXSA 3HP1A 3PEUA 3R20A 3BC1A 5FTKA 4RY2A 2ZRDA 2EFCB 4QNMA 3E70C 2XOKA 3H86A 4TL9A 4EPRA 2IS1A 2J3EA 4DLRA 1S0UA 2VHCA 1X6VA 5KNDA 2C96A 1G20E 3CO5A 1OYWA 1Z6XA 3MWJA 2FFQA 5CJPA 3U4QB 3WMGA 4BZQA 4LJAA 4HAWA 4KU4A 3CBQA 1E2FA 3RNLA 121PA 3IIKA 3K09A 3O8DA 2WJIA 3REFA 2BVNA 1MO5A 1U9IC 3VX4A 2JLRA 4TTRA 3X1XA 4MKIA 2ZJ8A 4C3ZA 1E2JA 1SVWA 3KKQA 3WXMA 4C2TA 1SXJD 4ON9A 1BOFA 4IEIA 4PC1A 2ORVA 2J45A 4JYCA 5TV2A 3F5FA 3EIEA 2GWHA 4R2IA 4Q4AA 1UF9A 2ATXA 3AVWA 3NHAA 1M8PA 4XTCS 2PJZA 3T5GA 1JR6A 2ZETA 1AS2A 1Z0FA 3T61A 4CZ2A 1HH4A 4UNNA 4TYNA 2GA8A 5KNCA 4TLDA 3GLHB 1L4UA 3QKTA 3ZVNA 1JR3A 1QHHB 2BMFA 4NYIR 3PR1A 3Q8XB 1G8HA 2JCSA 2G0TA 5KOYA 1GRNA 2F1IA 4IHQA 4MKHA 2PT5A 1SHZA 2CK3D 2G77B 3TAHA 1WP9A 2F55A 1KO1A 3OESA 4BEBA 2QEQA 3QIAA 3NH6A 4BLQA 1GOTA 2IYLD 1OYYA 4FI3C 1DAEA 1SVMA 8OHMA 2NO7A 3AKDA 1W49A 3H0KA 3GP8A 5KDDA 5CIWA 4TT3A 1E2PA 3U3JA 1U0JA 4U00A 2Z43A 1XD2B 1UJ2A 2IHYA 5C4GB 4Q48A 1MRSA 1FMJA 4O2RA 1ONBA 2ZUCA 1EFTA 4GFDA 2C98A 1T3SA 2ZI7A 3OEHD 1W0JD 2VRWA 5J4HA 3THOA 2RGBA 1NIPA 2ZSAA 4G1UC 2IYRA 2Z4SA 1RC8A 4HLCA 5CJ2A 4A0FA 5D3MB 1AK2A 1G291 1IAQA 1KSGA 2VPPA 3PEVA 3NHBA 2QY9A 3PIRA 4TMZA 5BXQC 4MKFA 1G3QA 1J99A 1Z0DA 2JA1A 1S4QA 3B82A 3HDTA 4HATA 1W44A 4Q7MB 1JQJC 3UANA 1YE8A 4US2R 4CEHB 3TKLA 1P9RA 1OPXA 4C7OA 4MQBA 4HUQB 1EESA 1KI7A 1NSFA 3B1VA 1RJ9A 1JXOA 1RVDA 1V5WA 3K9HA 4DC9A 1CULC 1F6BA 2QTHA 3ZZTA 4DDVA 4D6PA 2F1JA 2JJ1A 3IPYA 4IFBA 2XEXA 4ZIRB 3GLGB 2CLSA 3UIEA 1VCIA 1A7JA 2GF9A 3MAAC 2FSHA 5JFGA 5CYPA 2CL0X 4LBVA 1J90A 1AKYA 3OIYA 1MV5A 2JASA 1N0UA 2NZJA 1NLFA 1G9XA 1ZNZA 2IC5A 3DOEA 2BBOA 4RD4A 1GL6A 3KKMA 4DLUA 3ZYCA 1KI9A 1EX7A 3BBPA 1SHKA 5JCPA 3SC3A 3NKVA 5HE9A 1GL7A 3NBZC 1II0A 1VHLA 2EQBA 3QKUA 4HEJA 5FPSA 4TZ0A 4X8MA 3PEWA 4LCBA 4E09A 3ADBA 1DBSA 4IRUB 4GMXA 5IT5A 3ZZUA 2XTNA 1DO0A 4OHZA 1Z63A 3FKSD 1EFHA 3V4FA 3EZ6A 5CDFE 3L82B 1M74A 2D62A 421PA 1NMXA 2J7PA 2Q3HA 2K5UA 4JLAA 2O0JA 4M1WA 4Q4AB 3L0OA 3O47A 3BERA 1R10A 3PCRB 1GUAA 1YKSA 5FBLB 3DMNA 3AGQA 2CHQA 1FW6A 3LLUA 2KJQA 3WYGA 1VDZA 1YR6A 1ZAKA 2QROA 3FWYA 3FGNA 3B1YA 1YZLA 4V02A 4XVQA 2WWYA 4KFUA 2JEOA 1KK2A 1WA5A 1Z3IX 2FOLA 2ZRJA 2WWXA 1UKVY 4QBFA 5C18A 4BFTA 4M1SA 2P2LA 4TLCA 1Q1QA 3P27A 3Q5EA 4OYHA 1KTVA 2QBYA 1M7GA 2QMHA 5CM9C 4DLZA 4M1MA 5AJZA 3H1TA 1TF5A 4Q9KA 1Q3HA 3RLFA 1IY0A 5AJWA 1H8HA 2QGZA 1D2NA 2GJ8A 2W6IA 1XMSA 1GRQA 3WNDA 1E4YA 1Z22A 4S35A 2FGKA 5JS8A 2J0UA 1I2DA 3BWDD 1D2MA 3QPVA 4IOLA 3C5HA 1R4AA 2CL7X 4KLNA 1RRCA 4P33A 2IF0A 1XEXB 2G1KA 3DKVA 3V00A 1P6XA 3QUSA 4C0HA 3TE6A 1LS1A 2IHBA 1YZQA 3AGPA 3OAAA 4HUTA 1IN5A 4KBGA 4N3NA 1IM2A 2H92A 1B0UA 4PQRA 1G3IA 4LJYA 1OFTA 1T3LA 1XD2A 3JZMA 2P0EA 2F7SA 2XSZA 3LD9A 1KI8A 1ZIOA 4TLBA 4A8JA 3KXIA 2FG5A 3NXSA 4KSBA 3RHFA 5KSYA 4B76A 1Q0UA 2RHDA 3WRYC 3GEEA 4XVRA 4ILEA 1W0KD 1XNJA 1U8AA 2ZE6A 2YOFA 1ZBDA 1CJTC 3AKYA 2P5SA 3N5CA 1OFUX 1OKKA 1XCMA 2GEUA 1IN4A 4MGIR 3TSZA 4RZUA 3W3AA 4BLTA 4DEYA 1IY1A 2PMKA 4DXAA 1G21E 5CITA 4O25A 3U7EB 4YXWA 2BMDA 2AD1A 2ODNA 1AGPA 4IDHA 2NTYC 2O8BB 2O0HA 3ZS8A 2RGAA 4DRZA 5AJVB 2ZRGA 1Z0KA 4KBFA 4XWOA 4M1KA 4TL6A 2WJVA 3A4LA 3D31A 3KTAA 4CW7A 2GK7A 3HR8A 3HWSA 4HSEA 4MITA 1KYIA 3CF0A 2PEZA 1CEEA 2G1JA 3AP3A 2O8DA 2C9CA 5L3VA 2JAQA 3CZQA 1XEWX 1DO2A 4PTLA 2AXNA 1XBTA 3LLMA 3QOFA 1ANKA 1NRJB 2ZAMA 2R6DA 2ZSFA 3W90A 3ND8A 3H84A 3C16C 1NN0A 1S1CA 1OH7A 3GJ5A 2QQEA 4KVAA 1UDXA 2ZI9A 3BB4A 1P9NA 3QG1A 3NEJA 5FBWB 2W58A 4WW0A 2BBWA 2A9KA 2V6JA 1T5IA 4EFMA 4GDFA 1KI6A 1W1WA 2H1LA 1ZC3A 2UKDA 4IDQA 1LW7A 1F3OA 1OXUA 2I1QA 2OCYC 3TLXA 4B43A 1XPUA 2QGNA 3OE7D 1M34E 2XNDA 4M22A 4QHSA 2W0SA 1KSHA 4PO1A 3KJIA 1X1SA 2IBMA 2ZRIA 3P26A 1N25A 3TJZA 2HUPA 3MD0A 5GJCA 2FA9A 3K9LA 3SJAA 5EUQB 2IK8A 4JVLA 4BUJA 2PLFA 3CPEA 1P5ZB 2P67A 4QGFA 1IQPA 1G41A 2CBZA 4ZCLA 4LHZA 4R71A 4QM7A 4BZXA 1N6PA 4N0DA 1ZIPA 2V3CC 4CRWB 3LY5A 1G7RA 4IXNA 2AXPA 1L4YA 3VR6A 3RANA 4BASA 4V03A 1DELA 4DBLC 3GPLA 1KMHA 2R62A 3HYTA 2BKEA 3QE0A 3KUCA 2QENA 4LHVA 3SOPA 4O2LA 4YMVA 2Q3MA 3GQBA 1NLZA 4KYIB 4NYIQ 1G8PA 2JJ8A 2IYVA 4PPQA 1KK3A 3I32A 2CE2X 4JLOA 2YYZA 3ZVLA 4L8GA 1KGDA 3RDPA 3P32A 1OXSC 1QHIA 2OFXA 1ZW6A 3I8SA 3DEFA 3I73A 1S9DA 1JAIA 5BN3A 3AVYA 3PG5A 2J9RA 1IOZA 3GD7A 3T1OA 5EE5B 4EFLA 2VHJA 4JLDA 3EWAA 1VKJA 2GEDA 2FJUA 2ORIA 4BEJA 2QP9X 4B75A 2FGJA 1QHHA 3I8XA 3CRRA 2D2EA 2YHSA 3W34A 2YJTD 1XXHB 6Q21A 2YC2C 3KKOA 4JMPA 3MSXA 2Z0MA 3BOSA 1OIXA 2QMUA 3WRXC 3E1SA 2O8FB 3EWSA 1D5CA 4A92A 4D81A 4TTQA 1RPZA 2C78A 1LNZA 1W0JA 1LVGA 4JBXA 2BBSA 2IS6A 5CLLA 1TTTA 1W36B 4D4MA 1ZM9A 3RS5A 3SHWA 4DCVA 1YZNA 5TDHA 5CLQA 3EIHA 4MRPA 3K0AA 4IOKA 3EZ7A 4M2LA 4EUNA 2JGNA 1J8MF 1R0YA 1MOZA 4LHYA 1FX0A 1NJFA 2ZRMA 3CRW1 3MWLA 4BFXA 5BN4A 2J0SA 1FNNA 4IOJA 2Q6TA 1MH1A 2ZU6A 3K1JA 5FL7A 3TAUA 1DS6A 2HCBA 2ZSBA 2CLCX 1H65A 1N0VC 4Q47A 4H9GA 1NVXQ 4Y0VA 2P6RA 2C99A 4Q4LA 3EAQA 3REGA 1S3SA 2OZEA 5EJEA 2ZE7A 1W2HA 1ZU5A 2CXXA 4QG7A 4TSFA 1BO6A 5DLQC 5DNYB 5SZHB 2A5GA 3IHLA 1Y3AA 3B13B 3QF7A 2OCBA 1II8B 2JATA 1TPZA 2H5EA 4JVNA 2ODWA 1E9FA 4BWYA 4HUQA 1E9AA 3SBEA 3RS0A 2UZ3A 1CXZA 4QKQA 1G3MA 4L4UA 1ELOA 2V6IA 3GLHA 5HZHA 1J7KA 1N5JA 2AK2A 2VP4A 4A15A 2WZQA 1I4TD 3ONWA 1H8EA 4TYPA 1KO7A 3W6PA 4RFSA 2OFOA 4BFUA 4RD6A 1E2IA 1KY2A 2GCOA 5LBIA 1NKSA 2HJGA 3JVVA 2MSEB 1HA3A 1XCPA 1Z06A 3B78A 1T8UA 4Q1BA 4KSCA 5TMPA 5JJKA 4YC7A 3PV0A 4V0OA 1FMLA 1N5LA 3BFVA 5FR2A 3W5IA 1R5BA 2RMKA 4GI7A 1SVLA 1NY6A 4TL8A 4AIIA 2QN6A 4NDZA 3K09C 4MYHA 3KZ1E 1KI6B 2IS4A 2VP2A 1XJ0A 1G3RA 2I3BA 2ZJYA 3AF4A 2AFHE 4UNRA 1NVVQ 4P3YA 5A5GA 1P2VA 4ZI3A 5JJIA 5J47A 2BM1A 1D9ZA 4WXRA 5DE3A 2CJWA 2GXUA 2J41A 2ZSDA 2R9VA 4UNQA 1IONA 2FPMA 3DVLA 3NDPA 3DDCA 4WIAA 5HCNA 3R8FA 2BKUA 4BFSA 4EPYA 1BMFD 2GJAA 4R98A 3I1FA 5KDLA 1E94E 2JLWA 1RYHA 2XGJA 2QUZA 2ZE8A 1NN3A 4A9AA 4UQOA 5F9FA 3D8BA 4KFRA 5CYOA 5AR1A 1E69A 1D6JA 2ZR9A 2ODBA 4UJ3A 3KX2A 1OF1A 4URWR 3RRMA 3W5JA 2V9PA 3LVRE 1YU9A 4PSKA 3SYNA 2FSIA 1FP7A 5J4LA 5H68A 1SXJE 4H1VA 5FTMA 3LBHA 5FOSA 5JJLA 1TF7A 1G17A 2OHFA 2SHKA 3IO5A 4PPFA 4PXAA 2JLQA 1NG9A 1HYQA 2H16A 3K0SA 2LWIA 5E4FA 1TU3A 4DLTA 1SQ5A 2WSSA 4MUBA 1E1QD 1KY3A 1SZPA 1XEFA 2J0UB 2O5VA 3FTQA 3H4MA 4CVNA 4BQSA 2FV8A 2C8VA 5HZKA 4NYMR 3M0EA 4DUGA 1K6MA 3TW8B 5LPNA 3VNVA 3KQHA 4GBMA 4HZUB 4XJXA 3KJGA 5F9HA 2R8RA 4N0EA 2ZJ2A 1RZ3A 2JJ2A 4B48A 4D82A 4FXPA 1MO4A 4D0NA 2OV2A 4RD1A 1J70A 5FPKA 4K46A 2FWRA 4EQ6A 1L7VC 4IDPA 1NLYA 5F98A 4TMWA 4GOXA 3CX8A 5EXSA 3BK7A 1GZSA 1G19A 2IEYA 1E2EA 1KMQA 2F3RA 2X8AA 4E22A 1N6LA 2EWVA 2X77A 4G3XA 1GL9B 3CR7A 1XPOA 3AF1A 2BDTA 1A5TA 2E1RA 1PUJA 1RW4A 3BS4A 1U90A 5HKKA 3K0CA 2ZIAA 2QE7D 1KO4A 4Q00A 3CNOA 4PPGA 5J4KA 4OHWA 2XB2A 2WWHA 2HDNB 5L3QB 1I4LD 3WY9A 2AKYA 3R7WB 4WZ6A 2RGNA 2WMNB 3QVVA 1BYIA 1XTRA 2WHXA 1C4OA 2WOJA 1JPJA 1OSNA 4FCVA 1OB5A 2BJWA 5F3WB 3A6PC 4IW3B 4WOPA 1TEXA 5AUQA 3SDZA 4OQLA 4D25A 1XU4A 2QM7A 3LWNA 2XTMA 3A1UA 1EFRD 3B2EA 2F6RA 2PCLA 2RGNC 3WMEA 3QPWA 1PJRA 2NG1A 5EXPA 3UG7A 3FMPB 4ABYA 1JR3E 4NU0A 4RCZA 3FHCB 1VIYA 1G4UR 1W48A 2EFDB 1ETUA 1DADA 2BJVA 3ADKA 4HLUC 2RB4A 4NE2A 1P4SA 3FE2A 5B30A 2CNWD 2F9MA 1E9DA 1JBKA 1R8QA 5BW8A 5JI2E 3KJHA 1AZTA 2GZHA 1NKTA 3MWKA 4PC3A 3SI7A 4DLXA 1I2MA 5G3ZA 4ZKEA 4PFSA 1O3YA 4US0R 4LJ5A 3A1VA 3DO6A 3KTAB 2J7KA 5FUXA 5H70A 4EDHA 3IUYA 1S96A 1Z08A 4XD7A 1CR0A 2V7QD 2D7DA 4XVUA 1ZM3A 4OHYA 2DY1A 1ZMXA 1P60A 3LA6A 4C0BA 1KJYA 3QI2A 1W7AA 2Y8EA 4ZKDA 4CEJA 4HAVA 5BN5A 3ZD7A 4RFVA 1MKYA 2BEJA 2MMGA 1P2SA 3NVAA 1CRQA 4HYYA 2OLJA 2ZRHA 3CB4A 1E2MA 1AZSC 1UADA 1NJGA 1A2BA 2GTPA 3JVUA 4L5BA 1N6OA 4JSYA 2ZITA 4AWXA 4AKHA 3IPXA 5D3QA 3WYFA 4KXFB 1ZD1A 4CT4B 3NDBB 4C9BA 3SFVA 5HR5A 2V1XA 1NNEA 1G7TA 1E0JA 3KQKA 2AD5A 3PQCA 3ZH9B 2F3TA 2WWIA 4GOKA 2OUKA 3QG5A 3FFBA 1KIMA 2OG2A 4PHGA 4PSVA 5JWRA 2ZANA 2FSFA 4EJSC 2KBFA 4JT4A 2B7BA 3Q72A 4D26A 4DIDA 3KB1A 1VG8A 2WICA 1WRBA 4B71A 1B23P 2VP0A 1GNPA 1JECA 2BEKA 2GETA 5FL3A 4FWTA 4I1UA 3SBDA 4M1TA 2IYZA 2GXAA 4X8LA 2RCNA 1HQCA 3GLGE 1XZQA 3THYA 1UAAA 4DT1B 1NG1A 3D7MA 5AUOB 3K0CC 3JZAA 1N5KA 1NBMA 1G3UA 1Q1EA 3B6EA 2REXB 4LOAA 2WWWA 3O8BA 3SN6A 4B47A 1CRPA 4HB0A 4DEXA 4B2LA 1E79A 2WBLC 4HLUA 2IWRA 4QJ3A 4GZLA 1KMHB 5J4VA 2FSGA 4DCTA 4OQFA 1KI4A 4HAZA 3TUJC 4Z1MD 4GP6A 2N42A 1M2OB 4M9XA 5FPTA 5K8TA 4OJKA 4KHZA 5HKKD 4EAQA 4YMTA 2HT1A 3PUWA 4DCSA 1H8ED 4DHEA 2ZROA 1E96A 3WBKA 4DLSA 4JSTA 2A7QA 1O87A 1YR9A 4A6PA 1EWRA 1T91A 2IW3A 3L0IB 5KSZA 3ZD6A 4Z54A 2HJVA 3RRZA 4OQNA 2ZEJA 4PAMA 3A37A 5IRCD 2GXSA 1W46A 4GNKA 4V0LA 3CX6A 2GILA 3EG5A 1N0WA 2J7PD 4HI0E 1LB1B 1FPMA 1OLOA 3RWOA 3TRFA 2Q0HA 2GAAA 4TLEA 4PO8A 2IYTA 3FB4A 1ZD9A 4DDWA 1ODFA 5CDFA 2MMCA 3LX5A 1WXQA 1PLLA 4LJ6A 4BLOA 1Q21A 3RS7A 2NPFA 4LPSA 1NN5A 2JIZA 3THYB 2EWWA 3CR8A 4QFMA 3TH5A 2YOHA 2WV9A 4CEHA 4KLZA 4PAOA 1G5TA 2AX4A 4Q9LA 5LB4A 2BCGY 3AVOA 5IHPA 2ANCA 1OH8A 4NYJQ 1WQ1R 1XZPA 5DHFA 5KPDA 3NG1A 4U02A 2ZI4A 4M1YA 4WAUA 3RS3A 4PHTA 5FTNA 2LKCA 4QHYA 1UKEA 5EQTA 2VP5A 5UKDA 5FUWA 3L0SA 2QZ4A 2Q21A 1U9IA 2DWPA 2HV8A 4DCUA 1RJ9B 4LJ7A 4Z8YA 2FE4A 2VSFA 5G40A 3SNHA 4DLWA 4DSOA 1G1MA 2OAQ1 2F1HA 2O8CB 1R0ZA 3KQNA 3U61B 2WJYA 4QBHA 2O52A 3OHMA 1SVOA 4C2UA 1TQ6A 1F5NA 2NIPA 2IYYA 2WM9B 1E1QA 5JRJA 1JNYA 5JWOA 3DM9B 3UXMA 4BECA 2G9NA 4W9MC 2ATVA 4NONA 4ESHA 4ERNA 2N46A 1Z83A 2EU8A 4Q7JB 4TQUS 3OEEA 4PANA 5DHAA 3MJRA 3AF2A 3CKLA 3PUZA 2ANBA 2OFWA 4M9QA 2PX0A 1XD8A 3CH4B 4B33A 1TNDA 2QBYB 1N2CE 3SZRA 4DSNA 1G64A 3T1VA 2Q9AA 1VYTA 4BE7B 2IXEA 2IL1A 2WKRA 3NWJA 4HLDA 3MRSA 4JJKA 5EXXA 2ERYA 1AQYA 2BC9A 4PQYA 2PLRA 5DH9A 3A4MA 4R9UC 4LDJA 4Z1MA 4YMUA 2OE2A 3QJYA 4Q21A 3S1AB 4PZLA 1KDRA 1KDOA 2WAYA 4ACAA 2G83A 1CS4C 5KYKA 4AG5A 3BJIC 2OBMA 3IBYA 3VR2A 1R5OA 3IEUA 4LYJA 4OL0A 4LBZA 4BRUA 2CDNA 3KB2A 4CF7A 3TUZC 1ZCBA 2ZREA 1E4VA 1GSIA 4V0MA 5FBRB 4LBWA 1NN1A 4P4SB 2IEZA 4X8OA 1CTQA 1WMSA 4AK9A 2OESA 1WBBA 4X8HA 1HE8B 1TU4A 1U0LA 2ZU0C 5CB8A 1IXSB 1A4RA 1XF9A 2OCAA 4K8OA 3Q7QA 4H1UA 1E9BA 3AV0B 3HR7A 3RSOA 4UJ5A 3UATA 5DO9A 4AD8A 4LPKA 1IN8A 2EW1A 4NCJA 2QAGA 4FCWA 1NMZA 1Z6TA 4NBSA 1NP6A 1ZP6A 4OBEA 4Y0AA 3RWMB 1OXXK 1A82A 4JZKA 3TVDA 1R5NA 2GCOB 4JLKA 2Q9BA 5E95A 3EA0A 4A36A 4KAXA 1JEEA 2EYUA 5LD2B 2IYSA 3LO5A 2NO9A 2CNWA 4LSGA 4HB3A 2HT6A 5G53C 3U3OA 5JSZA 1U8YA 2JJ1D 1CF4A 3I92A 2WAXA 3SEAA 3CIOA 1OE0A 2AWNA 1SKYB 1KK0A 5FOTA 1FNMA 4PC2A 3MMPA 3O8CA 4LHXA 5JZVA 1E1RA 2GRJA 2IWHA 1NBME 2GZDA 1DAFA 3Q9LA 3TBKA 2GJ9A 4II7A 1T6NA 3BAFA 2C5LA 1ZCAA 4W7SA 2NZ8A 1HEIA 3SJZA 5JRZA 4OI1A 4LY6A 1GM5A 1YZUA 4XTRA 3VU9B 1AQUA 4L9WA 3PXGA 4QNRA 2MSDB 2QP3A 4F4JA 3WP1B 1DVRA 2W0MA 4A2WA 1R6BX 1HY3A 1XEXA 3OIVA 1GVNB 4E07A 2KSQA 4FMDF 2FX3A 3CF2A 2RH5A 3VAAA 2V8OA 2YWFA 1UM8A 1G5RA 2N1BA 4QGGA 5FOUA 1KNQA 4L16A 3TSOA 1HT2E 2CHGA 2F1RA 2P6UA 5CM8B 3GFOA 1QG2A 3N2IA 2HF9A 2KB0A 5JCZA 1DAHA 4Q4HA 3EXAA 1CP2A 3OAAD 4NCKA 4Q7KA 3K70B 2CCJA 1N5IA 1VG0B 4KV9A 4IDOA 5HE8A 5SZIA 5KU1A 3SQXA 2QL6A 4HLQB 5B58C 2WWGA 3GJ3A 2VSXA 2VQSA 3C41J 2QPAA 4NPHA 2QNRA 2XOKD 3VX3A 2ZRKA 2ZYUX 2OAP1 4ARZA 1CJUC 1ZNYA 221PA 3IGFA 4XD7D 1QRAA 2EVWX 2HXYA 1VYVA 3HU3A 2RGXA 2WVJA 4MGYR 5FL7D 5SZJA 5D3MA 3UWOA 4ASUD 1YRAA 4JLNA 2ZXUA 2A2ZA 4B3XA 2CK3A 4MYTA 1Z6YA 5FTJA 3WBJA 2QTFA 4PSAA 4FMCB 2VEDA 4GZMA 4P32A 4OQXA 3PENA 3IIJA 4URZR 1BH2A 3TQCA 4EJSA 5CB6A 4Q01A 4EPVA 3L2OB 3T06B 4DB4A 3RYTC 4MYCA 3NEYA 2H18A 1WB9A 2BWJA 2BBTA 5FI1B 3RC8A 1J8YF 4W5WA 2YKGA 4M8NE 4C0JA 2R6GA 3RS2A 2QMEA 3EC1A 5B64A 3VMFA 3KXKA 4NCNA 2PZFA 2REBA 3BH0A 1K5DA 2QPOA 1E3MA 2BCJQ 3W9YA 1XXHA 3ADDA 4M1OA 3AEZA 1HE1C 3U3MA 2FF7A 3KKNA 3P1JA 1GRRA 4GMDA 5B2ZA 5BYJA 5DI3A 5JS7A 5G3YA 1SULA 1XP8A 4FCTA 1U94A 4CEJB 4HAUA 4C0KA 1IN7A 4HDOB 1W5SA 3ASZA 4LJ8A 2FFAA 1YR8A 2QSZA 2DWQA 2WJGA 2B6HA 3GJXC 3TVTA 1E99A 1GWNA 5EP2A 2FPKA 1G16A 3A58B 3QBVA 3VFDA 4GOJA 1E2DA 1ZJ6A 1PLJA 5CK4A 1Z2CA 4OI2A 2IUSA 2ZRNA 4DSUA 5IK2D 1CIPA 2PT7A 2Z83A 3SU8A 2C04A 4NHOA 1S2MA 3I4LA 2FDCA 1E2NA 1XWIA 3GJ6A 4A0HA 1VCMA 4ZV4A 1GDDA 3A8TA 5H8WA 4AYXA 5KNBA 1II8A 3VKGA 3PJRA 3ZVRA 5FR1A 1VCOA 2ASEA 2WPDD 2CE7A 3EA5A 2YWEA 2XNSA 4AC9A 4LC0A 1DARA 4QBIA 1KHTA 1QDEA 3CRVA 1AIPA 2ZYTX 1E0KA 5JHHB 1Z5ZA 1GKYA 1KI2A 2RHMA 1P61B 2IXFA 4GL2A 1KNXA 2QG6A 4AYTA 3V9PA 2IUUA 3PEYA 2OBLA 1F48A 2F9LA 3VR4A 3QKSA 5GJWC 3GLFA 3B1XA 1F2UB 2DFTA 3TSWA 2YNMA 1OFHA 1KZ7B 4CT5A 5HPYB 4Q4HB 1G7SA 2V55B 2FFBA 1WF3A 5J5CA 3GJ7A 2I1VB 4OK6A 4EPTA 3DM5A 1FUKA 3K8YA 3R9WA 3U7HB 2G0NA 2VH5R 1XTSA 1KZGB 3BH6A 4HZIA 5SZKB 3TK1A 2IUTA 1PVOA 4Q19A 2CCKA 5AUNB 3NBFA 2XJ9A 3GLHE 2XX3A 2CJWB 3OFNA 4OKSA 4B44A 3FHOA 3FKSA 1PZNA 3FMOB 4M0LA 2Q9CA 2GHIA 1VG1A 2ZJAA 1U2RA 5FOXA 1E2GA 2AL7A 1WE2A 1X1RA 5ELXA 3GLIB 1US8A 3IDQA 4LZZA 4DJTA 4URVR 4HDCA 2QTVB 1E2KA 2R2AA 4NP6A 2GZAA 4D4LA 1U98A 3A4NA 5EP1A 2R44A 2ZI5A 4KODA 5FI0B 1XTQA 2AR7A 1NVVR 3B5JA 3ZQJA 3IO3A 3OIWA 1LS6A 2VF7A 2XTZA 4DLYA 4DLVA 4PX9A 3WYAA 4EIWA 2OO7A 2NPIA 1E9RA 1EK0A 1K8RA 3T1TA 4BFVA 1TQDA 3DKPA 4JVMA 4N1AA 1U8ZA 1COWA 4G5GA 2AKAB 1R0WA 1SXJA 1S3GA 2AK3A 4URXR 5EZ6B 2GBLC 4A0GA 3QXCA 1P2TA 3AF3A 3K0FA 1FL9A 4G0NA 3U6BA 1EWQA 3GLIE 3WMFA 3ZGXA 2HYIC 3N70A 2PL3A 5L8VA 3GJ0A 1L8QA 4NCHA 4PPNA 4OI4A 4FIDA 1KDTA 1Z8FA 2C9OA 4QOSA 3U4QA 3PFIA 2DFNA 1MO3A 3Q85A 4IFEA 4RJLA 3TQFA 2Q3FA 2B92A 4Q03A 1OKKD 4B3DA 1LF5A 5IK2A 4IDNA 3U44B 1ZM2A 4US1R 1OFIA 3OFND 4OK5A 5FPYA 1EFCA 1IN6A 1P2UA 2DFKB 1N6RA 5B57C 4DCNA 2WKQA 2IXGA 4GT1A 4LC1A 4Q9IA 5FBQB 3R8CA 4LYFA 3U7GA 1G7CA 4O0MA 2ZRLA 2LCFA 4XOIA 1RKBA 3U7FB 2YVUA 5KUTA 2WJJA 1QG4A 3RABA 2YOGA 1W47A 2ZJOA 2KE5A 4TYQA 4AY2A 3LH5A 3I62A 1JJVA 3AQ4A 1R8SA 4WZAE 1ZUHA 5EXTA 2F43A 1U99A 2WSSD 4M53A 4S2EA 4RZXA 4FMDB 3A1TA 1TL7C 4ZO4A 2KI5A 4E5UA 2IA5A 1G6HA 4XWAA 2JLZA 1NVWQ 3U3KA 4PHHA 4P0TA 3FYHA 2Z4RA 3EX7C 1X8KA 3X1DA 3THWB 3Q5DA 1RYFA 2B8TA 3ZZ0A 5C2JB 2GJSA 3HU1A 3U6KA 2JJ2D 3LDAA 3HPQA 1Q44A 2QAGC 1Z47A 1DG3A 2O8CA 1VMAA 1XEWY 5E7JA 1JQLB 3T5DA 4TMKA 3U60B 3PUXA 3F3YA 4MKGA 2OSBA 4AG6A 2OM2A 1S9HA 4FD2A 1KKMA 5HTKA 2WMOB 2JLUA 3CRMA 1WCV1 4FW9A 5AJXA 1GITA 1ZNXA 2QPTA 3L8YA 4YMSA 4KO8A 1JAHA 2GF0A 5FH9A 3GJ4A 3NH9A 1CKEA 1NBMD 4TQ9A 4MRVA 3NBYC 2ZVQX 3BRWD 4MRRA 4B3CA 1T4GA 4ESVA 1XRJA 3QY0A 1T3HA 3CNLA 3AVUA 3I61A 2IS2A 1YJ5A 5JSZB 2J0QA 5J4YA 5F2EA 1QHSA 4JKYA 2G88A 5EE9A 2JIZD 2HYDA 2HLDA 4D4JA 1M1YE 3ICQB 4HAXA 3WP0A 1JI0A 2QORA 2V54A 2NO1A 2TMKA 4ITRC 4D4KA 1OIWA 3QPUA 1HUQA 3GLGA 4B6FA 2BHRA 3AVPA 5DN6A 1II9A 3ZQ6A 4LUCA 5FOWA 1QHXA 1XTKA 2FN4A 4JS0A 4AYWA 1KSFX 2VYFA 2VHQA 4Q4JB 3E2IA 3AVVA 3VR1A 2PZEA 3AVQA 2AN9A 5GVRA 4B2PA 5K8UA 5DI9A 1LTQA 1TUEA 1BKDR 4URYR 3TNFA 4PQFA 1HT1E 1XFAA 2DYKA 2QE7A 3CNNA 3EZ9A 3LFUA 4YMWA 5DIFA 4A0RA 2NQ2C 3T12A 3ASYA 1CR1A 1DG1G 2VBCA 3VR3A 3ZIAA 5JHGB 4TSFD 1QBKC 4DDTA 1IXRC 2O8FA 4YDSA 4ZCIA 4IKEA 3CZPA 1CJMA 1Z28A 3IEVA 4FN5A 1BIFA 3U44A 2WIAA 3I3SR 3BB1A 1HURA 3LW8A 1AJEA 3L0PA 1LF0A 1OH6A 2WIBA 3SYLA 4AURA 2GKSA 2HLDD 1NL3A 3SJBA 3VKHA 2D7CA 2PCJA 3OIUA 3THWA 2VHTA 2A5JA 3F8TA 4D0LB 3AUXA 1OXVA 2VL7A 4KCGA 2C77A 2GESA 1GFIA 3VHXA 5KHOC 3TR0A 3BFKA 2V1UA 4O3MA 4B35A 3X1WA 2XXAA 5H1YA 5KSOA 2ZS9A 5JMTA 3PUVA 2X2FA 2A5YB 4LI0A 5FOVA 4BPBA 1E1RD 4F91B 1EFUA 2JDIA 4IOMA 1OXTA 5AWFC 3DMDA 1E9SA 1ZD8A 2XB4A 1E98A 2I4IA 3SHFA 2FU5C 3BORA 4I1SA 3TW4A 3OF5A 2GK6A 3UMSA 4I4LA 5AJYA 5TXGA 4WXPA 5LB2A 1Q22A 4GRAA 4I99A 3MGCA 2A5FA 3B60A 3FHTA 4G5SA 1AGRA 2DCUA 3GFPA 3ND9A 1SXJC 2D3WA 4OK3A 5IDVA 3E5HA 1GIAA 3M6AA 1JXMA 3SFZA 4TL7A 3RRNA 4QJ5A 3KL4A 3LQQA 2IX3A 2DBYA 4MDEA 2GAOA 3UG6A 2ZRBA 4C0SA 2CEAA 1YHNA 1UEIA 3ECCA 2ZPTX 5CK5A 4LYAA 1FOEB 5DN6D 1MO6A 2XNDD 1G8YA 4Q66C 1VYUA 1TQ4A 1TX4B 1VIAA 3P4XA 5L3RA 4DT1A 1E2LA 3MJHA 2JLYA 4ZDJA 1Z07A 4YQFA 1S1MA 4QXAA 1NIJA 3G5UA 4XH9B 3RVBA 4BFYA 1JPNA 3LRPA 2QP4A 1KO5A 4K81B 4Q1FA 3EZ2A 1F2UA 4Q18A 5G41A 3K70C 2EFGA 2RAPA 1UBCA 2VO1A 4M9SA 3EARA 2YV5A 4Q9HA 3IQXA 1VPLA 3TMKA 2OT3B 3X1YA 1COWD 2C9YA 3L8ZA 1QF9A 2KWIA 3VHLB 3U5ZB 1YZKA 5GADl 5A4JA 2PMDA 2D4HA 3CWQA 4RKEA 2AHOA 3IKJA 1G8FA 4A1FA 4A8JB 1Q20A 4DZZA 2GNOA 1GILA 2J87A 5IF9A 1LV7A 3BH7A 1X8JA 4PO9A 2OILA 4HZUA 2W2XA 2NGRA 4B3FX 2ERXA 1RRPA 1QVRA 721PA 2WWFA 4HAYA 4LV5B 1KDPA 5A0FA 1JEDA 3BXZA 2DB3A 2ORWA 2CMKA 5FUYA 1X86B 1J2JA 2VP6A 3FDIA 1L2TA 3IBGA 1YQTA 2ZRFA 5EP4A 2VHUA 1EGAA 3ZDQA 1CU1A 2FMXA 4BFZA 1BMFA 5CIQA 1HQYE 2W83A 1SVIA 1QHGA 3C4JA 2ZRCA 3QVUA 2ZI6A 2GCNA 1OT3A 4OHVA 4ZCMA 2JLVA 3QKRB 4V0KA 4V0NA 2OCPA 2IYXA 4ZIRA 2E9SA 1N6NA 5GJBA 3IILA 3GLFB 4FWIB 3CM0A 3K0FB 1ZM4A 2GVZC 4YDHB 4I1OA 2DHRA 5C1BA 4R2HA 2V4ZA 5L3SA 1NVUQ 4TYYA 1MABA 2JDID 1MR3F 3FPAA 4DB2A 3BFXA 4CGZA 4LV8B 1BS1A 1KJZA 5EUMA 1ESNA 2ODEA 4P4TA 2OEPA 3FFAA 3NBXX 3RAPR 3TR5A 4EQ6B 3ADCA 2W2TA 3BB3A 4EPXA 4HB4A 4JL5A 3MG9A 1F2TA 4UXIA 1FFHA 5JBQA 4PC7A 2MSCB 1DOAA 3ZS9A 4EKDA 4JL6A 1U81A 2H17A 1LFDB 2ZS7A 2EFHB 1SVSA 2FPLA 4M21A 1HV8A 4B2IA 4MA4A 2LKDA 1VHTA 3I5XA 4Q9JA 4G5QA 1OW3B 2IYQA 5LDDC 3W8NA 3KDSE 3WNCA 1Q3TA 2VIIA 4KYUA 1E2QA 1GAJA 5K8IA 3HU2A 4D0GA 1KAGA 1A2KC 4I1VA 1E0AA 2ZVPX 2ZRAA 4FMCF 3RS4A 3C8UA 5FPHA 4MYUA 3U3RA 3X1ZA 1E0SA 1XB2A 1IHUA 2WKPA 3C15C 3EPLA 3QEJA 3C5CA 5DGXA 5LD2C 2A5DA 4RKFA 3QXXA 2C95A 1SVKA 1TF2A 1Z6GA 1RFLA 4Q1DA 4LV6A 5FTLA 4RD0A 1TQ2A 4IEEA 2R65A 2R6CA 1JB1A 1QHNA 5AK0A 5DISB 4TT3D 3NC0C 3W8RA 4BRWA 3UK6A 1UBGA 4LHWA 4C0LA 2CLDX 2D74A 1EFRA 1UBFA 3ZVMA 1TUIA 3OEED 1UFQA 3ICEA 5FBVB 2AWOA 4P31A 1KK1A 2WPDA 2XZPA 3WNBA 1NF3A 4MGKR 3AKCA 1P3JA 1G18A 3EZFA 3EW9A 4NCIA 3BIFA 1Z0AA 4I81A 4ZPXA 3AUYA 3PUYA 4TQAA 4RFSB 1Z6AA 1TADA 1GNRA 3A1WA 4OJQA 1AS3A 4LGMA 4UXHA 3TGPA 1FQJA 3GFTA 4ZDKA 1XDBA 1BYUA 1UPTA 4JLPA 2NOAA 3QXHA 3K9NA 2ZSEA 2ZR0A 2GXQA 4JLMA 4KFSA 4ACBA 5EZ5A 1DAIA 5DI3B 3FOZA 4J0QA 2FEMA 1PUIA 5P21A 2X19A 1YRBA 1VECA 1ZRHA 3B7GA 4XIGS 2YC4C 4U5XA 4JLBA 2RGCA 3B9PA 1NMYA 1SKQA 1W5TA 2ZJZA 1Z29A 4ARZB 1GP2A 3P4YA 2B8WA 1ZM7A 3GEHA 1UDWA 3B1WA 2O0KA 4QL3A 1HTWA 3EPKA 1XCGB 2RGDA 3QKRA 3OEHA 2IT1A 1N6KA 1RRGA 1W4BA 3GMTA 2QT0A 1DAGA 1UEJA 3CW2A 3M4YA 4QJ4A 1GKUB 2CCGA 3Q3JB 2PZGA 3LV8A 1CBUA 5FFMA 4NYMQ 2ZAOA 3O8RA 4NZYA 2P65A 3K53A 3KFXA 1ZU4A 1MABB 3QEOA 5AUPB 3GLFE 3BGWA 2A3RA 2ZYVX 3AF0A 4YLGA 1RRFA 1G8GA 2QAJA 1XJCA 2F43B 2GCPA 3FMFA 4MRSA 3FKQA 3QXJA 1JJ7A 1FTSA 2ZTSA 5JWHA 1N6IA 3AP2A 4PHFA 3K70D 5KTYA 2P3SA 4LWZA 4Q7LA 5E7MA 5GVSA 2HEIA 3X2SA 3DZDA 4MUAA 2XAUA 1KAOA 3QSYA 4BGDA 4MRNA 2NO0A 2IYWA 4WA7A 3LXRA 4L9SA 1PV4A 3BE4A 1E2HA 3OE7A 2O8DB 4WVFA 621PA 4OI0A 2QRNA 3ZLJA 1VCNA 2QMOA 1I4DD 1D2EA 4LRWA 2C2HA 1Q12A 4UNPA 2AFIE 3EIQA 1G4AE 1E32A 1T9HA 2X1VA 1YR7A 4TZ6A 1UBEA 5KPJA 3EPJA 3KJEA 4NL4H 3CPJB 3W6NA 2DPXA 3K0EA 4DIEA 4LYHA 1FP6A 2QQ0A 4PAQA 2HF8A 2QM8A 4D2IA 3G0HA 3QKSB 1RE0A 1D9XA 4JKIA 4EFNA 2QA5A 3P20A 3KKPA 3UWKA 4ZDIA 4RVCA 3CWZA 3AVTA 4Q02A 1IY2A 2QAGB 521PA 4U7DA 4JIMA 5ANRB 3MFYA 1F2TB 5C46F 4KITB 1U0HC 4JLVA 4NTZA 1FZQA 1KKLA 3S1AA 1V43A 5C4MA 1EXMA 2WOOA 2XXAB 4W5HA 4UKDA 4AKGA 3MUFA 1XXHE 2EFEB 4IXMA 4P4UA 3LX8A 2ZJBA 4CEIB 1OB2A 2H8KA 2XZOA 3QQ5A 3RSLA 4M4SA 2ONJA 1EX6A 3UKDA 3K9GA 4W5JA 2YINC 5TARA 1KI1A 4KJZA 3W3ZB 4AKIA 1M7BA 4MGZR 2ZM5A 4LJ4A 4B73A 2CL6X 1AKEA 2PJRA 4PR0A 5DSZA 2J46A 4Q1CA 4F7WA 2REOA 3T1QA 2XZLA 5DYGA 1Z0JA 3VKWA 1FX0B 1ZYUA 3SS8A 4C0AC 4RD2A 2FFHA 3CF6R 5M04A 2BIFA 2RGEA 2W6ID 5JEEA 3QNUA 2CVHA 4JLJA 4TN1A 2WSMA 1TAGA 4KFTA 4C7OB 4RZ3A 1DTSA 1TMKA 1US8B 2VLIA 3ZJYA 1AN0A 2W6JD 4JJZA 4P4SA 2GBLA 1CR2A 4IVRA 1X3SA 1Q1BA 2FEOA 3BD9A 4TMXA 3VR5A 4DSTA 1ZINA 3KFVA 4R7ZA 4JL8A 4C30A 3ZIAD 2FNAA 2PH1A 4DKXA 2A30A 4IJMA 1RIFA 3B85A 3SQWA 4TYWA 2YWGA 4HDQB 1KI3A 1KSJA 2CVFA 4LJ9A 3ETLA 4M9ZA 1W2GA 3GLIA 4Z8XA 3PITA 3K0AB 3T35A 1OJLA 4F4IA 1CR4A 2R6FA 4QM6A 3THXA 3A1SA 4A4DA 3C14C 4B74A 4BZPA 1XPRA 4Q5IA 4LK2A 1OH5A 3AM1A 3MCAA 1AA9A 5DYIA 3GCGA 5GJVC 5JLJA 2O8EB 4OQMA 4F38A 4L15A 4V0ME 1GKIA 2H7VA 4LX0A 3I5YA 4MH0R 1P72A 1KJWA 4ZI2A 5BYKA 1GNQA 2J59A 2BV3A 3UMFA 1DAMA 4NH0A 4FMBB 2ECKA 3M1IA 5J40A 1R7RA 1MT0A 1D8TA 5KSPA 3NTUA 5E7IA 2ZYWX 1FQKA 2J0VA 2D2FA 3VTKA 4F4CA 1EG7A 1F60A 4BLSA 3MLEA 4JT2A 1YZGA 1ZNWA 4NMMA 4CEIA 2BOVA 4F93B 3FMIA 1IBRA 3W6OA 3PVSA 2XITA 2VA8A 2IF2A 4QBGB 4YONB 2E87A 3DPUA 3DOFA 1E9CA 1SKYE 2ZQ5A 3LQRA 1JR3D 2DFLA 3A36A 4TLAA 1XX6A 2VSOA 2B7CA 2WJHA 3B9QA 4G5RA 5TB5A 2B21A 1XTJA 4TTPA 1AM4D 3T15A 1G5PA 3G82C 2GJKA 5BQ5A 4RCYA 3DZ8A 3WHLA 4EJSB 5JECA 2FZLA 2HCJB 2ZR7A 1IXZA 4Q1AA 4CIDA 1E79D 4NYJR 3HPRA 1YVDA 1VG9B 3DHWC 5K8LA 1XTIA 1XD9A 1OV4A 5EE1A 1P75A 3VQTA 4GPTA 4LBYA 3SYKA 4A2PA 1W36D 4DVGA 1CJVC 1DE0A 3AKEA 1P9WA 1AS0A 1P73A 4HB2A 1UKYA 3TUIC 1NSTA 3AVXA 2D06A 1K5GA 4AKEA 1E6CA 2BMEA 5KO2A 2C03A 3AB3A 3J81k 1SGWA 3VU9A 4Z51A 3R9XA 2A78A 1FUUA 2ONKA 1M7HA 3GEIA 3LBIA 4XWKA 3THXB 1QVAA 4BLPA 4TMTA 3LVQE 2KBEA 2ZUDA 5TY0A 4A6XA 3DL0A 1ESMA 3CUEF 1W4CA 4C0QC 3LNCA 2VP9A 3AP1A 2W6JA 2ZJ5A 1FTNA 3LW7A 3R9IA 2ZUBA 3QF4A 4URUR 3C7KA 1UKZA 1XMVA 2FH5B 4ASUA 3B8HA 3IQWA 4IVPA 3CH5A 1Y63A 3KQLA 2QU8A 3QBTA 1VTKA 3EASA 3H2YA 4A82A 3CLVA 4QC2A 2O8EA 4E03A 1DAKA 4TMVA 4PZZA 5L3SB
chains in the Genus database with same CATH superfamily
4UPDA 5ISMA 1URPA 4TWZA 2H0RA 1R4NB 2PFGA 2UZIR 5LLSA 1XRQA 2ZI3A 3RUFA 4FHEA 1ULTA 4HWTA 4DMKA 4HDKB 1GYQA 1YRWA 2P9GA 2XYRA 4XFJA 2PKQP 4JZYA 3TIFA 3TNYA 1LLUA 1WMEA 4LRTB 3OICA 1QGED 3H6KA 4G5OA 1I3LA 4Y2RA 2JAHA 5IDXA 4N8EA 3IHWA 2QYTA 4OHXA 3BUSA 3EPHA 1U8FO 3W8FA 4Q4JA 4EWLA 1UOEA 3CX4A 3LJKA 5JBIA 1XRRA 2B36A 3U2QA 1JAZA 4J16A 3AEUA 2QSYA 4JVSB 3O94A 5KVAA 2PEYA 1DBQA 5GWXA 2VWPA 5EXDA 2CHVA 4CKBB 4WY2A 5AKYA 2QZZA 1BHJA 2QJFA 4HMPA 5HCIA 1XDGA 1KEZA 4CMBA 1XMJA 1KPHA 5EJ9A 4IIXA 4CDGA 3P2OA 3UOGA 2IEBA 2JI6A 3RC3A 3R7WA 5JXIA 1JQ3A 2WTUA 1RWXA 2C20A 2QQ5A 1XRMA 4KUGA 2AOXA 2YS6A 3QENA 5FNVA 1DIRA 5I4CA 2P6NA 4GYYA 5L95A 4W99A 2V5VA 2OV4A 1R64A 3ERCA 5AKIA 2P2DA 2R6AA 2I03A 1T2EA 5L7TA 2OBBA 2XY4A 4QHTA 1JXQA 1JXAA 2HC9A 4JT9A 5CXSA 1SEVA 4DM3A 1FB5A 2LP4Y 1UINA 3AHJA 3HM2A 2O8BA 3AM4A 4CDMA 3PWTA 3VNUA 4MW1A 4BFCA 1R0XA 3D3QA 2J5XA 3F0TA 4JUIA 3GFSA 4JYBA 1KEEA 2J5BA 4B34A 4NXMB 1DPFA 1RPNA 4KQFA 3URMA 2Z6AA 1ZD2P 4B3GA 3TTWA 4P7FA 4BKPA 3HN2A 4FE7A 1EWKA 3V4PB 1NXXA 4PZYA 2XDQA 1Z13A 2I65A 3CXRA 4KO1S 4AI6A 1QFZA 1AUXA 5L3QA 3FVQA 3WTCA 3EXFB 4C04A 3JVEA 4MDFA 4Q3OA 2IYEA 3CONA 4TTVA 1ZK3A 4JQOA 1NAIA 4G01B 2V4MA 3VPAA 5CEJA 2H51A 1G6OA 1E6UA 1YK0A 2LUOA 2QN9A 3V9AA 3V4RA 1K7XB 2GEVA 4KH0A 3ZDFA 1WZ2A 3AWDA 3EC2A 1E9EA 1ZGJA 3IESA 1WUYA 3K5IA 4DS3A 2IHVA 4ALMA 3C3DA 4BLWA 4BFWA 2ZRPA 3TLYA 2NYUA 1XDUA 1M6NA 5TGZA 3R6LA 3UC5A 2HKIA 4YXWD 4UM8B 1OI4A 3EVBA 3JQQA 1Y42X 4PVCA 5BV0A 2MSKA 5JI3E 4MIOA 3DNMA 2BMJA 2PX4A 4AKSA 1WU7A 1N5RA 2H57A 5BUQA 1Q2XA 4HDMB 1Z56C 4JJEA 5I5EA 1FJHA 2ZWMA 2CJXA 4MQMA 1ADFA 4YO7A 5EN4A 5LJIA 3PQ5A 2JHAA 2SBTA 2R7AA 3UA4A 4PC6A 1PYDA 2P5UA 3QF4B 4YJ2B 2X0IA 1H05A 2YWHA 1HETA 3Q7PA 3ZI4A 9GPBA 2Y05A 3UMRA 3WKBA 4NJEB 2P2CA 4LXYA 4UE2A 1HWYA 1T8TA 1MRNA 3LDHA 1T0HB 4PGGA 2FSVC 2HK8A 4ONEA 3ZI7A 3ZJVA 3MTAA 1JGTA 2YDXA 2BM0A 1ZDMA 3ND6A 3QHPA 4QGHA 3P2JA 4E21A 4GNRA 1GTVA 2VYVA 2FZ4A 4ENTA 3CPHA 2HXSA 3PEUA 2H52A 4BVKA 3A70A 2ZRDA 1YB4A 4XEUA 3SICE 4YNBA 4YFYA 3QX7A 2BI8A 2N1MA 5CFRA 4EPRA 1OI2A 5BQ3A 1S0UA 1KMCA 2V7GA 2C96A 2Q0QA 4TZKA 1OYWA 4ZREA 5IKPA 4CM4A 3AY6A 4RA6A 1UAGA 3TECE 3U4QB 1JFFB 1Q83A 3WMGA 5CDUA 1LJUA 3L02A 3CBQA 4M7WA 1E2FA 4DR6B 4DIMA 5DXFA 4MWGA 1GPYA 1L7DA 2J32A 3NHJA 2CMFA 3REFA 2BDEA 1ADJA 4L4ZA 1VGVA 1FJGB 3BWXA 5E6UA 3HCEA 3WLTA 4L8WB 5M34A 2CJYA 4X3OA 1DZ3A 3PVZA 1QO7A 4P3XA 1SVWA 3S40A 3NAGA 3WXMA 4C3ZA 4RH1A 4TTSA 4WLFA 3T5AA 2BL4A 2WF8A 4RTLA 1SXJD 3TD9A 3HMKA 3UQYS 1O5TA 4MJLA 4RMIA 2FPIA 2D1YA 2J45A 4JYCA 5TV2A 4E13A 3EIEA 1VMDA 4X91A 2GWHA 4R2IA 4XSVA 4JR2A 1DRWA 4AZWA 3B3AA 3AVWA 5FIUA 2O3SA 3L8HA 4WXYB 3WS7A 4MARA 1W2WB 4BP8A 4K9OA 3RV3A 1O7JA 5CEEA 1ORTA 2I33A 3DEIA 1BVYF 2C2GA 4HNUA 3DXXA 3ANYB 4L6AA 1E3IA 2QKYA 2R6JA 2B4YA 1PJZA 3QI7A 3RVPA 1L4UA 2UYOA 3TIIA 1JR3A 4FBMA 4NYIR 3RTGA 3RQIA 1LBQA 3CIFA 2X7XA 3PPVA 1IZYA 3Q8XB 1G8HA 2NSLA 4KO2S 4QX6A 1O94C 5B1HA 5KOYA 1GRNA 2F1IA 3GGJA 3N2LA 3NCHA 4IHQA 1MJGA 4M38A 4MKHA 2CK3D 1T1GA 4R7GA 5I4BA 1LLQA 4BEBA 3HM9A 2C57A 2QEQA 3QIAA 1ZL2A 4EM6A 1EUCB 4M0CA 1N2ZA 3K1TA 2EHJA 3BMOB 1SVMA 1S7GA 3RT1A 2NO7A 4CF3A 5K0SA 4GR9A 3DWGA 3UV6A 4AUMA 2P9ZA 3H0KA 3NYWA 3ASVA 4YRPA 4MVJM 5K3AA 5AD1A 5KDDA 1MIOB 1WNFA 1E2PA 3KEOA 1ZN7A 2PVSA 3R5KA 4FNGA 1U7ZA 3ZWYA 2Z43A 2Q4BA 1EB9A 2R4TA 4JMLA 4B3SB 2IHYA 4Q48A 5TIIA 1HDRA 1PR2A 2XCTB 2HJ9A 4GUDA 4ZC8A 3AZQA 1EFTA 1U4OA 2NXWA 3ZWCA 3ZJUA 4IIHA 1T3SA 1JHQA 1T43A 3A1NA 1K9SA 1FU8A 3BWBA 3OHSX 3P9IA 4D9EA 4DYVA 5J4HA 2IEAA 1UT5A 1NIPA 2JZOA 1PQPA 2QN7A 1D4OA 4EBFA 2VRCA 4G23A 4D3ZA 4ETMA 1M1ZA 4N0MA 1KEKA 3JAKB 4RTOA 4PVDA 2IRWA 3RUAA 1KSGA 3A05A 2VPPA 2HTFA 4LC9A 2QY9A 5H02A 2XTJA 1XP5A 3PIRA 4TMZA 4X7MA 5ENZA 3SQOA 4BRSA 5BXQC 2EP5A 2GFIA 2PUEA 1G3QA 1Z0DA 2C8KA 2PZJA 3MERA 2JA1A 3O0TA 3B82A 4MW0A 1J22A 4JI3B 2RH4A 1RVV1 2A9FA 3ELUA 2IBTA 2JFNA 1A8SA 4UFOA 3GMDA 1EESA 1N1MA 2VJPA 3HWWA 3G8AA 3DBOB 4WZBA 1USKA 4DM4A 2QU7A 1O8BA 2QRQA 1RVDA 3PL1A 5FFNA 3ANNA 2BSXA 4IS2A 4DC9A 4GRDA 2PKXA 4R3NA 2QTHA 5HKLA 3OY2A 4IIDA 4CQLA 3ML1A 3T3IA 2PKWA 2JJ1A 3AR2A 3ZR4B 1G21A 1ZWLA 2ZB7A 1XA3A 4AICA 1F9AA 3MJTA 4GGMX 3CT4A 4LBVA 1MV5A 1N0UA 1E5DA 2WKWA 4IGIA 2R25B 3DOEA 5CH5A 2BBOA 3LYLA 3RROA 3TL3A 3IPCA 1G5FA 4Z53A 1EX7A 1JIKA 1NR1A 1TUGA 2QVXX 3KUXA 4RVDA 4EKYA 2DVMA 5JCPA 2JGMA 1L5MA 1U7XA 1DHTA 5CT8A 3W7VA 3BQMB 4Q82A 5IT4A 2ADOA 2CFTA 2EQBA 3KOXA 4YRMA 1NI5A 3EC7A 1NP3A 2AOUA 3CEAA 4L27A 4AS1A 4GMXA 3ZZUA 3HADA 3D64A 1T36B 3FKSD 5KYXA 1J07A 1EFHA 2J08A 3GAFA 4ND7A 3V4FA 2ATIA 1CB7A 3GG2A 3T9BA 1C30A 4O4JB 2R1TB 3L82B 5L4NA 1DGQA 3IB6A 3CVJA 4Q4AB 1MW8X 4LZNA 5ITWA 3L0OA 4M8LA 4J4HA 3QA3E 4KHPB 1R10A 2OCXA 4B4WA 3T95A 2AJLI 5C37A 1YKSA 4N01A 4J0EA 4D9MA 3D8UA 3H3FA 1C1XA 3ST7A 5CBPA 1HNZB 3LHFA 1NVTA 2CHQA 2Q2QA 3LLUA 3R9KA 3WYGA 1VDZA 3BMNA 4KWTA 5K9ZA 2PGAA 1CEYA 2FZEA 3FWYA 1XAHA 3RGWS 4F2HA 5AI0A 4BGUA 2R79A 1JI3A 4MLPA 1EA5A 1XJ5A 2PHZA 1LK7A 3B5EA 3JYOA 3TS1A 5FOQA 4HQFA 4KUEA 3CCCA 1KK2A 1GV0A 1WA5A 2FOLA 1NZJA 1Z7WA 3CC8A 4WLEA 2IEDA 4BFTA 5C18A 4DV4B 4TLCA 5K6RA 4KAAA 4MV7A 4WBNB 2P0AA 4P08A 3VGJA 1M7GA 2BI7A 3BWEA 2QM3A 4X1KA 2HGZA 5AKKA 1QIMA 3H1TA 1BU8A 1Z6PA 1A7KA 3AB7A 3QW4B 1IY0A 3RLFA 4Y6QA 1XZIA 3RREA 1H8HA 3DONA 2W6IA 3UEOA 1XMSA 4FS8A 2QRMA 4X61A 1PRYA 4WNAA 3IVAA 1E4YA 1GZ6A 1V0JA 1TYZA 2HNKA 2I3DA 2I2FA 4MI1A 1UPAA 4ER5A 3QPVA 1VPDA 1Y5LA 3C5HA 4IOLA 4DG9A 1RRCA 3E8MA 2IF0A 2B8EA 2C2BA 4NJMA 1DKUA 5AP9A 4B45A 5A2QA 5IVPA 3V00A 4C0HA 3E3MA 4OYYA 3TE6A 3ZWNA 2IHBA 4DWJA 1YZQA 1A8IA 2CBXA 3MWDA 3OWXA 5JADA 3GJZA 2Y27A 4ZYYA 4FFMA 4K05A 1R8YA 3GXBA 3L5OA 2H92A 2PUWA 2QD5A 4H7EA 4PQRA 1U2TA 5JARA 4IH1A 1OFTA 1PFYA 1L1RA 2Y1XA 3VGPA 1O95D 2P0EA 4NY1A 4TLBA 3F6RA 3TQTA 3BRQA 2YIJA 4R0NA 5T4BA 4BVJA 5BPHA 3CLTC 4B85A 5KMGA 2FG5A 1IBKB 4S04A 4DNOA 4E5DA 1VA5A 4B76A 1Q0UA 4IWXA 1MA0A 5EMNA 2WUVA 4ZQEA 3BMOA 4ILEA 4XVRA 4IDAA 5I7UA 5AK4A 1N4DA 1W0KD 5EUCA 2HPZA 3P97A 1U8AA 4REQA 4QDTA 5BR7A 3CF4A 1N0IA 3WWDA 3AKYA 1DKOA 4YAUA 2QUAA 3N5CA 3AEQB 4E51A 1IN4A 4MGIR 3SNHA 4YR9A 4FFSA 5FNZA 5BVGB 4W7IA 1G21E 5ITVA 3U7EB 1Z4PX 2XD9A 3O8LA 5ITZB 3H0CA 2O8BB 2O0HA 3G2LA 4EJFA 2RGAA 5KX5A 4P7JA 4DRZA 4W5OA 2V45A 1Z0KA 3BQNB 2W2OA 3QLVA 4XWOA 5CXQA 3A4LA 4CW7A 1IWPB 2JEYA 4AMZA 3HR8A 4HSEA 3PP8A 1R3DA 4MITA 2VBGA 5IKMA 3CF0A 2PEZA 1OZGA 3DBHB 3KJQA 3UFBA 3G3EA 1TT5A 1XA4A 1DO2A 1BA3A 3PNPA 4GHWA 2AXNA 2VTBA 4DMGA 4YRAA 2ZAMA 4C20A 1UBUS 3FPLA 2R6DA 4HS9A 3SX4A 2HLNA 3W90A 3T7DA 2VYQA 2B2NA 3MS7A 4PRKA 1NN0A 3EIXA 4MQEB 4TV9B 5FD8A 4RTJA 1GUYA 1Y9AA 4RK1A 5IKEA 2QQEA 3ESZA 4E0BA 5E1DA 2AR0A 1UDXA 2ZI9A 3Q3IA 4YH1A 3BD8A 3W1EA 3ZZNA 3O3OB 3VKVA 2O4CA 5HFNA 3KJXA 4O4LF 3NAMA 2BBWA 1AKMA 1KJIA 2V6JA 1T5IA 4RIIA 5AW2A 4GDFA 2Y1OA 3D6FA 1YIDA 1FYVA 1MHPA 1N2JA 4HUJA 5EAIA 1YS7A 4O08A 3PHJA 5CYFA 1BW9B 1J1ZA 2QGNA 2VLBA 3LL7A 3H7AA 1TLLA 2XNDA 5EQDA 1KAEA 1B2LA 2BKXA 3E35A 4PAWA 4PO1A 1JLLA 2EG5A 1X1SA 3P26A 1N25A 1WCIA 2GEBA 5GJCA 3SJAA 1HLPA 1NNUA 1WP4A 4CIYA 4AF7A 1VL8A 2PLFA 3CPEA 3DC7A 3IT0A 2GUGA 2P67A 1KQOA 3QVSA 4QGFA 3DMRA 3ZY5A 4XD2A 4R71A 5BMVA 2RHHA 3SSNA 4QM7A 1A04A 3LQYA 1G8MA 2Y1WA 3VDNB 5ALDA 1CUYA 3SVTA 3NUGA 3MYYA 4I08A 1P1JA 2XZTA 4HTAA 1H0KA 5IZCA 2RHWA 1TKBA 1O5IA 3PC6A 3G02A 4CRWB 5JD4A 1B76A 2YHUA 3HVUA 5LQDA 4U2DA 4MP3A 2AN1A 3AOGA 1ZUNA 3F67A 3LCCA 1R66A 2XQIA 4PYLA 1DELA 4WZZA 3VR6A 1Z8HA 3TAXA 1H1TA 2R62A 4Y1RB 4KI7A 3LT2A 4WH0A 4AP6A 4IQFA 1BA2A 2E1PA 3SOPA 1SUBA 1IZ8A 2GGSA 2JAPA 3GQBA 4I9GA 3A31A 1XVVA 3KR9A 2ZIEA 2IYVA 4RH3A 1Z4KA 4MS1A 1KK3A 4PINA 4QVIA 4JLOA 4KQ9A 1JEQB 2YYZA 2WTNA 3EPPA 3Q88A 2IZ0A 2JH8A 3CO0S 4TM8A 2M6LA 3W2EA 1X8XA 5HGXA 5HZMA 2B61A 3EVCA 3ZV7A 1ZW6A 1NJ6A 3CLRC 3I8SA 4MCIA 1TXGA 2ZIUB 3STTA 1JDZA 2HPVA 5JOQA 3QOXA 5BN3A 3GVPA 4QGSA 5JAPA 4DKJA 3PG5A 2J9RA 2ZYIA 5MGNA 2BH2A 4IO0A 2OFPA 1Y80A 5ADUS 1NF2A 2WAAA 2JIPA 2RDMA 3EWAA 3M8KA 4PYRA 5CB4F 1WLSA 1F8YA 2FGJA 4B75A 4CCYB 3LBYA 1XXHB 4X97A 1MIHA 2PV7A 2VYND 3KD2A 4F56A 3KKOA 1YV9A 4M60A 3A3PA 1L4LA 4JMPA 5JAMA 3AKZA 3NUZA 3ZZMA 1RRVA 4IBOA 1SRRA 4Q6WA 3WRXC 3E1SA 4BNJA 2O8FB 1REQA 5IUKC 3M7IA 3TZCA 4XYMA 3W05A 1D5CA 1NLMA 1X1AA 2VXBA 3X2EA 1Z0SA 1OGYA 3CGGA 2LD4A 2ZYRA 3L4BC 3K20A 1PDVA 3K6RA 1RPZA 5K3CA 1UKCA 3GYGA 3FLMA 4HJXA 2BBSA 1WXDA 1U7DA 2FXIA 2VN8A 3NBMA 3UC9A 4MUKA 2IP4A 1LQTA 4J1SA 1NQOA 5AVXA 1ZM9A 3RS5A 1TMYA 4Z4QA 2ZT6A 5JV5A 3FPGA 4DPLA 1YJQA 3JVDA 3NJRA 3AUKA 3RIXA 4EUNA 3UMJA 2BGMA 4KMSA 1G66A 1R0RE 5ALPA 4JJ7A 2JBAA 1Z2OX 3F9IA 1VJGA 3RG8A 2ZU6A 3K1JA 1U63A 3GBPA 4YACA 3F7NA 1XKLA 2YDYA 1N0VC 1JLRA 1SBNE 1UK9A 2YJ5A 3BXOA 4Y2QA 3VKHA 4B6PA 2Q6IA 4Q4CA 1NQVA 1YO6A 2C99A 1L7RA 3H9GA 3BSSA 4Q4LA 3I12A 5EKSA 5EJEA 2F8TA 1W2HA 2CXXA 1Y5RA 1W93A 3DYBA 5CVVA 5LUBA 3W8DA 4LECA 3B13B 3QF7A 4YBRA 3IL2A 1II8B 1JDNA 4JVNA 1G20A 1FLDA 3PFFA 4Y2VA 1X1CA 4MS3B 1O6ZA 4HXYA 2XQFA 3RIYA 3A6ZA 3LUAA 2PYIA 2P9BA 3HBJA 2UZ3A 4MB2A 4QKQA 5JH7F 3CRNA 3T3MB 1KVUA 3EFEA 5HZHA 3GLHA 3OLWA 1RC0A 4NFHA 3LDGA 2WZQA 3ONWA 3P2KA 1QRRA 2CUTA 4NU8X 1DDGA 2W4QA 2DECA 4OOFA 3EQ8A 3SX0A 4RFSA 2OFOA 1I7LA 5B3LA 5A3VA 4RD6A 2H0AA 1KY2A 3B6MA 5LBIA 4OLBA 3EIFA 4ZXFA 3GR6A 1E7WA 2VOEA 4KIGA 5JQGB 2HJGA 1B8NA 3NTLA 2MSEB 1HA3A 3KZXA 3B78A 1P7ZA 3OO0A 3ZHQA 5TMPA 1ID8A 4YC7A 4B7XA 3PV0A 1E8DA 3A9CA 5F76A 1WSAA 4EVQA 3ZXUB 1GTL1 1FMLA 2PA3A 1GHTA 2WHPB 2Y6UA 3K4QA 1TJYA 3CLUC 3OQPA 3PXUA 1R5BA 4FLEA 4N0EA 4RHUA 2V3VA 3OKAA 1NY6A 1IE3A 1SQ6A 5FP0A 4A1OA 3NHPA 4QYXA 4F84A 3GVCA 3RK1A 4EDFA 5JUWA 3MUOA 1O6BA 3EGVA 1XJ0A 2H1FA 4DBLE 1JA9A 2PMCA 2AFHE 2NX2A 4YIKA 5BNWA 5EQFA 3MGAA 4OU5A 2R96A 2ZSKA 5GQSA 2Q3BA 4D8XA 4FB5A 4S24A 4EA8A 1XCLA 2CJWA 2GHRA 3VR6H 1UBHS 1L8LA 2ZSDA 4FFBB 4HWRA 1CDOA 1E3WB 4UNQA 1SFRA 1NHWA 2AQKA 2E7ZA 3VYSB 4QZVA 1QQ6A 5KI6A 1FQWA 2FPMA 2IPMA 2G6TA 3DW3X 3BE8A 5HCNA 3TQOA 1VXRA 5FBZA 5BQXA 1TK9A 3DWIA 3RSHA 1E5XA 2FPOA 2JGRA 4EKIA 1QF7A 3WJAA 1ZSNA 4WUVA 5DCUA 2QUZA 2P1RA 1R9MA 2MCFA 2A4MA 4DTCA 1NN3A 4A9AA 2MOKA 5A3QA 3FM9A 4OPMA 4AX4A 4EB6B 1SB8A 4QUBA 1W5EA 2AHRA 2QV7A 3DVQX 4M83A 5K01A 2Z30A 5EINA 1GY8A 4G5YA 4R40A 2XYQA 2I2CA 4H17A 3U4GA 2Q2NA 4URWR 3RRMA 2V9PA 3HCAA 4HYTA 5DMHA 1NXVA 4PG7A 3GA0A 5J4LA 2CD9A 1VSBA 5H68A 1SXJE 5FTMA 2QN3A 1V7CA 3LBHA 5CAEB 1ZOIA 3HQ4O 2PS1A 2JLQA 5IAOA 4FQ8A 3VDXA 1GQSA 3K0SA 5E4FA 5TSDA 5DHRA 1K8QA 4MUBA 1E1QD 1KY3A 1E62A 1XEFA 1KZYC 1PD0A 1UP6A 2P9TA 3FTQA 3I4FA 3M3PA 4BQSA 4WN9B 1QP0A 2D6FA 1YRLA 5AT1A 3M4XA 1YRQA 1N5OX 3FYSA 1I7SB 2NT4A 4KK3A 4WJKB 4X1KB 5ELLA 4HZUB 4C43A 3OQVA 5TQ0A 3GXOA 5TF4A 5HQ3A 2VQFB 4Q34A 2QTWB 4RS4A 4XJXA 1NDHA 4TQGA 3TLGA 1C8BA 2JLAA 2ZJ2A 4KOAA 1RZ3A 2JJ2A 2NACA 2YMLA 1I1QB 3Q1LA 4FXPA 4WFKA 2O2XA 4H6XA 4D0NA 4UM9D 4L02A 1XTPA 4FEGA 4K46A 5CNMA 3H5IA 3T3NA 1RJDA 1IY8A 3BKXA 3W7BA 1U9JA 3AFOA 4NJMB 4WI1A 1K6XA 4QBKA 4RVSA 1W73A 1A4XA 3EDOA 1A9ZA 5E1MA 4GOXA 3E8SA 3WDLA 5LSAA 4RTKA 2BTEA 4Z7OB 3U7RA 2GNPA 1E1CA 1GZSA 2ZUFA 1KMQA 2AFIB 3C0KA 1G8SA 3LRTA 2F3RA 3ZJ5A 4IUDS 4C7VA 2V0NA 1DAPA 4ANFA 1TVMA 4UQPA 2X77A 4NXNB 2MYUA 4ENSA 3AF1A 4OSPA 3PNQA 2GRAA 3MW8A 1A5TA 3E7DA 1F2VA 4LNUB 5G0WA 4D5EA 5HKKA 3ZPXA 2PH7A 1SQGA 2P6MA 2ZIAA 3AFMA 3DFFA 4DW8A 5AVVA 4NJEA 3CNOA 2QLJA 5BSEA 4C7JA 1WUTA 1EXWA 2WIFA 1YNOA 1QMPA 1QQTA 5ALEA 3BCRA 1EFVB 4WVLA 2EW8A 3AIKA 4WZ6A 1XTRA 2PRKA 2OD9A 3AUFA 1JG7A 4KR7A 3DBHA 5ESDA 1K98A 2WYHA 1K86A 4IW3B 4R1MA 4WOPA 4OX9B 3M6UA 2PO7A 1HMYA 4OGGA 5AUQA 3T9EA 1T0BA 1CC1S 5HMLA 2QM7A 3QU5A 3RK0A 4TS9A 2XTMA 4ZEWA 4K9DA 4EATA 1H3FA 1RXUA 2PFKA 3HSYA 5KYUB 2PSHA 2ZBVA 4URFA 1PCXA 4EMSA 3WMEA 1KGSA 5C7YA 3P94A 5KX5B 2VHVA 1PJRA 2PLWA 1A8HA 2NG1A 3V97A 5EXPA 3UG7A 3FMPB 1UPUA 3OMWA 5D3ZA 2ODPA 3HBLA 4RGVA 3E3OA 3N58A 1GFWA 3F1LA 4K9QA 5D1NA 3CVVA 3HB9A 1YQQA 5ER9A 1VIYA 2LNDA 1I1NA 1W48A 5HRCA 1DADA 4W5TA 2BJVA 4HLUC 2WG0A 1XO1A 1WZUA 1P4SA 4XFKA 5B30A 3T5MA 1X39A 2B5WA 1UK7A 1JBKA 4H7KA 5IMBA 3ZX5A 1ODLA 4S3MA 3OC0A 3QY9A 1LBTA 2VDWA 1JDSA 3RIEA 4DLXA 4EHNA 4JI6B 1JEYB 3GRFA 4ZO7A 1I2MA 1NFRA 1TJNA 1ZH6A 3E7WA 3EY9A 3U7QB 4ZKEA 3WQRA 1UFOA 2CBGA 4AROA 1EDZA 5KNBD 1O3YA 4LJ5A 4BNZA 1E3WA 1I8TA 1R8XA 3KTAB 3NKLA 4RGYA 1RCUA 5FUXA 3S28A 3VSEA 1FFDA 4DREA 2W6CX 4XR9A 3BE5A 4ZXPA 6GPBA 2OZPA 2Q4RA 4UTXA 3ILSA 2DKNA 1PV2A 4XWTA 4L5IA 4MA0A 2DY1A 1ZMXA 2AC2A 1RLIA 3FPBA 4YP0A 5DK6A 2W2MA 4QREA 4C0BA 1XOIA 2X8WA 3P9XA 2BEJA 2ZWPA 1HM5A 2H3EA 1P2SA 2MMGA 3NVAA 1CRQA 1YZFA 4JFAA 2OYRA 3WB2A 4CXMA 1Y1PA 3DMTA 3L7JA 3N86A 4KO4S 3NR2A 3Q0EA 5LQSA 4AG3A 4L5BA 4ZT7A 1D6NA 1DEAA 2Z9CA 1N6OA 4GBED 3TFQA 1UCFA 4AWXA 4DG5A 1L7OA 1XZKA 4LGCA 4X94A 1ZD1A 3T7CA 1PK9A 4CT4B 3GT7A 5FUQA 3F90A 2CVZA 3G13A 3VSBA 5HR5A 3U4DA 3RV4A 1FXWF 1V7QA 3EHDA 1E0JA 2WC1A 4IILA 4L3WA 1XMXA 1KC1A 1Y7PA 2IQ5A 3O3NB 2IFTA 2WWIA 3QG5A 1KBZA 1HE2A 2RARA 4JUDX 2JFGA 2FSFA 5CUQA 4CE6A 4EJSC 1JKXA 1W6UA 2B7BA 3LLVA 4RE5A 4OB7A 5ECWA 1VG8A 4JP3A 2DFPA 3KTFA 4PGFA 3SQLA 3PJEA 4F8EA 2UYCA 1WRBA 2BGJA 2RJNA 3GN1A 1Z0UA 4HGQA 4J3JA 4QRDA 2GETA 3EIWA 4I2NA 5HA5A 2I2WA 2P7HA 4OUDB 2C4VA 5CA1F 3SE7A 2ZIVB 1EJ0A 3L93A 4M0FA 3SMVA 4ZOCA 3DOUA 5AUOB 2MDTA 1M2VA 3K0CC 3ZCXA 5K45A 3WBFA 1U4NA 3HP7A 4NG4A 2REXB 2WWWA 1XHFA 2GD1O 4NWIA 4OBWA 4HB0A 3ZLBA 1UKBA 4D0SA 3TUJC 4Z1MD 1E6KA 2J3MA 2X9GA 2Z2KA 3MAGA 5FPTA 1T6BY 4OJKA 3IEPA 4RIHA 3KTOA 3GFGA 5D00A 5E3IA 5EKUA 5B1SA 5I7HA 4PTYA 4DCSA 4K88A 3U3XA 2XKJE 4R1TA 2NUAB 2HNBA 3DPIA 1XTZA 2QI9F 3EZNA 4AUEA 1J06A 2HDOA 4R83A 3TLCA 4A6PA 3L0IB 1AOXA 5CLIA 1Z2NX 2HJVA 1JILA 1Z9BA 3KV3O 3CN7A 3I4CA 4PAMA 1GTZA 2D59A 3A37A 4MUXA 1ZIXA 1NYLA 1L1FA 3B9BA 4L1KA 1GSOA 4L8YA 4V0LA 2BF7A 3VO1A 2CNOA 4DOMA 4FYIA 4RFLA 1NJ1A 2GILA 5ARCA 3WA6A 3EG5A 2J7PD 2EKDA 5ILGA 4IDCA 1QMGA 3DFMA 1APBA 3OHPA 1OLOA 3FJYA 2DUUA 4PO8A 2FKAA 4J6FA 1UMBB 3NZEA 5CDFA 3GGSA 3LX5A 3RVQA 3WNZA 4LRSB 5KVVA 2NPFA 1KORA 4LPSA 4GQIA 3G9XA 5JZ9A 2QTCA 2VNIA 1T4CB 1BRTA 4QFMA 4KNWA 2YQZA 2YOHA 4PYKA 4C08A 4G89A 4KLZA 4D9GA 2AX4A 2XH8A 4JN6B 3ODGA 4Q9LA 4KMRA 2C8LA 4N3GA 5H5JA 1OH8A 1Q95A 2H9YA 3H2JA 1WQ1R 4RBNA 1S3FA 4IKPA 3L0YA 2ICAA 2V7PA 5ERXA 4ND4A 5KPDA 1CZUA 4DXDA 1ZICA 2ZI4A 4LZAA 1C4KA 4UVGA 1XLWA 3A1DA 1LI4A 1RSZA 3ZWAA 2Z9BA 3Q2KA 2IE8A 1XWWA 4R8KA 5AJTA 3R7DA 1FLNA 3AJ9A 3C87A 4LCEA 1AQ6A 2VP5A 3VNRA 4HVTA 4KR2A 1WZCA 5UKDA 2PJDA 1YQEA 5FUWA 5A0VA 5L51A 2QZ4A 2NNLD 4IH9A 5DHQA 5BWNA 1GCGA 4DDHA 2FX5A 2HV8A 3Q3EA 1EE1A 9LDTA 4WGFA 3HDQA 4LJ7A 3OOJA 4FDAA 3RU7A 3A32A 1G1MA 4GW3A 1NJ5A 3ITNA 2F1HA 2O8CB 3O03A 2Q49A 3RAFC 2F90A 3U61B 3E22A 4LRXA 2OBYA 2CXOA 1GYRA 3F7MA 3OHMA 4II2A 1NONA 1EJBA 2NIPA 3C6QA 4IJ5A 5FB3A 4ZVPA 3W5HA 3WLOA 1YF3A 1LDNA 1JB9A 3HR4A 3UXMA 4QUIA 3DL4A 2V7VA 1A8PA 1BJTA 2ATVA 2Q5OA 4EG6A 4ESHA 5AHWA 4ERNA 4BMNA 2RE8A 3OP4A 2N46A 5AHOA 4Y6RA 1V3QE 3GA5A 3WLQA 2DUMA 1IC6A 4AZSA 4TQUS 2M9MA 3OEEA 4PANA 1RXVA 3MJRA 3RIMA 4DA6A 3R0JA 2ANBA 2OFWA 3VYUB 1TYCA 2E6KA 2XMBA 4GZ6A 2NUTA 3V3TA 5TPWA 1CUFA 1DBIA 4S05A 3VPSA 4FVTA 4R69A 2ZIXA 5IAJA 4LYYA 1N2CE 3SZRA 3UV3A 4DSNA 1G64A 4G0XA 4XLLA 3R7AA 4CM9D 4S1NA 4ALNA 2O23A 5TJHA 1KDZA 4A8HA 3NWJA 2FMKA 4IZIA 1M34B 5KCMA 1QPZA 2GO7A 2Q5FA 4B46A 3OZDA 4PQYA 4Z9FA 3LHSA 1FDRA 2WF5A 3QNMA 3A4MA 1XNHA 3I9V6 5K0NA 3SHOA 4YMUA 4Q21A 1I3OA 4G1MB 4FBLA 4PZLA 1KDOA 1T9GS 3GDHA 4FHDA 3HCFA 1LSUA 3OZVA 1CS4C 2A9JA 4JAVC 4P36A 4PQGA 3W5VA 8LDHA 3IBYA 1XALA 1GAQA 4X93A 4OL0A 1QTQA 1I13A 2JHCA 2WLTA 4UHFA 1ZKDA 1WVGA 3T1NA 4W8OA 3RGGA 2KW5A 4E6PA 4UMEA 4J0KA 1E4VA 2JVJA 3I30X 3L77A 3R3WA 4ZYUA 1NN1A 4IQ4A 4MWSA 2GYUA 4NNOA 4AK9A 1TZBA 1U9ZA 2BMVA 3M6MD 1YU6A 1WBBA 4X8HA 3HSKA 3OFSA 4J0CA 4II3A 4RZSA 3DKKA 2ZB8A 3L92A 1I10A 1UXHA 3N6VA 5LQRA 3CVXA 5LDGA 5CB8A 2IZ7A 2VSQA 2PKYX 1LK5A 3DS8A 4RJKA 1N7JA 1BROA 1OVGA 5E4JA 4CG2A 4V1CB 5FQOA 1E9BA 3AV0B 3HR7A 3RSOA 5F5LA 2FN8A 1QIGA 4KQ1A 4AD8A 4PYNA 1A9PA 3IP8A 8ABPA 2HCTA 2I3AA 3E84A 4FCWA 1Z6TA 1C4WA 3DCNA 4IWNA 4Q7EA 4OBEA 1NP6A 2WU1A 1A82A 3TVDA 1RBQA 2Q9BA 2DUNA 2W70A 3EA0A 4WK6A 3HXOA 1J20A 1HLFA 3NTRA 1JEEA 2DFDA 4ZYTA 1YTLA 3F9CA 3ROFA 3FNGA 3OQOA 1FLAA 1JW9B 2CMDA 2CNWA 1Z4MA 1RBYA 3C85A 3M9LA 2YNMC 5JSZA 4PR3A 1PNRA 4BUCA 3KOOA 1UPBA 1OE0A 4DNFA 4NCBA 1ZBQA 4EA7A 3O8CA 4MLCA 2RJ3A 2GRJA 4U8GA 2IWHA 2XV1A 4WLOA 3QOWA 1DAFA 2XCUA 4I19A 3ANTA 2AQ8A 1PG0A 4D79A 1ZCAA 2QW1A 3SKXA 4EL0A 3A9UA 4CT0A 1A2QA 4XTRA 3DE2X 1AQUA 1YRHA 3WLJA 3ICCA 2FPWA 7AT1A 4UBLA 1M1UA 2PO5A 1U1EA 4LE0A 2D5AA 2H65A 2FN3A 2WF7A 2W0MA 4FOSA 2CUKA 4N18A 4QYIB 3TVYA 4A2WA 2XDAA 3DXFA 3FH0A 3GRRA 3QOYA 1WQ4A 3KVNA 1FQOA 3MXTA 4HDSB 3TMAA 3TRKA 3UK0A 3TSYA 2ZQYA 1GU1A 4DY4A 3UAWA 5IBRA 3SF0A 1GVNB 2VCHA 5ARDA 2KSQA 3R0ZA 4CFZA 2R7LA 4YGYA 3SEFA 5HYVA 1U0EA 2RH5A 1JQDA 1KC3A 2V8OA 3CF2A 2YWFA 3NQ41 4CKZA 3TLZA 2N3ZA 4QGGA 2WWVD 3G1UA 5FOUA 3ZWPA 1XZEA 4RNDB 1EVZA 4KIUA 3ID6C 2F1RA 3SZGA 1NRWA 3GFOA 3HJTA 1NMQA 1QG2A 3N2IA 2HF9A 4KQEA 4EJ6A 2GH1A 1MQAA 1WXWA 4IJWA 4ND6A 1CE8B 4QU8A 1YBFA 1GTSA 3R0XA 4NCKA 1FRNA 5LBTA 1ODTC 3HJHA 5D1HA 3WLNA 2CCJA 3IP7A 2YHIB 4D6XA 4K7JA 4EB6A 4IDOA 3GRZA 4ZAWA 5KU1A 2QL6A 3DB1A 5C8ZA 1D7AA 1EUYA 1VE9A 5I7AA 2W42A 1WMDA 3EODA 3LY8A 4KQKA 1V3UA 4H15A 1YDHA 1W5BA 3NV9A 3D0QA 4MXDA 5KOJB 1MGOA 1X14A 2CNBA 2Q4DA 4G4SO 4J7AA 4MR9A 1HDOA 1KF0A 5DTMA 1PIWA 3CXUA 3CT6A 1SKMA 2HXYA 3HGTA 4AZVA 1XNQB 2RGXA 2WVJA 4TKVB 3V7NA 4BO3A 3FWKA 2PX2A 5SZJA 1K08A 1S8NA 2CD7A 1WW2A 2CLEB 5D3MA 4ASUD 5ALRA 1PJSA 3C8DA 1QHFA 3NS7A 4JLNA 1JWBB 3CFYA 3DD5A 4BN4A 2H5LA 4D98A 2SNIE 1GPNA 4FGUA 2I78A 3R3YA 4FXOA 3AB8A 3RYCA 3KLNA 4U7WA 1U6JA 4ITUA 1Z4OA 2I4LA 4KAJA 1GR1A 1WNTA 2AV6A 1KRWA 2O2DA 4OQXA 4Z99A 4LZPA 3O95A 2GZ1A 4O2AF 1EIZA 2ZOSA 1SG6A 4JQSA 4K87A 4LXXA 5A71A 1PJQA 2VDJA 4EJSA 4N65A 1GQQA 3BK2A 2VHXA 1BCSB 4KR6A 2Q45A 3DZKA 1M5UA 2PL5A 4R2KA 3VOTA 4YCNA 3NU1A 2BWJA 3RU3A 2BBTA 5FI1B 4XQ0A 3IUEA 1J8YF 1NOJA 1PZGA 3FTCA 4OQQA 3GN2A 5L6MB 4P7GA 4C0JA 4C07A 1H2WA 4OQZA 2B4KA 3EC1A 3ZQ4A