2NSLA

E. coli pure h45n mutant complexed with cair
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
PARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSANRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase catalytic subunit
publication title N(5)-CAIR Mutase: Role of a CO(2) Binding Site and Substrate Movement in Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 53
structure length 162
sequence length 162
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2006-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2nslA00
4GRDA 5CTJA 5CLFA 5BOSB 1QCZA 2FWIA 2FW1A 3TRHA 4ZJYA 5CLHA 4JA0A 3OPQA 2ATEA 5CLIA 4YCDA 3ORSA 4B4KA 3OOWA 2FW9A 1D7AA 4ZMBA 2FWJA 4Z7JA 2NSLA 4AY3A 5CVTA 5BOSA 4ZC8A 2FW6A 1XMPA 1U11A 1O4VA 2NSHA 2NSJA 3LP6A 4YCBA 2FW8A 2YWXA 3RGGA 5BORA 5CLGA 5C5DA 2H31A 2FWAA 4YCJA 4YCCA 2FW7A 5CLJA 2FWBA 3KUUA 3RG8A 2FWPA 4ZK2A 4AY4A
chains in the Genus database with same CATH superfamily
3UBMA 3RAEC 4WOCA 5AXAA 4C76A 4RELA 1J0DA 3L6EA 4Q1DA 4MH0R 1W4AA 1BD3A 2C5HA 3LRTA 3VZQA 3GT7A 3PG5A 5GINE 4RK0A 2WY2D 3F71A 2ZI3A 3SQLA 3ZS8A 3W4IA 2F6RA 3SPXA 3KJXA 3R0XA 3NHPA 2PKXA 1MVOA 1OFUX 2OE2A 3WYGA 1CR2A 2B2XA 4YP6A 3OIVA 5BW8A 2QT9A 1R4NB 3I62A 2R6ZA 4NYMQ 4Z1MD 2JI4A 4FR5A 2PPLA 1Z15A 3DJFA 3KK0A 3JD2A 4GMXA 1WU8A 3WHPA 4KR7A 2CUTA 1XTQA 4JCOA 2GD6A 2YTZA 3H3JA 1WVIA 3OE4A 3RADC 4FD3A 3DNMA 1NW5A 2H92A 2JEYA 3N2LA 1F2TB 4IPTA 1I7LA 1M34B 3S2IA 5IZCA 3P0RA 4MEAA 4L4XA 2PUFA 3FVVA 1FVXA 2G9UA 4TL8A 1E4YA 3S68A 1U0EA 3VU8A 1USIA 1U6IA 3Q6MA 5JPDA 1TJPB 5BOSB 1XVTA 2GZRA 2W8BA 1H94A 1T8TA 2WG2A 5ALLA 2IYZA 3BQ9A 1TCCA 3RF6A 3WWZA 2WYUA 3FYUA 3ADKA 2C8VA 2L18A 4L2IB 4LRWA 4PCUA 4CVNA 4GQAA 2G70A 4AQDA 3H84A 3V80A 1JR3A 1BDIA 3I8SA 3IKVA 1HSZA 1Y9EA 4M1KA 2ZU6A 1W35A 3I9FA 5A4IS 3G5AA 4MYTA 2H4YA 4QHYA 4I4TB 2JIZD 1HV8A 1SUSA 2DJIA 3BUSA 3SR0A 4XM2A 1U3TA 4LMRA 4NMWA 1QHFA 4JH0A 4B47A 2EL9A 3JQQA 1VKHA 1NBOA 2FF5A 4L75A 5D8DA 4JGBA 1XEXB 4GFDA 1FW8A 4BECA 4DR2B 3MLEA 1I5RA 3OD5A 1H2ZA 4LOJA 2FWRA 5LIRA 1HF3A 3A2MA 3GXOA 1K7YA 2YHIB 5DYIA 3A2KA 3TB6A 2QL9A 1N6OA 2GJ9A 4J1TA 4MCJA 2Y93A 2R8ZA 3DV9A 1ECBA 5IHXA 4EFDA 4JLMA 1C1XB 4Q18A 2ZUFA 2A5FA 2YIVX 1PEDA 2NUBA 1F38A 4LSWA 1ONBA 3I92A 3NCHA 5NULA 1FEZA 4RMJA 1ZW1A 1OX5A 2VJDA 3CH5A 4KO2S 1UPFA 3AF4A 3AV0B 3DMHA 4RNDB 2OA0A 3W8NA 4FJ2A 1N32B 1J8QA 3MWLA 4Q1AA 2XCOA 4HQKA 3ME5A 5BOSA 4XWKA 2ZIVB 4PLHA 2AD5A 2P0AA 4M9SA 1RADA 2WTNA 3QMPA 4AWXA 2ZVPX 1MVLA 1T9KA 3LPAA 1AHNA 1X7XB 4NE7A 1S96A 3CMCO 3TR0A 1X0XA 1J39A 2O19A 3CX4A 1L4YA 2ORIA 2QYTA 4JC0A 1T9GS 2E3JA 3GRAA 5EIBD 5AO9A 5CB4F 2P35A 4OJKA 1SOUA 4WXEA 4X94A 3FNEA 4UM7A 4LISA 3IUSA 3NM5A 3W5DA 3SOZA 2JNWA 2CHVA 3AZOA 1W1UA 5AIBA 3MJ4A 3FPGA 4D96A 1G7SA 1YTLA 4UJ3A 4QBGB 4UHKA 4NDAA 3NGMA 2PLRA 3C0KA 1STOA 3NIGB 4GLBA 4LAFA 5ELLA 5KYVA 3UGQA 4NLLA 5C53B 1R1DA 3KUDA 3BZWA 2LBPA 3EWIA 5G0WA 5A06A 2Q8PA 3DMFA 2GR9A 2Z3VA 2ZYDA 3WHKA 5EAIA 3KQWA 3FNRA 5FLEX 4ARZA 3QXHA 3I0MA 4K0KB 2R6FA 2WF6A 2OXIA 2NUPA 3NEYA 3A4NA 1T6XA 4IYJA 3RH0A 2P7HA 3N8DA 3OCCA 4CG0A 1JFTA 3L7YA 2WFLB 2Z95A 1ZR4A 2QU8A 2BKLA 2P0EA 1L7PA 4WZBB 4G0UA 2ODNA 2F8TA 2F67A 4U8GA 3B1XA 5DIFA 2PMCA 2DE0X 4EJFA 5DN6D 3IVCA 1M7GA 2JK0A 3LVFO 3GLIE 1L7BA 3Q1KA 5IS2A 1ISSA 1TYBE 2PD6A 4YMGA 4LI3X 3T12A 2I2DA 4JUFA 1E9VA 3L40A 1R10A 3NOVA 2YZNA 3NOXA 1FJGB 1FS5A 5JAPA 2IKQA 1OPRA 3K9BA 4LSZA 1XZBA 1PFWA 1B0PA 2BHTA 2FX2A 2TMYA 3KZVA 3VX4A 5C1DA 2XECA 5EHZA 2F00A 4XSVA 1PHRA 5AW8A 2HCJB 5A4FS 2VRCD 5IAJA 3M1AA 1N7GA 3I45A 2PYZA 5IMSA 2J08A 3DLTA 1FXWF 2RI6A 4K0RA 4OHRA 5LP6B 1XF9A 2R4UA 1G20B 1WZNA 2V7VA 2ZWIA 4MDYA 4O2BB 4OKSA 4M1ZA 1JV2B 1PZHA 4JVLA 1DAEA 1W581 4OP1A 1MHTA 1G3MA 4AYWA 4G1EB 3G9ZA 1AHIA 1WKCA 4RU1A 5BORA 1LFAA 1FUYB 1NUQA 5C35A 1IOVA 3BMCA 1EIWA 1OXUA 1UK8A 1YS1X 2WUWE 3I52A 3CZRA 3I2GA 4K9NA 1B00A 2C3MA 2QXUA 2QF7A 2HXYA 3D0OA 1JG6A 4QOFA 4RH0A 5DH9A 4BV3A 4CCSA 3JWGA 4JKYA 4LXHA 1KEKA 3NEPX 1K06A 2X41A 2VHCA 3FPCA 1B0UA 4M0LA 1G20E 1NLYA 3PTZA 3EUFA 1NQVA 5I9BA 1KH3A 3CZPA 2FRXA 3L0YA 1KTVA 3PVCA 1MRSA 2GF0A 3E7FA 3OO0A 4DC9A 5K3OA 4AMYA 1N5OX 4UTRA 3WJAA 2VFAA 4M1YA 3NTLA 2PO5A 3L8EA 3HP4A 3IBGA 1P31A 1LLFA 3CXUA 4I9GA 4DUYB 1E63A 1S89A 2FUEA 1TUEA 4TSKA 4WD3A 3C6XA 1IL0A 1MMFB 2HA0A 2Q6VA 2X0EA 4DIFA 3PXCX 1VCMA 3IUPA 2DBZA 2OCGA 5CITA 1VHWA 4CQLB 4QT4A 2BSQA 1YO6A 2QTTA 2ZBGA 2B6HA 3ZDBA 2QW8A 1AVTA 2WF8A 1NIJA 1VBFA 3W6UA 4LMAA 3SNKA 2J4FA 5FPPA 2HC9A 3SX0A 3X1JA 4BUZA 2Y0BA 1I1HA 4TMYA 1ZK2A 1K5PA 1KJ9A 2FHPA 2AKYA 5HEKA 4BBAA 4UNNA 1IAVA 2VLIA 4BO9A 4GKJB 1BH2A 3WIVA 5GZ3A 1VLJA 2VT2A 2Y76A 3SLRA 1H93A 4MQ6A 8ADHA 1JW9B 2EZUA 3NIFB 1NJ2A 2X9VA 4MKRA 3AHHA 3HRIA 5U1PA 1T0UA 2ATEA 3SIPA 4F3RA 4P9NA 3U5TA 3EEBA 3S7ZA 3SQMA 4WRRA 1XTBA 1ZCFA 2Q3MA 3C87A 2VKTA 2R86A 3PD7A 4U00A 4GX5A 2IHNA 1Q91A 4Q3BA 3QHPA 4W9NA 5EFZA 4I50A 2Q5LA 3MGBA 2NWQA 5H16A 2O14A 1HNZB 2NTNA 2GCEA 4MR8B 3PE3A 1N33B 1LJLA 4IIVA 4B7AA 3E7DA 1NYLA 1JDBC 4GI7A 1PWZA 4G0VA 1E6LA 3ZIUA 1N0VC 1TK9A 5KWEA 1AS2A 4RX1A 1H4VB 5I9NA 4PGMA 4RF5A 4IHQA 1U2GC 1IOZA 1EHIA 3V6MA 4B6PA 3RJMA 1VGRA 1SRQA 1J0EA 5DTJA 2SHKA 2OBNA 3EG9A 4LWQA 4Q9HA 1O6GA 2P77A 2RJNA 2JCSA 1G3QA 2BONA 3A05A 1E6MA 3IAFA 4MUHA 4RMIA 3DDSA 3IP6A 2RI0A 4PSKA 3L18A 2C7BA 2MR6A 1CD5A 3TX2A 4LHSA 3H1EA 3ZDYB 5CP8A 4WJLA 2J0VA 2FHSA 5HZGA 5I6DA 1K9VF 3NBMA 1Z25A 1HH4A 1PD0A 2FP4B 2JGDA 4OA8A 3HJCA 3OI7A 5ICFA 2HHHB 2BMVA 3DMTA 1IY0A 3JYQA 3T5TA 1QCDA 1BS1A 1T3GA 2R68A 3ZR4B 5KYKA 1EPUA 1JFFA 1O94C 3UATA 1ISRA 2Q3DA 5ERYA 3WADA 4LDAA 1CY0A 1KSJA 4H3VA 4O4IB 3FR7A 3TNDA 1B8NA 4WASA 4DDMA 1VI6A 1SXIA 4TWJA 3I1JA 1RWQA 5LDHA 2YJZA 3P9CA 1IN7A 1AD2A 3TLMA 4CE6A 3PEWA 3HUFA 4LRUA 1K4YA 3NWJA 3TL3A 2FJ0A 1WV0A 1SHLA 3E3AA 5KC9A 4MUBA 3R7AA 1YU9A 3K0HA 4HB2A 3EZGA 5JU6A 2HKIA 3COVA 1SXPA 1L7NA 2V7TA 2J45A 3C74A 3JX9A 1B3BA 1QKJA 3K9GA 4K9OA 3QXXA 5FT9A 1BMTA 1TYCA 1VIYA 3W9YA 5I9LA 5JS8A 5HMLA 5DTQA 1TM4E 1K9SA 1BA2A 2B7BA 3ZU4A 2IYFA 1IEVA 3K9NA 1QRSA 1A9OA 4PFSA 2HYIC 1M8GA 2Q1YA 1C9EA 2I34A 3UJ7A 3Q87B 3ZZUA 2XEXA 4CKWA 3DR5A 1OX4A 4PCLA 1G6HA 4WL0A 4DCOA 5C32A 3EODA 1E0DA 3QUAA 1QG4A 3HEBA 4I6GA 3LHKA 4PGHA 1SXJD 4BN5A 5EEGA 1G4HA 4UU1A 2CXNA 5B3JA 2KJQA 3ND5A 4W5TA 3F46A 2LTAA 5FTNA 4DCVA 3OCZA 3RLIA 5DN6A 4OG2A 2X5KO 1EFAA 1A9TA 1NYQA 3PITA 2AZTA 1X87A 2PGDA 2MSWA 3CF2A 3IB6A 4ON9A 3T7CA 5TV2A 4INPA 3U4QB 3M2PA 1E4EB 5JDCC 1QLJA 5DKFA 2CW5A 1U04A 3F5MA 4PTZA 1K8QA 1NOKA 1A72A 2ZIAA 4GG1A 1KORA 3UY4A 4B0OA 3LWNA 4DBLE 3FLBA 4AJOA 5BNTA 1L8OA 4JITA 3U1BA 5CA0B 5DGXA 4KE9A 1PWXA 2QLBA 1OAKA 1TQ6A 4LJ9A 3EXHC 4IF4A 3FFBA 3KIPA 4GM4A 3GLHA 4BLWA 1YE3A 2BFDB 2VRCA 2XGSA 2BC9A 3HI4A 4RK6A 4MKFA 1SPBS 4EB6B 1G5IA 1DC8A 2XQGA 4C5CA 1I4OA 5F5NA 5EUQB 5L4SA 1GUAA 1UWLA 2ZBDA 1QNFA 3D6NB 5A3JA 1H2FA 3PUZA 1NSTA 1P5FA 2UYGA 3WLNA 4AI6A 2GLTA 5LP6C 2Z9CA 2YV5A 2ZT5A 1T4CB 2QMEA 4NESA 3CLSD 1RYMA 5I7AA 3NOOA 1YHZA 3T1QA 2EP8A 2IV7A 3D7RA 3MWKA 1YOVB 2I66A 4MVJG 5CLJA 1TAHA 4ROSA 3IVMA 3A1FA 3PJFA 1XDGA 2Z08A 3MJTA 3A25A 3DP7A 1SBCA 5ALJA 4KR6A 1W4LA 3FNQA 4IBOA 1IWBB 1FYDA 3BSYA 3LJKA 4TXJA 4LY0A 4ARUA 1UODA 2H11A 1OV4A 3FPLA 3GGCA 3JQEA 2WG0A 3I4CA 3NUGA 3T4XA 1CE8A 3WNBA 3ZD7A 4ALMA 3MM4A 1Z6PA 2ZJOA 3C6KA 3W34A 3WIBA 1M6VA 3DV0B 3OKPA 5UKDA 4Z4HA 1EXVA 4IJ6A 4G0OA 1NBAA 4R40A 1FQKA 3RODA 1Q0LA 1DC7A 2B5OA 4N48A 2Z43A 4BVJA 3EDRA 4JFAA 1GR0A 1NHGA 3QVGB 3QLTA 2P9CA 2WB4A 3HUDA 3L43A 4JT8A 3KKKA 4HAYA 4CF5A 5AXBA 1ULAA 3BIXA 4IO1A 2O52A 1HQYE 3HO6A 4WOJA 5IXYA 3N7AA 3TRKA 3SHOA 1AX9A 3D6MA 2CVZA 1DAFA 2H48A 1XJ5A 3A9TA 5G1NA 1X74A 3E03A 3ZIAA 3JU3A 2VPQA 2V5UA 1X7YA 3HYLA 1OLOA 4R1UA 3WRXC 4CQMB 3DOFA 2XOXA 2VP0A 1MQAA 3NX4A 2H17A 2H3EA 4KMOA 3K5IA 1XKLA 3GLHE 2IPLA 3ASVA 1G8JA 2I2XB 4U6QA 4H15A 1GXSA 1A0OA 1AURA 5LDGA 3DZBA 3AU8A 4HLQB 2FTKE 2YL2A 3H19A 1EINA 1L9KA 4JJ7A 3TQFA 1TEVA 3R6DA 3B3AA 4Y2SA 4F6RA 3GWZA 3O4RA 2Z5VA 1D2CA 2M6SA 4L8LA 4N7RA 2ZUTA 5A62A 3FPFA 3HCAA 4LNHA 5LVAA 4TV8F 1WSAA 4F5ZA 4XH9B 1GCGA 4RULA 5CMLA 5EP2A 1SXJA 2HN9A 3QMMA 2II6A 5BWNA 1VJGA 3K9CA 5EWLA 3TH5A 3SVTA 5BSVA 3SQOA 1RW4A 3DNFA 5DYTA 1I7SB 2BDTA 1L0BA 1XPUA 5J40A 3V6LA 1ZUNB 1FMFA 3Q88A 1Z82A 2QRUA 3E7PA 4GUDA 3RQSA 2GN6A 3JVUA 1BXKA 1XTIA 1RJ9A 3KSMA 1XKQA 1I2CA 4ALJA 1QDEA 2BJWA 2QL5A 3HB4X 1V9LA 3NJ8A 1L8LA 3O8CA 2JGMA 1W73A 3DTVB 3LUBA 2LUOA 3GRRA 1KFKB 3P9PA 1IUKA 1YB5A 3BJEA 1VSBA 1EVIA 4XRRA 1GG9A 3TSOA 3F5QA 1CNEA 4I08A 5EMKA 3ZN2A 4AFNA 4DIUA 4JLUA 3CQ9A 4QSMA 7AT1A 3J7TA 1FFXA 4XFJA 5L4NA 5AJHA 3HJBA 1QQAA 1XYVA 4E46A 4MWSA 5D86A 5KWJA 1AHHA 1KARA 4FFMA 3V2UA 1NLUA 3ZWYA 3OBIA 4PAMA 4TKZA 5A4AA 1WVMA 2C4TA 1T0HB 5L3SB 2HR1A 2G72A 2F17A 3W8RA 4DC0A 3F4LA 3H83A 5HILA 5KX5B 4RDCA 3V1LA 2OHVA 5C1OA 4LECA 5FFMA 3T7KA 2D5AA 4EMTA 9ATCA 1N8NA 1S01A 5K0FA 2PT5A 3AR2A 2HM7A 5KPJA 5KHAA 4KX3A 1GSOA 3HUUA 4CWAA 5FXMA 2FVYA 2DCUA 4BNKA 1ODKA 3N59A 3L0CA 1RI2A 4BMZA 2AA3A 4PZ9A 2GA9A 2REOA 1Q1NA 2EL7A 4JJZA 1E62A 2DTXA 2X5XA 4UDXX 1PK8A 3EQ9A 2VWHA 1TQHA 4B81A 1AQNA 5E9JA 5IAGA 4PLPA 4YDSA 1PJ3A 1D1SA 4P93A 3T38A 4X1IA 1EVJA 1LBEA 3SZOA 2VF2A 2YZGA 2CXOA 2Q1WA 4L0MA 3ZH9B 4HVAA 4QXAA 3U37A 2PFKA 5AXDA 1DAMA 2WJHA 3CEPB 2P5SA 1GPMA 1UBMS 2A0KA 4ZVRA 1F8GA 2B7CA 4S1NA 5FUYA 5A7GA 5TY0A 4F2PA 3AIKA 4MIYA 5ADVA 2VNJA 5J4HA 1A5TA 3X1MA 4UMEA 3NOQA 2H4FA 2VF4X 4TQAA 5CLQA 3V3TA 2W70A 1YDGA 3G2PA 2BFCA 3EFOA 1P8JA 1XMOB 4XGIA 3LO8A 1O95D 1PW7A 4LQLA 1Q6YA 5KX5A 1O6BA 3DDUA 2HQOA 1N4DA 2P2NA 2VC2B 2ZIXA 5ELMA 1ZW6A 3WWOA 2QTGA 1E8NA 3BRCA 3AYXB 3E53A 1DE0A 2BFEB 4DM4A 3WGHA 3MMPA 1GPNA 1NVTA 1XF1A 3PJGA 4FU0A 4ZO7A 2I1WA 2YQ4A 4OU5A 1TCBA 1E5TA 1BS9A 3BFVA 3NC1C 4Q47A 2GEBA 1JVNA 4DDWA 1H3FA 1Y42X 5SY6A 1VIAA 3L1UA 5BSKA 4OX9Y 5AFSA 4O4HF 3RYFA 1A97A 3THOA 3BWBA 2C2YA 1I36A 2AR9A 4DT1B 2HY7A 2X7XA 2I7TA 3IL2A 3SBEA 4G1BA 3V4VB 5KNDD 2FUG6 1UMBA 2X8AA 4OPMA 2B30A 1FDTA 4W7IA 1J99A 1FLAA 2M6KA 2P2SA 4BNGA 1EDOA 4WT7A 3GCWA 4KAJA 3FYHA 1N6NA 4KNVA 4Q6WA 3IIMA 3STUA 2ZE6A 3V7UA 2HSJA 3O8NA 1Y5NA 1XMJA 2ZJ7A 1TFRA 5CHEA 1Y3DE 5J3JA 3A58B 3AF0A 2X0DA 3DLCA 3S7TA 5KCMA 5JLAA 4AECA 1R0YA 1T0JB 4MQFA 4RM2A 3AB3A 1NNI1 3W3AA 3MWGA 3TQSA 1DUSA 1YFJA 4UVEA 3GU3A 2IBSA 5BY2A 5CVTA 4KREA 5FEUA 4YGYA 3O6VA 1M73E 3COYA 5TPZA 4Z3KA 1YRWA 2CFTA 4B4UA 2V7XA 3EGIA 1CZLA 2YXLA 2JGLA 2O5EA 3H3XA 3REOA 4D2IA 4V0LA 3S55A 2ZW9A 2XR1A 3DEAA 4ZARA 3H1TA 1MGOA 1YK1A 1QTNA 4Y1RB 3WG9A 1QIGA 1L2TA 1SK8A 1RWNA 2MSNA 3GRYA 2VSFA 4MRAA 4RA9A 4ETIA 1ZGAA 2XUKA 5DNDA 5CDTA 1NQOA 2HF7A 1P39A 3UAGA 2VYVD 3DC2A 4J1NA 2HPHA 3UWSA 1QXSA 1XNJA 3QEAZ 1Y6ZA 2WE7A 2JI7A 4PAOA 1KDYA 5BR8B 721PA 1XPRA 1PT8A 5BT9A 4OHKA 5IXSA 1H65A 3AKCA 4MRMB 4V38A 3V8QA 1O97D 3GIDA 2PH7A 2FVXA 1FRNA 1WD5A 4QUEA 3MS4A 3IAM1 1HDCA 3P26A 3H5IA 2AG0A 3KR2A 3ZQ6A 5GZ6A 3A7EA 3ASUA 4MQFB 3IPXA 1Y6RA 2O57A 2VHTA 4A6EA 6REQB 2VTBB 3IQGX 1XDDA 2WILA 1U8TA 2Y68A 3WRXA 4MLCA 3RVMA 3NFRA 5FA6A 1RBZA 1DBWA 3A4YA 3TTUA 3TRIA 2V0CA 4DQLA 2R2GA 2OGZA 3A31A 5JPIA 1QHSA 4Y0VA 5BR7A 1RXYA 2TMKA 4UBLA 4XLTA 3LUFA 4LOKA 3DZCA 1JLKA 5HX7A 3HSKA 3OC0A 4FMCB 3OTWA 2X8BA 5DGTA 1JJIA 5DRYA 1GRVA 4RZHA 1JTEA 1YGYA 3QFHA 1U2PA 3PB3A 1FU8A 1LI5A 4NX2A 3C3WA 2ZSDA 4B48A 1UC8A 1Z6ZA 3CLKA 4B3XA 1WQ4A 3L7AA 4MRMA 4EG5A 5I7UA 1GNRA 1ZG3A 1ONOA 3PFCA 3QKSB 1V0JA 1NP6A 1UQTA 1VHJA 2AFIB 4PNZA 1PCXA 4PNEA 3LAWA 3M8KA 4ZVTA 3OZUA 5A4JA 3KXKA 4DIDA 4LJRA 4C03A 3DMGA 4I2NA 3PXAA 5EKTA 5I51A 4BZQA 1N1GA 5GONA 2QUIA 5ALGA 1HURA 1V41E 2AMYA 5AHOA 4YMVA 3ZXXA 2UAGA 1ORIA 3L6BA 2ZB2A 3BH6A 5KNCA 2W4QA 2VAWA 4TYYA 4FI3F 1TW2A 3PHLA 2CB9A 2V3VA 3MUNA 4W8HA 3R3YA 3Q15C 1F3OA 1UAAA 1LQ2A 4RZIA 3JQAD 4PHGA 2BFBA 3VHXA 4EA6A 4TN1A 5K3EA 1WX1A 4L51A 3BWMA 5TC4A 1LRLA 4MARA 2HJ9A 3G8BA 2E87A 6PFKA 3HBMA 2QTLA 4D42A 2BJHA 4NRDA 3FYUB 4X54A 4X90A 2O8CA 3N2ZB 4QIHA 2YZ2A 2XYPA 4ZHSA 3A6GA 3ISVA 3Q10A 5EXSA 2JANA 4EG8A 1JTFA 1TYZA 3L4BA 2Q28A 3AERB 1W2WB 3I23A 3GA7A 2YUTA 4EL0A 1RYDA 4FFLA 2WINI 1I0LA 3I42A 3PT9A 5IAEA 5KPDA 3ZDCA 4UXIA 3MG9A 4MKHA 2M1ZA 3EWSA 2VP9A 3CF4A 4GQBA 1LDYA 5E8RA 3CZQA 5KOJA 4QICA 4YRZA 4CLOA 2F4VB 3LV8A 3HLKA 1NW6A 3KOWA 1EJ6A 2IU6A 2LE0A 3AONB 3N2KB 4K6KA 4IFEA 4JJ4A 3KOOA 1P2UA 5GQSA 5F4ZA 2ZITA 4YQZA 4Q3LA 1K7XB 1XN4A 4DEXA 3V8BA 4P80A 3NTXA 1CNFA 1MEEA 1JHRA 4QUGA 2P1RA 4TS1A 1NBWB 4JASB 2NO4A 5F73A 3GBPA 2QDKA 2F8SA 2RGXA 2Q7XA 5B3JC 4QG3A 4NXNB 2IHVA 3KBOA 2JB9A 1ZM3A 1P1FA 1I2DA 3ZU3A 1Y63A 3LF1A 5JADA 1A98A 3H11A 5TDHA 1XALA 4BRWA 4KN6A 2OBXA 1ECPA 2Q2VA 1QYXA 2WAYA 1T3SA 4LRYA 1PQWA 4ND5A 4U8HA 5J2UA 2PUBA 2IXEA 2HWWA 4EGCB 1AQIA 1HQDA 1VA5A 4KYIB 4TWBA 4TTPA 3D59A 2C07A 2GF2A 1K92A 4O4LA 1UH5A 1PNOA 5F3WB 4RMGA 2X14A 2QRJA 3I4LA 2XD4A 3A10A 3B9PA 3RUDA 3JWJA 3SJUA 3R6TA 3RVOA 1UZNA 5LJIA 4J29A 2PMKA 1MAUA 2BI8A 4MLZA 3UCEA 4B3TB 2PL5A 5A6SA 2IGTA 3NHJA 1C8BA 3SD7A 1R16A 2VPTA 5EMHA 3FCCA 4OI4A 3WMEA 1ZJ4A 5FBWB 3UJPA 1YBHA 1K7EB 2QQ0A 4RO0A 4ZC8A 2Y4OA 1L5KA 2BKUA 3L0BA 2O2XA 4MPJA 3ROEA 2Q8NA 4MUJA 5L45A 5B53A 3WLQA 1FPQA 1WA5A 3GJ6A 3JZMA 1CZNA 2AYYA 4GNRA 2I6QA 1ZD9A 2C0QA 1O94A 4HN9A 2YWFA 3JD3A 5C8DA 4YAJA 2ZQZA 2A5GA 3QVTA 4KQJA 3O8LA 3W6ZA 2Y0CA 1Z4QA 3D6UA 3K30A 4AZ0B 4FS3A 4YLYA 7MHTA 1KYWA 2E5FA 2G71A 2IIPA 3H8WA 4U7JA 5E7JA 3TLAA 4Z4QA 1VBMA 3DOIA 5BW4A 2FCAA 3TLCA 2C3OA 4LXGA 3AR3A 2HNAA 2ZIWB 5ALKA 2P67A 3E5NA 5FI5A 3MS2A 4C30A 5BVGA 3HMQA 1XZKA 2NTJA 4X1KB 3ZGNA 1KC3A 1TVKB 2G8LA 2HRZA 3WL7A 3VZSA 2QYOA 4CCAA 3L8ZA 5LD2B 4HXGA 2BAGA 3OTGA 4NEHB 4DG8A 3KJGA 5F9FA 1UEIA 4RZUA 4L6CA 1T5HX 2Y3IA 4YASA 1OYWA 4ZO6A 4FKBA 5J2UF 4YCMA 3PXXA 1ZGCA 2ZJ0A 3RFFA 2RMKA 3Q9NA 4K6CA 4P4SB 2DPXA 4YAWA 1A1VA 4BNWA 3I9NA 3LUHA 4NBTA 3AHCA 5TT0A 3QUSA 2VSNA 2SBTA 2XF2A 4XZ3A 3BM5A 1BS2A 1YB7A 5AVYA 5IFKA 4IUCS 2HLHA 2QPAA 1BE6A 4IF6A 5IKMA 1ZNWA 3H16A 3G85A 2JIDA 3X1XA 3IDAA 3C3DA 1WABA 2AEFA 2I7DA 2ZRPA 3MXTA 4MVJH 5DNEA 4YDHB 3VNUA 1GO2A 4JC8A 4OGFA 4GGOA 4QAQA 1G20A 2GETA 2C2KA 3EXFA 4MHTA 4NC9A 1JEQA 1PGOA 3W0LB 1UBSB 4DFDA 1NVEA 3F78A 1YR7A 1YQTA 3KUCA 2ZR7A 1W8IA 2OHGA 4H6WA 4AKEA 4KLRA 4R8SA 3H1FA 3FPJA 1EGVB 3K4HA 2H57A 4WLOA 3N2IA 2C1XA 1V8OA 4JWTA 2Z09A 2KQUA 4IIXA 1BCSA 1BH6A 4Y98A 2H54A 2B98A 2XTNA 3PBKA 4ZCLA 4DR5B 5BSRA 1UMCB 4PM4A 2FDCA 1XEWX 3FLEA 4FUQA 3O3MB 1L5FA 3H9BA 2V6JA 3GPIA 2XW6A 4BQEA 2G9ZA 3H2KA 1NDHA 1ZNYA 2E1RA 4EY5A 4X91A 4RTKA 3WMXA 2OCLA 5HGJA 3UJ8A 1QHXA 1G4UR 3OFVA 1MH9A 3U16A 4KN5A 2D1FA 4D1YA 4O3MA 1TKCA 4EJSC 4KR9A 4JOSA 4EZBA 1CYDA 3FNBA 4RWZA 3R0ZA 3ZUPA 2P0YA 3JRNA 4WKGA 1N1EA 2YNMD 4B5LA 3OJXA 4G8JA 3PFKA 1DWUA 3I83A 5A0TA 1U1IA 1R8YA 2AEEA 4ZMSA 3ZJVA 2CLSA 4OP3A 4J2HA 1JEQB 2RH5A 5FOWA 1NXTA 5TR9A 2W6ZA 3EA4A 1NVKA 4HZUA 5BSMA 1L5WA 3UAVA 4LX0A 4ZEXA 4LJAA 4JD5A 3LZDA 1H8ED 2WC1A 1B23P 2MMGA 4K6HA 4R3UC 4HN2A 4RF3A 1HT1E 1SPXA 4J9UE 4OX9B 4JBYA 1HE1C 3QQPA 4MW9A 2Y9PB 1LDGA 1Y7LA 2FSVC 2DGDA 1EFRD 4FVTA 3DE1X 5E1OA 5BMVF 5JS6A 2IEGA 1KP3A 4R1OA 2A86A 3P9KA 1MX9A 3V4ZA 1P29A 2CEKA 3GWGA 3PR3A 4N3AA 1MJGA 3DWGA 3GLUA 4I50B 5THXA 4A8JC 1I32A 2BZSA 3ZY3A 1YJCA 5ALTA 5M29A 2B82A 2BGIA 4P4GA 3N74A 2C94A 3MBOA 4ND8B 3PDIB 4TWAA 4UUMA 2Q2OA 4KQCA 5AVSA 4L8WB 1E1CB 2HYDA 5JDIC 3R2JA 2QR5A 2ASVA 2OWDA 1HOXA 1G64A 3HZRA 3K94A 4TN5A 1SCBA 3JQGA 4BFLA 3HDYA 1D7AA 2ICAA 3HI6A 2RH4A 3R0JA 4ZOLA 1VCOA 4Q24A 4B4OA 1V5FA 2C5GA 5JSUA 1ULTA 5TRTA 3HCFA 3QVKA 3WFZA 5IJ0B 1PJTA 2AV6A 3KAKA 4XRGA 3RKSA 3B52X 4KO4S 4FQ8A 1W25A 1ZDMA 1JR3D 3O3NB 4KC0A 3FDJA 3LDGA 3VAAA 4BU1A 2ZYRA 2VWQA 3D7LA 1ZN7A 1N6IA 3PKIA 4IIEA 4YJ2A 3WQBA 2V96A 2HZBA 2PZ8A 2NU9B 2VDLB 1BWSA 2PZBA 4RANA 5JO9A 4OA5A 1U0JA 2JHPA 4MV5A 5JD3A 4YRIA 5CLFA 1G98A 1W5TA 2V58A 4W5RA 4UZEA 4D8XA 2VATA 3NIWA 3CH4B 4WZAA 1NF9A 4W99A 1M66A 2HMTA 3R5XA 3ZV5A 2Y9MB 4Z7OB 1X1RA 3R41A 1W88B 3GG9A 4G3XA 4Y67A 4QYIA 3F6EX 5C81A 2HZ7A 4GPEA 3RBXA 4EWLA 4BYGA 3C5EA 3LCCA 5H9WA 1L4NA 2A5JA 2BMWA 4B34A 2PSHA 1JIVA 4XIIA 1EVKA 2WWXA 4G0NA 2GN4A 1ACJA 3PNOA 3KYBA 2E4ZA 4FEGA 2ZANA 4ZOBA 1YRHA 4LXUA 1ZVVA 3RIYA 5IH7A 4IFIA 4LJYA 3H18A 3ADCA 2W6CX 3KPJA 3N0TA 3EVFA 5G4KB 2NPIA 4WSOA 5AHRA 4XLZA 4PPNA 1OX4B 1E61A 1R9GA 1I51A 4OHPA 4DMLA 3CLTC 1QGZA 4U02A 3GJ7A 1WMDA 3MZ0A 3IALA 3R20A 1VBNA 1E1QA 1M34A 3HFRA 4DLKA 1AN0A 5MGBA 2V7GA 4A82A 1O9BA 1CR1A 3DR3A 4ARAA 4ZAVA 2HV9A 2J0UA 3ETCA 2QTRA 1Z2NX 3ZVNA 1P5RA 2IU3A 4OQMA 4QGAA 2C2OA 3CRZA 1WTAA 4IVPA 1H4QA 1IG0A 5AKHA 5GP1A 3IP1A 2V1UA 3EIXA 4KPUB 2JC3A 1NKSA 4V1CB 1P7VA 1UPCA 1VOTA 2AMJA 3ZW8A 2GHIA 5ES3A 5EWMA 5CA0A 1V45E 2QR3A 1J9GA 1Y5LA 1P0QA 3B9BA 4O1HA 3PGA1 4LC0A 1PR4A 2Q8QA 1EP9A 2Z3ZA 3TSYA 1EX1A 3QLEA 4L50A 2EDAA 3WNVA 4BFUA 1NG9A 3KYDA 5DBFA 1KL7A 5GADl 4GPZA 3GLFE 3VUEA 1SU6A 1BJKA 5A2GA 5JMTA 4AMVA 1IZ0A 1LLQA 2BGLA 2AR0A 1NN0A 1ZJ5A 3GAAA 5A7HA 3TQRA 2N46A 3BHMA 4AURA 5KZMB 5IAOA 3NHLA 3WHIA 4JXKA 1E96A 2Q49A 2VP6A 4E6PA 2GUGA 3OT1B 4HH0A 5I7OA 3FMFA 3NQ41 4KWCA 5EIWA 4F9GA 3EISA 3ONVA 1J1UA 2P6MA 1M2OA 5CTAA 1ZCBA 3KJNA 4WIAA 5KOHB 6ABPA 1UXJA 4M9RA 3HCWA 3BRWD 5ALZA 4N7JA 3VSBA 1GZ3A 1Z16A 3AHEA 4UUQA 2BGMA 5SYAA 1YJ8A 1QV6A 4C06A 2CXHA 4ABTA 4J9VA 2POQX 3I34X 2CDAA 2IC5A 4I1UA 4DA8A 1TGYA 1SWWA 1BX3A 2QLFA 3NHUA 4FHDA 3BMOA 3ZDRA 3OU2A 4NMMA 4BBPA 5IBPA 3ZD6A 2RHGB 4TVBA 4N54A 5K4AA 4E1BA 5BN5A 2UXCB 3H5TA 2FP3A 1TQ4A 4Q4HA 1V26A 3WFJA 1BVRA 4A73A 4PZYA 3M6AA 4GE3A 4KO8A 4CM4B 3HO1A 5GJBA 4GZLA 2VZEA 1C7JA 3D5TA 1K27A 1F9EA 2E55A 3JQFC 2VJYA 3AF3A 4NBWA 1YZHA 3PVZA 5TVKA 1MN6A 1RYYA 2CT8A 2ZXFA 4WE3A 4QYXA 1OAAA 5K7SA 1YA6A 3OFNA 1H6BA 4HWGA 5BUZA 2QVYX 3LKZA 1F5NA 1GZHB 1FL9A 1US8A 1U8EA 1ZAKA 5LA6A 1M1UA 1BO6A 3LC0A 4R6WA 3TCXB 4O6VA 4FYHA 5EJAA 1NPYA 2HLNA 4BY9E 1M2OB 5JASA 1Z28A 1ZSYA 1ONPA 2AYXA 2QW1A 2WIAA 1JKMA 5BN4B 5IKPA 3R9XB 3VJMA 2YHUA 3E27A 1VTKA 4OGWA 3VDXA 2D13A 3IKJA 5FRDA 3QFRA 3GVXA 1RWKA 1XQ6A 2F48A 2O7RA 4L95C 2B1RA 4A0SA 4JLAA 1E6CA 5TGTA 3SZUA 5IKXA 2DBQA 2R7KA 4AUKA 4MVWA 2D2FA 3A37A 4O4HB 1U6KA 4EFKA 4HEA6 4EUKA 1TEHA 3N75A 3OZDA 4RMHA 5KVSA 2HX1A 3N6VA 5DK4A 5LN1A 5H7XA 3AGQA 1SQSA 4NCKA 1RIFA 2EKLA 5E7IA 3UUWA 1UOPA 5JDIA 5JI3E 3F73A 4MIKA 2UYHA 3ZWCA 2FEXA 2GQ0A 4MPPA 4DQUA 1KJQA 1JJ7A 4LKRA 3N53A 4KQIA 4DMHA 3KXPA 3U49A 1E2IA 2ROQA 2X1VA 4LCJA 5ALHA 2INGX 5BT8A 4JP8A 3F5DA 1GT6A 1VP3A 4EG4A 2RHHA 2CNBA 3C85A 2VZ9A 4O2BA 3A1CA 4GP7A 2NMVA 4ERXA 1I5EA 1CG6A 3S40A 3B1WA 4N49A 2Q21A 2ZJBA 1PGNA 4ZCPA 4X1YA 1JHZA 2GPWA 3IDFA 4X97A 4DAOA 1XVVA 5KTTA 3THYA 2ID9A 2XOEA 5C8XA 4QTXA 5ICMA 3ZS9A 2OV3A 2ECFA 4ESEA 5LUBA 5TQVA 1WZEA 1GADO 3CSDA 2G83A 3NYIA 1AQYA 1N0HA 2Y71A 3EW9A 4QO8A 2QPOA 1FFEA 4HAXA 2GHTA 4A8TA 2JFWA 1U7TA 2X0NA 2XUQA 1QYDA 3CWZA 4KODA 4KRGA 2FSPA 4DWWA 1B0AA 1L5YA 3QVJA 2ST1A 1YA4A 4POOA 5AESA 1QTRA 3TQOA 4FQ7A 3S3TA 1YACA 2XVYA 1RI4A 3KDPA 2C9YA 4GZMA 2RC5A 4MVJE 4L8YA 3NYWA 4CETA 1CQPA 1ZRNA 3IEUA 5J2TF 2YFKA 3K5HA 3GYBA 1G21A 4G65A 2I2WA 4AW9A 2C2BA 3AKYA 3DMTC 4OXXA 2JGJA 3R7WB 3NDBB 3VR5H 2XLCA 2VCYA 4L0CA 1BQEA 2PSJA 2QAGC 3RR2A 1GKIA 2WDZA 3TEFA 4CF3A 2P3OA 3IUEA 1XTUA 2PXAA 1LWNA 3W5UA 3CLRC 1E2NA 2B25A 2ZRLA 4X41A 3WDLA 2C31A 4O4JA 3A06A 4AMZA 4LY9A 2FW6A 1NP3A 1DUVG 1PR5A 2ZZKA 3H65A 5FNZA 1PVOA 2JCBA 2HSWA 4J16C 2XDYA 1UMDB 1W0JD 5K01A 2RE8A 3URKA 1GGKA 1KQFA 4P38A 2BFCB 3EFOB 4QRDA 2AK2A 2NYVA 4BFTA 4G23A 1IZ8A 2BKAA 3T94A 3VHRA 1BGWA 3GFVA 1YR8A 2PLAA 1LNQA 1UJ2A 2IPMA 1FK8A 4JJIA 1PJLA 2GFIA 1KDOA 1V16B 2A14A 4OH7A 2IH5A 4Z4EA 2AFIE 4DM7A 4E32A 4PXAA 3KUXA 3SBDA 4MVJI 4P3KA 5IABA 3V1MA 3M49A 4IG9A 5CXQA 3PJRA 4Q3OA 4KFSA 1W49A 2FR8A 2P9JA 3R3HA 5I4BA 3MW8A 4GKVA 3MUFA 1PK9A 2DUUA 1K66A 3NHBA 4MSUA 5ISMA 1XRJA 1ZESA 1NBMD 1L1RA 1R8JA 1DSSG 2DTDA 3AETA 2J46A 3KSRA 2FUG1 3CJQA 4FS8A 5AKGA 2VJQA 4WBSA 4KYVA 2I8AA 4OXYA 1NI5A 2ZAMA 5EZ6B 1JJVA 5CXXA 4B33A 3IOCA 1X7HA 4UMFA 3ONWA 4ZQHA 5FTWA 2ZPAA 3W2GA 2PJRA 5FFFA 3EY4A 3C4VA 4QU5A 4D9EA 3RVLA 1QGOA 5KNDH 3ZK7A 4KG7A 1NMSA 2FMFA 1SZJG 4RVUA 4BB9A 4D56A 1K8XB 2IP1A 2J8ZA 5JH7A 4F4CA 1SC4A 3OT4A 3LOPA 4IDEA 4KO1S 3EVCA 2R60A 4CMBA 1E1YA 4QVIA 3V34A 1B41A 1KDVA 4TT3A 3TE7A 1Q1EA 2AI2A 4P0PB 2AUTA 5I5EA 4V39A 3GN2A 1YR1A 1F6WA 4GXQA 4TXMA 3D8RA 5JCJA 1MW8X 3DEIA 3D4IA 5BWBA 2IIQA 1Q83A 2C8KA 5FNVF 1XV5A 4Y8VA 5LBIA 4PN3A 3ZGLA 5C3MA 4X6UA 3VV2A 1XQYA 4MWOA 2PX5A 5ETJA 3H4TA 1NKVA 1CDEA 1XJQA 3WWDA 2OUKA 2ZJ5A 4M0PA 1XCMA 1A5ZA 2HO4A 1OFIA 4NH0A 2CNNA 4B3GA 4ER7A 4Y2YA 1YBMA 2RKBA 4PX9A 4KPFC 1DG1G 4F4HA 1KZ9A 1RZUA 1W75A 1K1EA 4D4JA 1ZISA 4DLXA 1X7ZA 1NJ5A 2O2JA 1F2UA 2I03A 2PH3A 5JVDB 2I3ZA 3TM5A 1WDTA 2Y1XA 4REQB 1YZ3A 2QXYA 3FZNA 1L4MA 4GGMX 1N2HA 1QHNA 1KZHA 5BR4A 2RBEA 1S3GA 1K8RA 3O8DA 5IRCD 1EUZA 5KJ1A 4BKQA 4FJ0A 1R4AA 4GYWA 1GG2A 2EKQA 2EFGA 2IXDA 2I2CA 3S44A 2QMHA 4EMBA 2HADA 2YWHA 4G0XA 3F7OA 1N2CA 4M3NA 4EUHA 4XGQA 1JTVA 3F74A 3ZHQA 2FRVA 5JDCA 3G17A 1JLLB 1I1NA 4EFLA 2HWUA 2RCYA 3DZDA 3H75A 3PQDA 2PUDA 3GO4A 3FSGD 4CR6A 2XUFA 4ZDIA 1R0BA 1Z7WA 4UVDA 2DHDA 2O4UX 4DSTA 2P9EA 4G4IA 3OCVA 4BLTA 4Z4IA 2DF8A 2J0QA 3FDZB 1JB1A 2HRQA 4LF7B 1Z0AA 2G17A 3AJ8A 1HDOA 3AUTA 1XZHA 4JL6A 2Y66A 5EESA 5CA0F 1ODIA 4C04A 5CB0A 1V8FA 3MT0A 3F6RA 4PY2A 1G7RA 3WYNA 1V4VA 4YV7A 1Y0BA 4MB6A 4M9ZA 1PQUA 4Q4AA 1OR8A 1XTTA 1ZH6A 3DAHA 1CULC 1N5MA 1U0FA 3UPDA 3S2EA 3TCNA 1EWVA 4JLVA 1NC3A 1UJ4A 3FFTA 5L40A 3WA7A 3DL4A 1B6GA 5HQ3A 1IBMB 4U2EA 4UHDA 1FX0B 1E2MA 3P9QA 1BWPA 1GTL1 1NKTA 1RD4A 1GZDA 2GPBA 3GBSA 1T0PA 3GD5A 1QH9A 2RHRA 4FX5A 4G5FA 1E1RD 2AFIA 1PUXA 2WYVA 3E48A 1N8KA 1ODJA 4LVOA 4UKDA 3NNNA 4JI7B 1P18A 1OXMA 1JKJB 3JZAA 1WW8A 4XKJA 3TGWA 1DQRA 2OAQ1 4DV1B 2I4RA 5EKXA 2CNWD 2HBQA 3G8DA 3QZUA 3R3UA 2CLLB 1XRRA 1YB2A 1ZH8A 4GC5A 4YRCA 2QG6A 1KS2A 2VHEA 4RPKA 3TQTA 5ALYA 1BCRA 5GAJA 1J56A 5IT9A 4IGAA 1ETUA 4CQNA 1KMNA 2Z8YM 1A82A 1GFSA 3MF4A 4FYIA 1KMIY 3VH4A 2VOEA 2YC4C 3KQQA 2PNFA 4ZV4A 4FR2A 1N0UA 4MTLA 5CXSA 1M76A 2AFVA 2Z6AA 3VHXB 4RD3A 4B0PA 1QJCA 3A4VA 4MW5A 4GMDA 4M6WA 1VL5A 5TJ9A 1OFVA 2ZRBA 4EQZA 2V7QA 3NEJA 1M33A 2W2PA 4KQ2A 1MO5A 2EGHA 3P0HA 4F45A 5ADHA 3O8OA 4UEWA 3BF8A 3G68A 1UP6A 1B1AA 2JKZA 1EIZA 5JATA 4QBKA 2PHZA 4ZZIA 1GRRA 4IQ0A 4BEVA 2JLYA 3OEEA 2VWGA 3BE8A 4N5MA 2F1KA 1WUIS 4EDHA 5KOYA 5ALRA 4OLHA 5DVZA 2G1JA 2HSDA 4EW3A 2JARA 4J49A 1R9JA 1TD9A 4BFWA 1KQNA 5FO1A 4D6XA 2VAVA 4FGWA 3WIOA 3H6GA 4C6TA 3G59A 3LP5A 3TJZA 5IYZB 3V8NA 1G2PA 2BBTA 3JVDA 4XR9A 3H6HA 3I6YA 3KTDA 1TA4A 1WEKA 1H6AA 3GJ5A 3PPVA 4MUEA 4WCDA 3FHJA 4LWZA 3STWA 3U2QA 3E05A 1E77A 2W93A 3L4SO 3VNRA 1IU9A 1HDRA 2NG1A 1WCIB 3QUQA 3P27A 3THXB 1SAYA 1YVDA 5ALMA 1YQEA 4KBFA 5AP9A 3NBUA 5TQ0B 3USZA 1O6CA 2I9KA 2C8LA 2BM8A 2QZ4A 4LHWA 3U44B 1OYYA 3P19A 3V3KA 3WK9A 1A9XA 4YCSA 2BZGA 2CE7A 1SVSA 3LA6A 1UJMA 2C03A 1JZSA 2WSIA 4ITRC 4QATA 2FPIB 2WWHA 4GM0A 3E18A 5EP3A 3PQ4A 1L7QA 5FI3A 3SHTA 3TNFA 5EJGA 5EZYB 1KO8A 4H35A 4I3HA 4UNQA 3T1TA 4A03A 1KAMA 3HU2A 1YR3A 1Z3IX 3M4JA 3A11A 2A9FA 4OHZA 4MLPA 5BWMA 4P22A 2RAVA 4WVFA 3LY5A 1XZJA 1OQAA 5TPWB 3SJCA 4LE0A 1HYHA 5I9TA 2YFQA 3TW6A 4ENWA 2P1ZA 1Q12A 5K09A 1E59A 4UAVA 5IT5A 2M1XA 1G7TA 1GZSA 1KJIA 4UCFA 1RWPA 1WUYA 5TEVA 3SQDA 4U7HA 1TJ4A 2RGRA 1OI7A 2PFGA 3O38A 4DLBA 1LPMA 5LKRA 3IQDB 4CV3A 1IN5A 2YW9A 2CLFB 1I3NA 3L8HA 4QDOA 1RC1A 4Q4JA 4UREA 1PS9A 1HLGA 2B34A 2D5CA 4V0ME 3VPHA 1EBFA 1OU4A 2Z30A 4COOA 2FLWA 3I5MA 1I7DA 4U5XA 4MQEB 1YIAA 2P8SA 5K05A 2DU8A 1Z5UA 4GXTA 3FN4A 2OKCA 1XOIA 2Q50A 3F98A 1PL0A 4I8XA 1WAMA 1PLJA 1ADGA 5G4LA 5AVXA 1VPEA 1XELA 1H2BA 3FVQA 1JU9A 4CMAA 1UPXA 2C9BA 1M1NB 5EHXA 4LFBB 4FHEA 4K9MA 3RKRA 3MCWA 3C1AA 3AR5A 2D7DA 1M1ZA 4LBWA 3FOZA 1DO8A 2BWJA 3G6WA 1M8FA 4N0MA 4OFXA 5EWJB 1E64A 3BRSA 2ZB8A 4QARA 4LJKA 2D6FA 1Z6AA 1ZKDA 4ZK2A 1TK3A 2Q3FA 4KZPA 4Q7LA 2EF1A 5DI3A 2IQIA 3EEYA 3U3OA 3TUIC 4RSRA 2SECE 3L4KA 2GASA 5K2MA 5CIQA 1I10A 3R3JA 1Z4IA 1ZRMA 2W2XA 3S2ZA 3BDVA 4BNMA 5B64A 3JZIA 3TSZA 2OSBA 1HKHA 1FZTA 2WPNA 3PRHA 2XBLA 1SD2A 3DAFA 5C4GB 1MEOA 2JGKA 2AC2A 2W6PA 3SC2B 1UBFA 5A4KA 2GJKA 3NVAA 3SEQA 3VYRB 4YDQA 3QXGA 3CLRD 2ISSD 3OJ0A 4XB6B 5DGDA 4DHWA 4IS3A 3UH0A 2Y1EA 4DV2B 3GJ3A 3AIIA 1D6MA 3GEEA 1CS0B 2CLIB 2QD4A 3Q12A 4RXTA 3KAQA 1YUNA 3FTCA 4X95A 3WK6A 2YRWA 1LPOA 5EHIA 3UJNA 3N9IA 2YW2A 3K2EA 1X7WA 1H0HA 1Q2XA 4KE7A 2AJ8A 3PPYA 4KACA 2EVWX 5ES4B 3P7MA 1F51E 4TPKA 4KDFA 2GAJA 1HZZC 5HKLA 1WOMA 5M3BA 3DBHA 2DMRA 5DLPA 3LBHA 1XT6A 4FMDB 5L3ZA 3G0HA 3KPWA 2NT3A 4LJ7A 3PWKA 821PA 1CUZA 4MQBA 1NUHA 7GPBA 4R54A 1T35A 2V1XA 4G56A 2Z98A 4C4AA 3JQFA 1XDBA 4A91A 5DP1A 1KR2A 3IR7A 4N8SA 3ZNPA 2XSZA 3NTUA 1Q7BA 4L3OA 4G1FA 4CM9D 4H1WA 1ZH2A 4X7RA 5H81A 4IDDA 2FMHA 2AMLA 4ZAYA 1V1RA 4IIBA 1Z39A 1FU4A 1S9HA 3OOJA 4JK3A 3DM5A 3GCXA 1J2TA 3LT4A 4DCCA 3AC0A 4HDCA 4H3KB 4Z2YA 1C9NA 3CT6A 3P96A 2AI3A 2RGGA 3O94A 3OWHA 3I5UA 4KH1A 2ONZA 3LA8A 1ZS9A 2Q46A 1YZNA 2N9UA 3MRXA 4MA4A 4OB8A 4DB2A 2I4TA 1UP4A 2OC4A 4YJ2B 4YP5A 2VAXA 4ZA2A 1WXFA 4I2VA 3U3JA 2P75A 5JROA 2R8RA 1JXOA 1KMHA 1H0KA 2QE6A 3GEIA 4FLEA 4KMSA 4ZDWA 3NATA 4IEEA 3WYDA 1BYIA 3ZK8A 2Z8ZA 4A2CA 8OHMA 4I1PA 3UAZA 2HF2A 4CPDA 1GFZA 1OT3A 5CA1A 1OMOA 4QFDA 3RROA 3RTCA 1RJGA 2PLWA 1J0BA 3OG9A 1KGSA 3DWEX 3A1NA 4UM9D 4HNAB 4BVAA 5EZYF 2ZJ3A 1FFSA 1T6NA 3ZY4A 3OWXA 2HCBA 4IUYA 1DDIA 5LQSA 4IXTA 2B4YA 4IRXA 1B93A 2H2IA 4F2GA 4FEAA 2QMZA 3CNLA 2WJIA 4CUZA 1S2LA 2WV9A 4ND6A 3UB2A 4I8IA 3SYTA 4RIHA 1N7IA 1ZCAA 4G1VA 3VV3A 4JR0A 4RLSA 4C3UA 5BWLA 1T24A 2VSQA 2VJOA 3TTWA 2ZBPA 4P7FA 4E1AA 1LWOA 1GFWA 1SKQA 5AR1A 3EF3A 3N07A 1EGAA 4C22A 4ZD6A 1FW6A 1M83A 1EFLA 2EGUA 2NUTB 4N5IX 1D07A 4AKIA 5GY7A 2JD0A 3ND7A 3R77A 4R8LA 5F5LA 5CUQA 5EPUA 2H7XA 2ZK7A 1A76A 4WPGA 1GIAA 1KQPA 2V5VA 1JB9A 2I62A 2LIVA 4QFCA 1N1DA 4TKVB 4UEKA 4FFBB 4UXHA 5E4YA 3K70B 3WGGA 1ZITA 2HOQA 2XDQA 3UFXB 4K1XA 2FN9A 4KWTA 3SQNA 2ZUCA 4AMGA 3QUCA 3S5UA 2X76A 5CYOA 1QP8A 1P2SA 2VS1A 4BNDB 5KYTA 2WMYA 4O1MA 5BSHA 4XD7D 2O8DA 1B74A 4EECA 2EW1A 2OG1A 3PYLA 3D6VA 4RFVA 4D57A 4RDHA 2A3NA 1KI7A 1VGVA 1G63A 1OTYA 1QOPB 3QA3E 3VC7A 4BRUA 1QAQA 2I6UA 3D8SA 4NE9A 5G0UA 3H2YA 1IPHA 4ER3A 1G2OA 4QYMA 2FKAA 4GRIA 3PX7A 1O95A 2WKRA 2XTZA 3DXYA 3WV5A 4BZPA 2VYVA 2EFJA 3I72A 4E5MA 4X20B 4F5WA 3SX2A 4CTNA 3OUZA 2VN8A 3Q3HA 1KHHA 2ZBQA 1V11A 2Q6KA 2QQEA 1IK4A 2FWMX 4O2LA 1SXGA 3WOVA 5DM1A 2NUAA 3NW9A 5JMWA 2EX4A 1SHZA 2X4DA 4CTKA 4PLWA 3NM6B 2WFLA 2XTAA 4FZ5A 1S2OA 2YWCA 5EJIA 4V1CA 1I4TD 3UJBA 4W5QA 1GPUA 1Y8RA 2CMFA 3ICCA 3LF2A 4RHUA 5EWMB 3UAYA 2I4OA 4I7EA 5IVPA 5JEEA 4RTRA 3L8YA 3MINA 4PPFA 1AV7A 2PSFA 1SCNE 4YRKA 1UJ5A 2ADOA 2GZ3A 3RAGA 5I45A 3EIHA 5FWXB 1Z7GA 1SHUX 2EBFX 1A8HA 4D4KA 5ITZA 4FE7A 3SXJA 2UYCA 2H1LA 3FJ1A 1JMYA 1RWWA 3GVHA 1BEUB 2FFAA 2SKDA 3HM2A 4U2CA 1ZVJA 5FUWA 4CDNA 3WP1B 3TG8A 3ZVMA 1LD3A 4OAQA 1R0WA 1Y8AA 3HY3A 1VHLA 1WUTA 5FYQA 2AF4C 4Y18A 3L7IA 4HHEA 4BGEA 3LX5A 3AEKA 3KTAB 3SZMA 5KYXB 1IWPB 2XQVA 1B2RA 4N8DA 4E6EA 1QK4A 5JCOC 3HB5X 5JFOA 1H23A 4DUPA 1SHTX 3D9QX 3L0DA 3ICEA 2GM9A 2C1EA 1CZKA 3K9QO 1IZZA 5KNCH 2XXBA 4FHZA 1Y3FE 4D3XA 4UM9B 1KRWA 3DMYA 3UOWA 1PUIA 2FWJA 2ZQ5A 1IB6A 2PQMA 3PGMA 3BMCB 1HMYA 2CYBA 3AZPA 3ENKA 4Z9BA 2NU8A 5HKBA 1YTUA 1DGQA 4LZLA 3EVAA 4C0BA 3PDUA 2W2MA 3OCJA 3H05A 5HFNA 5CNIA 4CM4A 5LMCA 1SY7A 1WLSA 3HXLA 4H77A 4J2TA 5ARCA 1M54A 2XUOA 1RRKA 1TNDA 5IJXA 2LRHA 4LV6A 1UDBA 2Q62A 4LS3A 4MQMA 4ETNA 2KE5A 2WJZB 4S35A 4BTEA 1U9JA 4URZR 5CR9A 5KOIA 3MMZA 3E84A 2EP5A 4NJOA 4E1VA 1GOTA 5JXHA 2QSUA 1EJ2A 5IN5A 2YJTD 3NAQA 3Q2IA 3F49S 3FNFA 1XZGA 5EHNA 3OHSX 4JB2A 4MI1A 5DI9A 1SKYB 2TECE 1P2DA 4D46A 4BPBA 1EVLA 3QBJA 1LVUA 2RHWA 5FUQA 4RK1A 1SR8A 3SN6A 3ZTYA 5C4IA 2UYOA 4TQGA 3CBQA 2HMYB 1O4WA 1A5AB 4L0DA 3KLNA 4ZQEA 1N2GA 1NXVA 4G5QA 5HQJA 3EZYA 1HRKA 3JWIA 1JHUA 4BX8A 2OILA 1QF9A 1S1CA 4K86A 4UFOA 1D8AA 1GNPA 1NZJA 1BKDR 2DC1A 3CEJA 4O4HA 3TMYA 3AFMA 5ALDA 4AS2A 4AKTA 3U3XA 1AJEA 3PQ5A 4IEFB 1YFLA 4JELA 4UD2A 3HXMA 1J8YF 1N92A 3QG1A 2RARA 5ANRB 1FXWA 2WJWA 5DOVA 4L6IA 1P45A 2EFYA 2OPHA 5EIOA 3ZLVA 4BUJA 4WEOA 3ZWQA 1A1SA 4HR7A 3I2IA 4BMYA 5JO0A 2XZOA 1XLWA 3KKQA 4D26A 3T5CA 4CI0B 1UAYA 3HCEA 3DTYA 4NBVA 1H8EA 1ULUA 2WYWA 1IUNA 3KQYA 2Q5IA 4M55A 4PFJA 3UT5B 3TZLA 1NAIA 4BWFB 4EY4A 4EENA 4M8LA 2G06A 1WZCA 1OX6A 1HL7A 4HWKA 4YAGA 5JRZA 4ZEMA 3D6FA 3C3JA 4MGHA 4WESA 3FOWA 4LYHA 3VPXA 5CVCA 4C4TA 3WAGA 1NVAA 3I0ZA 4NE2A 2GCPA 3ED1A 5F2OA 3CW8X 1MFZA 2ZTVA 5F35A 3CRMA 3DDCA 4OJMX 2VTKA 3N5CA 4WCFB 3UJAA 5FDFA 4R9RA 4NR0A 1ISIA 2DFLA 4R0VA 4GPBA 4G0QA 3K70D 5GV8A 1PE0A 1KNXA 3U7HB 4JX8A 4L9SA 4WECA 2Z1NA 1YL5A 4XUGB 7MDHA 2KB0A 5LYJB 3ER9A 1VB3A 1JPUA 2OD9A 2QTNA 4TWZA 2CJPA 2D7CA 5CDFE 3RYCA 4N76A 2M98A 1MPTA 2GXUA 1ECGA 5FBLB 1KWGA 2C5SA 3NR2A 4NZ9A 4PZCA 4C7KA 4TVOA 4RPGA 3PDHA 4CTOA 3QBTA 4IDBA 3QJ5A 4F93B 3D6AA 2WHPA 4M1SA 3BWVA 2UV8A 1EGHA 1V16A 4P54A 4JROA 1GZ6A 3AJRA 4EVIA 2WTBA 3R09A 1T1IA 1Q77A 2AZDA 2ERCA 3JQRA 1LEHA 1UAGA 3HJAA 3ESYA 1SU8A 4JAVC 3D4OA 2O2CA 1N9GB 1DIBA 3ZIAD 4Z1OA 1TLTA 1TZ2A 2AG8A 2V7WA 1CUYA 2O2YA 4ZV9A 4B17A 2V54A 2LIPA 3MCAA 2O1SA 1MAWA 1U7XA 1Z2CA 3K16A 4WKBA 4YJHB 5SYNA 1OU0A 4Z49A 2ORVA 1X94A 1U9IA 3I53A 3M5PA 5E2IA 3TZ6A 2JJ8A 5JJLA 1LVHA 4MGYR 3UUFA 5C8VA 1P0IA 1OXSC 3RAJA 4JU9A 2XJ9A 2VDQB 2CDRA 3IXLA 3BMXA 3ZE0B 2ZDGA 1CJCA 4BIMA 3WAJA 1Z9BA 4P33A 3HB7A 2WM9B 4P4TA 2DHCA 2V9ZA 2EJCA 3VMFA 1PEKE 2PL1A 4BBZA 4CKZA 1NIPA 3SLGA 2BCJQ 4P1ZA 4E31A 1HSOA 4K7JA 3BXFA 3HSSA 3HJFA 1USUA 3R9IA 2HNBA 5BVHA 3PDIA 4XYMA 3WKBA 3MYRA 1JLSA 2G4CA 1DMSA 3GFQA 4RK4A 4YJ3B 3DEYX 1II8B 4DTCA 4ER6A 4HGQA 2LKDA 1KKMA 1ECFA 1LB1B 1XQXA 3DT6A 4OHXA 1RLMA 1PFGA 5HPYB 3KCQA 4Q3CA 1PKEA 2IOHA 1X1BA 1SULA 5EFOA 1MIOA 4OQZA 2Q27A 1F8YA 4L1KA 3CRQA 1E1QD 2ZE8A 4PS1A 1YK0A 3WB0A 5CCXA 2PGJA 3U60B 2DRIA 3OQ6A 4FD2A 3GFGA 1GAQA 1D1TA 2FFHA 4IZOA 4NZMA 4QJ5A 1NVDA 3BJMA 2IYVA 2PT9A 1U2EA 2W2KA 2XMDA 2PMWB 2IXAA 1TZJA 4S04A 2QIPA 3G7NA 2PN1A 221PA 1F2TA 1C41A 2ZB7A 2J6HA 2ZRGA 4M1WA 4RDIA 2ZPUA 2BFFA 4K8OA 1USKA 4N6NA 3QF4B 2OB1A 3I6QA 3ED5A 2WWRA 5IF9A 2J9FB 2W2LD 1V71A 2W8BB 1UT5A 1NXPA 4KSYA 2RJOA 4RSMA 4WQMA 5IDWA 3A0UA 4LXXA 3E82A 3VDQA 4AQ7A 5COQA 4ALKA 5AW2A 4GWKA 5C31A 3NWEA 3D4LA 4L28A 1CUXA 4ZVQA 2RB4A 3IP3A 5JD5A 5ENZA 1JLLA 3OIYA 4QYIB 2OV4A 4U3JA 3BXEA 4N1AA 5EQFA 3V9PA 4B2IA 4DCSA 1PWEA 2ZIGA 2F9FA 2X9NA 2J07A 3GLGE 1LBIA 2ON6A 1Q7GA 1H9CA 4QRIA 3Q8XB 4PLZA 5BW5A 1PT5A 1YAJA 4U4AA 1LRJA 4JB3A 3RIGA 2DULA 1KO1A 1XXHB 2E4UA 1W6UA 1G2QA 4O4JF 4K3VA 2FK7A 4DV3B 2WG1A 4HDMB 3TL6A 3BCHA 3R5JA 1NWCA 2HLPA 2Y2UA 4DUZB 1J9ZA 2A92A 3EVNA 1Q1GA 3BFKA 3EUEA 4RY8A 4TMZA 5C52B 3FKSD 5C8ZA 1MABB 3A04A 3AY7A 4U39A 3PTAA 2AE2A 4CIVA 2E4AA 2D5BA 4PE5B 4BFYA 4FZ3A 1BJRE 1V9CA 3KQHA 3ITEA 3HDGA 1QB8A 3CEMA 1MX3A 2H59A 3ESRA 1EFDN 1DRWA 1T6YA 5IM4A 4R2LA 5ICSA 1EWYA 1CF2O 2J9FA 3NS7A 1GLVA 3JW8A 1UF9A 4TMXA 2V65A 3JQ9A 1E0AA 2R5FA 1YL7A 5AJUA 4X71A 2DBVO 1JBKA 1CEXA 2HXGA 4UDOA 2RK3A 1MJNA 2W6JD 4M8NE 3VYTB 2XPCA 4JI4B 1ZICA 2IYNA 3SS9X 2GCNA 4MAFA 1FBNA 1N3BA 4NBKA 1ZOOA 5FA5A 3DUFB 2Y99A 4EX6A 1KZ7B 4DDVA 5AVUA 4S0XA 5DULA 5KTKA 2NU6A 4KXXA 3PNLA 5CB4B 3U17A 1NPTO 1VI5A 2GCOA 1X8KA 2GWRA 3V00A 3I39X 4F6RB 5K0SA 1VJ5A 2V74B 1ETHA 2XGGA 3DYVA 3DAYA 2GBLC 2WKPA 1VCNA 1YASA 1M67A 2DAPA 2YXDA 2QWXA 2PNJA 3PLRA 4YT8A 5ESDA 4ZQBA 1M3SA 4RQBA 1G5FA 4MV6A 3GA0A 3AT1A 1M1YA 3BXZA 2FWBA 4Q34A 5INTA 2WZCA 2QLNA 5EWLB 4B6GA 4DXAA 2K5UA 4B87A 2QQFA 1E9CA 1NNUA 1OFTA 2JRLA 5THKA 2Y6UA 3N2NA 5HUJA 3R75A 3AVTA 5K3SA 5DMXA 2D4HA 1D9XA 2CVOA 4G26A 4DILA 1MX5A 2QRHA 3W8EA 4DMMA 2PYIA 3O8OB 3GGPA 1AN9A 2IDMA 3OTQA 2HQRA 1E79D 1RI5A 3I9OA 2PJDA 3L8DA 1NU8A 4MJ3A 4KFUA 5ED0A 1L9XA 2X5NA 1DWQA 1RJFA 2ECKA 2ABWA 3D43A 3FOBA 3PLNA 5CU7A 2HJRA 3CNBA 3N76A 4RUKA 5GJWC 2IEYA 3HLYA 2ZSKA 2GPJA 2Z2JA 3QKIA 2JG3A 1G42A 3KEOA 2CL0X 3DFUA 1KY5A 4ZT2A 2QTCA 3IHLA 4BQIA 2Q1SA 1GZ7A 2XNJA 1VG8A 3TPFA 4RETA 1WB9A 5T67A 5JTUA 3EAQA 4BJHB 1D4AA 2HQBA 3MWEB 2JAOA 1SU7A 3TZBA 3RT7A 3MCVA 3AP3A 1Q16A 3NGLA 2X3YA 3GY0A 4TL9A 4W1QA 3PNMA 4RA6A 4QVGA 4ZIRA 3N0VA 3ACCA 5JJKA 4TZKA 3LBYA 5H1YA 2IHKA 4L22A 4NBRA 4YPOA 2Q6LA 4X20A 5CFZA 4V2IA 1MORA 4PRYA 3DKKA 3D64A 3HKCA 4R3NA 4MI6A 3BMQA 2PTHA 1YONA 2KLHA 1UBKS 3DHVA 3CWQA 1E58A 1XE3A 4QU9A 5TQ0A 1ZBQA 2JGEA 5KNCD 1JEYB 5ER6A 1MO6A 3U5ZB 1IIRA 2UVDA 2CZCA 3N0RA 3L79A 5COBA 3L9WA 4C78A 1DX9A 3AEQB 3AR4A 1YULA 2IPOA 4DLNA 2PS0A 2WT4A 4PZUA 1JI3A 1IM2A 1J0XO 3CU5A 1NXWA 4YMLA 2P30A 4MLDA 4GLFA 2VBFA 1CDOA 2WU4A 2W11A 5HTKA 2D06A 2QRZA 4GBMA 4C7XA 3AFHA 2V7UA 1Z73A 5FR2A 4DMFA 1EZ1A 4DQXA 3CMMA 3DP9A 3QE0A 3VVMA 1U2DC 1CFZA 4KSCA 3HZHA 4TGLA 5DO9A 2DHQA 3KQSA 4IJUA 1P6UA 5BQFA 4DSNA 4CLXA 4HEJA 3BC1A 3KUKA 4ARVA 1U0HC 3W05A 1PYGA 1GU0A 1XK6A 4AKSA 3DE2X 2MCFA 3K0EA 2DZDA 3GGOA 4CKBB 4PSVA 5FLYA 4FQ5A 4AY2A 2IS2A 1RM4A 2ZIXB 1H2WA 1VPLA 4Q4DA 5CAEA 4AZSA 4L6AA 4DNOA 5F7ZA 4MR7B 1QE0A 2FPIA 1ZVQA 3GPDG 5T5QA 2BGJA 5CVEA 3LGAA 2PE5A 1Z2AA 3RSLA 1AS0A 3GOQA 3F6BX 2G9QA 2IEDA 1QK5A 3KOYA 3GMDA 3O26A 3C8ZA 4OFWA 2FJUA 4RJJA 4W1SA 3P2EA 2B9EA 1XZFA 4V24A 3GHHA 3IC5A 4YLEA 2FLKA 3AEUB 4AJIA 2C00A 1HM5A 4ZAFA 4X1YB 1HK7A 2LCIA 3QY0A 4XVCA 1QLHA 1GRNA 2I33A 1GU7A 2IZZA 3WGNA 2W2LA 3KFVA 1PT9A 1AKYA 1RKQA 2JBAA 2R5WA 4DR3B 1P91A 4IQFA 1BXRA 1LJUA 2JVIA 3IDQA 4OY3A 4PQRA 4AQYB 4Y6PA 4ACAA 1G2IA 4HAZA 3R23A 4TLEA 4GR4A 3W77A 2OWEA 1QYIA 1VG9B 4R8KA 5EXEA 5T4FA 3AXSA 4ZI5A 5ABPA 3LUGA 5CAEB 3INGA 4DV4B 2PWZA 2YV2A 3N28A 3Q9UA 4IOLA 3TI7A 1OGYA 1ULSA 5JAUA 1G16A 1YZQA 3H99A 1N5RA 1JU3A 3C3CA 3O3CA 2I80A 4N0DA 3ZYCA 4C3OB 4E2XA 3E22B 3SVZA 3GLTA 4QDZA 3AL3A 4GBED 1XUOA 1SC9A 1DTWA 2NU7B 3QLVC 5E9AA 3AM1A 4TXNA 5KJCA 2XNDA 3KYCA 4XTRA 1RU3A 1Y1TA 2C59A 4O33A 3UJDA 4AO7A 3ILSA 2PKWA 5BQXA 4TTJA 3ZEAA 3ES9A 4HGZA 4DZZA 2PO7A 3C7AA 4B3HA 4B6QA 4QDTA 4RKRA 1QH8A 2YWDA 5FFNA 1SEVA 4YS6A 2QT0A 3PQ7A 5AK0A 5GZ1A 3GLIA 2JBAB 1IPEA 4Q05A 4R6XA 4KJZA 1D2GA 4A15A 2PZGA 1FDRA 1E9FA 3COJA 5HIIA 3KZ1E 4YUVA 1LCIA 2WJVA 2O7NA 3EY9A 1S8AA 3DBHB 1KJYA 1JPNA 1JQKA 1V7QA 5EOVA 1MOZA 2HTEA 4Q39A 1SXJC 4K88A 3CUWA 5P21A 1ZNZA 3ZCUA 2I3GA 1WXWA 5IC4A 3KLBA 2BFPA 5JRDS 2AQHA 3DBRB 3V48A 3QK7A 5CFLA 1M0SA 2QENA 2J1LA 2YIJA 4F96A 2YVQA 1LNSA 2P4SA 3VDNB 3AH8A 1Y9AA 3KV3O 1U0OC 4J0DA 4IGFA 3AUJB 3A6KA 2QMUA 2ZYGA 3H4IA 3ORRA 2L69A 4HX9A 2BGUA 3A8TA 5FKJA 4HNTA 2OV2A 3BIWA 3GH3A 4MGEA 2WNHA 3H86A 4H7HA 1Y7HA 1E20A 3B85A 4ZHQB 1I4EB 3MRTA 4QWWA 4XVHA 2HK6A 2WZQA 3L49A 3P4XA 2JFUA 4JT2A 4RLHA 3DG9A 3W79A 1FY2A 5KIAA 3QKTA 3VJLA 5IZCC 3K7EA 1SD5A 3KYIB 2X6RA 1UFKA 3L93A 421PA 3MNFA 3RVDA 1U2ZA 2WJ4A 5G2OA 4HFMA 5EVCA 5T8KA 4CFZA 4JN6B 1HTTA 2JBWA 2GPTA 1QAMA 3KZKA 1OA0A 1P80A 3P9SA 2C9CA 4DJAA 1MQ8B 4CM1A 1ESMA 3NC4A 4UZFA 2GKSA 3EW7A 1GPKA 3AEYA 3LQFA 3EGCA 5ALEA 1RABA 3KFXA 5L7YA 1XP5A 2EU8A 2DQ4A 4W6QA 3M6FA 2QVLA 5IAKA 2GRUA 4B80A 1GDHA 1KI9A 1GKKA 1HDEA 2W6QA 4GF5A 4ND3A 5ALIA 4TVSA 2OKGA 1XG5A 4Z7QB 4KR2A 2OAGA 5AK4A 2R6JA 2XNKA 3ELDA 3IBTA 4QYSA 4TMVA 3PXDA 2ACWA 2YIDA 4G01B 3LBNA 2BM0A 3K1AA 1EYZA 4DHEA 2NUTA 3EAGA 3W7AA 5JYEA 4MKGA 4FB4A 3LM8A 5KNBD 1PX2A 4L5CA 3V4FA 2R1VB 2W6NA 1RNLA 2B20A 1NW3A 1XXLA 4Q1BA 5LC1A 3FE2A 3VVBA 3IP7A 3RGWS 2JJYA 4UM5A 3L6DA 3W78A 5KNDA 2QOEA 2EFCB 3FHLA 2IIBA 2PCJA 3PUIA 3THRA 4DDHA 5HWSA 4DLTA 3HKDB 3H2BA 5KINB 2MYPA 2BE9A 4P58A 2XUZA 3THWB 1YJBA 2OM6A 1EFCA 3IJEB 3AVUA 1T2AA 1LX7A 1TL7C 3GFSA 3KQOA 2XCRB 1ZUIA 1ZEMA 4YUXA 2GI4A 1IONA 1NZDA 2Q3CA 1TE2A 1O95C 3F7TA 3GFTA 3LK7A 1RTTA 2DSTA 4LMPA 3KYDB 2XIJA 4WINA 3QPVA 5F1YA 5GIPE 8MHTA 3WAKA 3BB1A 3OP1A 2EBWA 3LXRA 4NYJQ 1GUFA 3IIIA 2H5IA 1U3DA 4QU8A 4PHCA 4X45A 4YP0A 1Z7BA 1GPBA 1WRBA 3A3KA 2ZOSA 2R8EA 2YV4A 2Q3HA 3PK0A 4YIKA 4CF7A 5BXQC 3FAZA 1C1HA 1XAJA 4JWKA 1CUSA 4M54A 3TN7A 2BH2A 3OM1A 5H83A 1IQUA 5ALSA 3L7DA 5LB4A 5C4MA 5TGZA 3PUXA 1R9MA 1UDCA 5TNXA 2QJWA 4DLUA 4IIHA 1CRPA 4BV2A 1PV4A 3JQ8B 3KB8A 2ZSUA 3N1UA 5EINA 3L6CA 4B6JA 2JIBA 2I5PO 2VJLA 4V03A 3CTMA 4C89A 1ENOA 3VO8A 1R3DA 3M6MD 3ZHZA 2IOQA 2YOFA 4ZVNA 3BA1A 2VSXA 2Q41A 2OOKA 3D6HA 3PL5A 3CNQS 4PZLA 3WKEA 3FCAA 1HYBA 4U7WA 4UFNA 2PBZA 3SF0A 2VVTA 1TM2A 4JS0A 3N2KA 1P9WA 2DP4E 3T1NA 5TQJA 2DEUA 1EEHA 4R1SA 1SBTA 4HB3A 3R7NA 4BVBA 3R5HA 521PA 5IJ9A 3DOOA 3HP7A 1ZK4A 1IH8A 3I6IA 5ITSA 3EXG2 1GA4A 1Z0IA 4PPYA 1WO8A 1FFCA 4IIFA 1FC0A 4LXYA 2IWRA 5J2TB 1QU3A 2XT9A 3KQKA 1QRAA 3D8BA 4Q9KA 2LGJA 3L05A 3WLOA 1FX1A 3GCGA 3ZU2A 3KFLA 1W46A 4FCTA 2AXQA 3HBAA 3PC7A 4YRSA 3CO0S 4K46A 2A57A 3IBSA 1IN6A 3N7UA 5CGQB 4Z9FA 3SOPA 4EHFA 1JE0A 1E0JA 1Y37A 1E8DA 3JQDA 2PZFA 3PCRB 1AT1A 2AG6A 1I5OA 1J8FA 2IPXA 4EYQA 5JISA 2OCBA 3T1YB 1IIBA 3P52A 5DN9A 5HMMA 3BZBA 1V8BA 1Q22A 5DCYA 4E7OA 1IBKB 3UAOA 1HDGO 2GB4A 5KYUA 3WGUA 4IICA 3ET4A 2CXUA 5JW6A 3U7EB 4G6ZA 4B3JA 3DHNA 3RTDA 3VO1A 4PO8A 2XZPA 5TT1A 3HVRA 3OY2A 5LP6F 2DG2A 4DJEC 3WBKA 4QTYA 1RMQA 1OREA 1ML3A 1AQUA 1X1AA 3ONEA 2X9LA 3JQ7A 2WVGA 3K09C 2DFNA 5A1JA 1GVHA 2QLMA 1KVSA 4C14A 2I99A 2OQIA 4HGOA 5JYBA 3Q6IA 5ILOA 1H85A 1K0FA 1WKBA 3T4EA 4E33A 2FQQA 1TQ8A 1YUBA 4WI1A 1EUQA 2QPLA 3G82C 4XWWA 1V47A 3IO5A 1V1MB 2NN3C 3OIWA 3RYIA 2A35A 2A84A 4WZZA 3DKIA 3GRCA 1GUZA 1Z4PX 2F3SA 2OBMA 5KHOC 4J4BA 1Y3HA 4CW7A 4EYSA 4BCBA 1CDDA 1K8ZB 1I33A 2FRDA 1EM8B 2HQ1A 2UYQA 2VP2A 3CEHA 4OM7A 4WKOA 1C4OA 2QRNA 5K0CA 4U6NA 5T41A 1Z6XA 4GL4A 4O29A 4B9AA 4HPXB 1SQ6A 1NQXA 3GG2A 4NCJA 4B3MB 4FGLA 4PLVA 3ZD9A 3CX6A 3BFXA 3BTSA 2FW7A 3PXGA 2QD3A 1DPFA 2FN3A 3R7SA 3KUUA 2OQ2A 1FDIA 2PSSA 4P8RA 5J4KA 1M0EA 5F9HA 1PAUA 3CCFA 4BKRA 3AFGA 1P4JA 4RDXA 1QS0A 2AE1A 3I30X 5I4IA 4XW2A 3GPLA 2ZSHA 1N2IA 4C4OA 1ZIYA 4KQ9A 1QIMA 1KP9A 3WRWA 1GGEA 3D3KA 4RQTA 2WNIA 3OOWA 1TO1E 4YMHA 4BLRA 5I7FA 7YASA 3LIIA 3AEXA 3RYIB 1KEUA 1F48A 2BFEA 1KYVA 2W43A 1EG7A 2ZUBA 1SBNE 2PJZA 4LDPA 5IK2A 4NZZA 1SH7A 1JYEA 1B8UA 3GJXC 4D99A 4UFPA 2VPYA 3C8UA 1EM8A 4MP3A 1NMXA 2PT7A 1E92A 2MINB 3KHKA 5FQNA 1P4GA 5FBZA 3N87A 4HDSA 1X1EA 3L0PA 2EEPA 5COAA 2CKMA 1UMDA 1UZAA 1IDOA 4EVSA 4N0EA 5FPHA 3PF8A 3JD4A 4P4LA 3EPHA 3DC7A 3R1IA 5LU8A 1V9SA 3AHDA 5DEIA 2LW7A 4JC4A 4DLRA 3OF3A 1BU8A 4LRXA 5LP6A 5I4CA 1CRQA 3DCNA 4NU8X 1ZD2P 1OROA 3DL0A 2B8WA 2QSZA 3A3NA 3VISA 5B1SA 1DCFA 3MWDB 3LLSA 4MQ5A 5C51B 5C3UA 1HFJA 1WVGA 3DAPA 2O50A 4YVFA 1M1YE 5M04A 3OPYI 4Q03A 1IATA 5JCXA 2AGVA 3JR7A 3ANTA 2RCNA 3HHPA 4RZQA 4WESB 4LZJA 3EARA 3U7QB 3VO2A 1XO1A 4IDHA 1MG0A 5LOVF 5H68A 4X9XA 3TAXA 1H3EA 3EBLA 1LSOA 5CX1B 4H3HB 2FUNB 5CCEA 4YREA 3HVUA 1C3XA 4S2EA 3ZOZA 4LDNA 1IVYA 3LT5A 4RIEA 4EJMA 4TLDA 4BP9A 3L4BC 4CKWB 2JF0A 1LNZA 4WV3A 1N8SA 2IZ1A 4MW7A 1AKNA 1G5QA 2NM0A 2V3WA 3H13A 2EBUA 5DOZA 5LL6P 1L5HB 1ZD4A 2HMAA 2J5QA 2V7QD 3FTQA 5FAKA 3ZJUA 1G6OA 1WR8A 1H9AA 2I9PA 4FFPA 5CIWA 5K03A 4NG5A 1JAHA 4E13A 1DINA 3FDIA 3OFJA 3PRYA 1IEXA 4KWIA 3ZOKA 3ADBA 4F5YA 1WEHA 2C95A 1L7OA 3M81A 4ZYUA 3M4ZA 2IH2A 3V8MA 2MSEB 2X2EA 4L2IA 4NP6A 4II2A 3MWDA 3LW8A 4S0ZA 4H3SA 1QPZA 3RWMB 5E6SA 2PVPA 2BJVA 4A10A 3NBQA 4GOLD 4I6JA 2AC7A 4FFRA 1E94E 4M0DA 3ODGA 2G1KA 2QLJA 1O08A 2G28A 3EVEA 4NULA 4KXWA 3JQGB 4QUJA 4YRPA 1ZJWA 1I9GA 2QP9X 3NVMB 2HWXA 4MCAA 2REXB 4FMPA 2QIOA 1J2UA 1LQTA 2FPMA 2OZKA 3GROA 3G5UA 5JE8A 1PG5A 3TB4A 2D5IA 3L8FA 4C88A 3ENQA 2HDHA 4CR8A 1QONA 5DW3A 5ENDA 1PO7A 3ENWA 4ZTBA 1DIRA 2I76A 2Y77A 3DOJA 4X8MA 4IH4A 4IHJA 4N40A 5JVDA 2GA8A 2CEAA 3E3MA 4ED9A 4NFLA 1YDEA 4IDQA 4AX8A 4EAAA 3EA5A 5IXJA 3R9WA 1ZAYA 3RFTA 3FWPA 3DEJA 5JNWA 2G7ZA 3HNRA 4P92A 4G8DA 2FW1A 3K5PA 4IWYA 4ZVPA 3BQMB 1O8BA 2IS4A 4KR3A 1CQZA 4ND7A 1MBZA 4UMVA 2R1ZA 1MNAA 3AVWA 4F9FA 2XVAA 2E4XA 3SZ3A 3KE8A 3HH8A 4WAUA 4R4JA 5FYDA 1LA2A 4JHLA 2WW8A 5C9ZA 1XGKA 1E60A 3CNHA 4L7VA 2BL4A 2XMQA 1P17A 3KS9A 4J0CA 2YJNA 4CTMA 4Q1CA 4YCAA 4D97A 4YMSA 5JR3A 7ADHA 1ZQ9A 2XYGA 1EFUA 1XZ8A 5ALUA 5AW4A 2ZRAA 2X86A 2ZUUA 4EKIA 3ROGA 4AD8A 3WXMA 4OOEA 3ZV6A 5GONF 5H3CA 4N3CA 3IDOA 4AF7A 4MQUA 5G0SA 3IEVA 4U0KA 1PLLA 5ESRA 1H2YA 2YJ4A 4IQGA 5ESXA 2PA0A 4WXRA 1XRLA 1P5HA 1TB4A 2ZBEA 2OFOA 3QE2A 4KLNA 3WQQA 4QA9A 3K6JA 4DSAA 3R6WA 2YCLA 1QZUA 3UW3A 2FW0A 5MN6A 4XYGA 1JUDA 5ECWA 4RYDA 3K1YA 3R3VA 5BN3A 2VDNB 1FE8A 1ZY2A 4LG1A 3JATB 4OFBA 3ITKA 4RIFA 4YJFB 3ZE6A 3P5BA 1U0GA 4MIOA 4WMLA 3VXKA 5U9CA 1TZBA 4FFBA 1TYEB 4HY3A 5IUKC 5A6VA 1P8AA 2GN2A 1P74A 1YMQA 1GWNA 4OAPA 3QWFA 3BMNB 3C16C 4U3JB 1RHRA 2HUNA 4PGGA 3K9LA 4LF9B 1ZRSA 4HF7A 4G2NA 2HK7A 3L7LA 3IOYA 3O8BA 4HAIA 3FI0A 3TOSA 2CCGA 1RZRA 1Y1RA 1PGPA 4MA0A 2QVCA 1HZZA 5ESWA 3PRJA 1JDSA 1HBJA 2YBEA 1C80A 4HDKA 3M3PA 4MW0A 3LPMA 2QX9A 4QGBA 4U2BA 3D3EA 4YI5A 3ZBUA 5P8WA 1SXHA 3D7NA 2IW1A 5L53A 2OBLA 1HKUA 2VJMB 4M36A 1EFKA 3WISA 5JLJA 4YRBA 4PLGA 1DCMA 4ZK6A 3O8QA 5L3QA 1M7HA 1KEPA 4QWMA 2H9IA 4WEQA 2HHCA 1QGYA 2FG7C 4OK6A 2P65A 3ZHRA 3R3SA 1GYPA 1LTQA 1W1IA 3BA6A 1RXUA 2HI0A 3IMEA 4HO1X 4YACA 4A4DA 4DMGA 3BKWA 4YCCA 2VDRB 1O89A 2J7KA 3P0EA 4FCWA 3VO9A 1GTRA 3AY3A 2EZ4A 3ESZA 4FM9A 1JLRA 4GRDA 1QPBA 4MWDA 1SQ0A 4H4CA 3T7SA 3VTFA 4C4XA 1RM0A 3PWSA 5DASA 3RVJA 3NJ4A 3U1TA 3MGKA 4IZ6A 1SWVA 2OECA 2WAXA 3FF1A 4F5DA 2K2QB 4GZ3A 1Y3CE 3WHLA 5JAMA 1E9AA 3V4SA 1WB4A 3DTVA 2WJAA 3NU1A 1FQJA 1AA6A 1ZN2A 5E6RB 1RPTA 2O7VA 3NYQA 4WDRA 4X6XA 1CVRA 1K3UB 2R1UA 2GHQA 1S7CA 2CUZA 2HJHA 4IJWA 4W1PA 3RSCA