The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
Knots found |
|
sequence length |
151
|
structure length |
151
|
Chain Sequence |
YFQGMLKNIDPALNADVLHALRAMGHGDTLVISDTNFPSDSVARQTTVGKVLHIDNVSAARAMKAILSVLPLDTPLQPSVGRMEVMGAPDQLEPVQVEVQQEIDAAEGKSAPMYGIERFAFYEKAKQAYCVITTGETRFYGCFLLTKGVIP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Sugar binding protein
|
| molecule keywords |
Hypothetical protein Atu2016
|
| publication title |
Crystal structure of protein Atu2016, putative sugar binding protein
rcsb |
| source organism |
Agrobacterium tumefaciens str.
|
| total genus |
36
|
| structure length |
151
|
| sequence length |
151
|
| other databases |
 KnotProt 2.0: S +31
|
| ec nomenclature | |
| pdb deposition date | 2006-12-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05025 | RbsD_FucU | RbsD / FucU transport protein family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | RbsD-like fold | RbsD-like domain |
#chains in the Genus database with same CATH superfamily 1OGD A; 3P12 A; 3P13 A; 1OGE A; 2OB5 A; 2WCV A; 2WCU A; 1OGC A; 1OGF A; 3MVK A; 4A34 A; 3E7N A; #chains in the Genus database with same CATH topology 1OGD A; 3P12 A; 3P13 A; 1OGE A; 2OB5 A; 2WCV A; 2WCU A; 1OGC A; 1OGF A; 3MVK A; 4A34 A; 3E7N A; #chains in the Genus database with same CATH homology 1OGD A; 3P12 A; 3P13 A; 1OGE A; 2OB5 A; 2WCV A; 2WCU A; 1OGC A; 1OGF A; 3MVK A; 4A34 A; 3E7N A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
