2OCLA

Crystal structure of valacyclovir hydrolase s122a mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWADGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Valacyclovir hydrolase
publication title Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 92
structure length 254
sequence length 254
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oclA00
1CV2A 4BDSA 4HS9A 2HIHA 1NX9A 4FTWA 4IH1A 3WK7A 2V98A 2J4CA 3LIPA 4J0JA 3U1TA 1CUGA 4E15A 4GW3A 1YR2A 3OG9A 3STUA 5K3CA 5K3BA 2ACEA 4W1SA 4QZVA 5AKKA 4EB0A 1BN6A 5HKAA 1XZKA 4LIPD 4IHAA 4AN0A 3AZPA 3D2BA 1HQDA 1BCSA 2ZYRA 4H7IA 4BCCA 5JIBA 1QIFA 1ZGBA 5F4ZA 1CUBA 2Z8ZA 3DNMA 3BJRA 1IVYA 5DYWA 1LGYA 4OYLA 5LP1A 4EY4A 2HRQA 1AQLA 2DCMA 3WYDA 5AK5A 5CXXA 2VAXA 4TPKA 2K2QB 3AFIA 4EZIA 4AZ0A 2ORYA 2VJCA 2WQZA 3D5EA 2HHAA 3FYUA 1ZD3A 2OCGA 3Q8WA 5AI6A 2PSEA 2HADA 2OGSA 3C6YA 2Q0XA 3D59A 3KSRA 3LS2A 2QUBA 5ALFA 3S8YA 3G0IA 4C4YA 1QO9A 4GLBA 1GPKA 2XMQA 1RYYA 1U8EA 5FV4A 4H18A 1C7IA 3IVMA 3F9CA 3E0XA 3ZI7A 2XUKA 3RK4A 3BDIA 4G8CA 4DNPA 3A70A 1BRTA 2C5FA 4KR0A 2QS9A 4QWWA 5HCUA 5ALMA 3PUHA 4BTVA 2VQ6A 4INZA 5CT8A 2HU5A 2LIPA 3DCNA 4FWBA 4UBKA 3R3WA 1JU3A 3G9UA 5BV7A 4DNOA 1JU4A 3MUNA 4X7BA 5AP9A 5ALKA 2ZJ6A 1TIBA 4WDRA 2ZJFA 4DMHA 4X6XA 2QXTA 4BRSA 3TEJA 4CG2A 3N2ZB 2E3JA 4KE8A 1QZ3A 5DNWA 1VZ2A 3I28A 5I9IA 1ZICA 1ZOIA 3WL6A 1SFRA 1X2BA 4Q82A 1ACLA 4A23A 4UBOA 1JJIA 1QIGA 4Y2JA 2O2HA 3LP5A 1GXSA 1ETHA 2AJ8A 4HXFB 1XRLA 1ODTC 5AM5A 5ISMA 5K3DA 5AK4A 2CBGA 4Y2UA 3T52A 4B0OA 2CKMA 4E14A 2VTVA 2HFJA 5HK8A 3QMWA 4J0CA 1E5TA 2CB9A 4UHHA 4W1RA 2CJPA 2HU8A 3MVEA 1VZ3A 1AMNA 2FUKA 4WJLA 1EI9A 4MWSA 4PSDA 2HA4A 2ZSIA 2B4KA 4FNMA 4AZ3A 1JJFA 1EINA 3I2GA 4CG3A 1J1IA 4BE4A 5EGNA 3BJMA 4LXGA 1L7QA 4KAFA 4AQDA 1HBJA 1H2ZA 1E89A 4TVKA 3OPMA 4EY6A 5ALZA 2QUAA 3G9TA 4FOLA 1J07A 3H2GA 3HSSA 1QJ4A 4LYDA 2JBWA 1DQZA 5T4HA 2C5GA 5SYMA 4B84A 4W1PA 3FAKA 4OCZA 1DT3A 5ALYA 2FX5A 1CIJA 2JGKA 3A2LA 3ED1A 1Z68A 4BZZA 2JGLA 4GBGA 2WIFA 5CRIA 5BWBA 4ZGBA 1UK6A 4YK7A 4H7FA 3O9VA 2QM0A 1O6FA 2XT0A 1XZHA 4B0PA 3HACA 4G8DA 3FSGD 1XLUA 1DTEA 4BB0A 4UBMA 5K3FB 4L9AA 3OC0A 5EHZA 5T4BA 3ANSA 2R8BA 3VVMA 1GKLA 3OM8A 5ALWA 2EDAA 4O08A 2DHCA 1G4HA 5HF5A 2V96A 4BVKA 1CR6A 1W76A 5DNUA 4A5SA 1WM1A 2WUDA 2ACKA 2WU3A 3QMVA 4CIBA 3KOOA 2PUJA 1M33A 1XRMA 3NUZA 4GEGA 3FWHA 5LIPA 4CCWA 1WHSA 3MUOA 4WCVA 3C45A 2QR5A 3WIOA 3I6ZA 1X2EA 1XQXA 1E3QA 4X85A 4Q3LA 4EY8A 3O95A 3O9MA 1W52X 4DMFA 3NOXA 1WPRA 1A88A 5LYYA 1EA5A 1CUFA 3QPCA 1QO7A 4RE6A 3H0CA 2WM2A 5E4YA 2ZYIA 4C89A 2C4HA 1GQRA 1G5FA 4JEIA 4AXBA 1THGA 3WL7A 3KXPA 5T4EA 2ES4A 4GECA 3VDXA 3KD2A 2OCLA 1CEXA 3G02A 4N5IX 4TGLA 5AH0A 4BVLA 3SK0A 1F8UA 3WMRA 3SWWA 5ALVA 1QOZA 5ALSA 3G9ZA 4EY5A 2O7RA 3IUMA 3WK8A 3W9UA 4FFWA 3AJAA 2XMSA 1CUHA 3R40A 4OD0A 1X70A 4RE5A 1LPBB 4U2EA 2GZSA 1J06A 3BF8A 4YASA 3D0KA 4FHZA 4Q05A 4ZI5A 3JYHA 3MGAA 1BEEA 5E2IA 2WG0A 1FFAA 4QWMA 2QZPA 3HC7A 4EBBA 1XQYA 4X92A 1ZJ5A 4B7ZA 1ZJ4A 1XZCA 4C6HA 1R9MA 1NU8A 1QONA 1UK8A 2DQZA 2HA0A 1LPOA 1E8DA 1S8OA 4KRXA 5CT9A 2X76A 4MWTA 4X6YA 2XUPA 4EUSA 1EDBA 3G0DA 3V48A 1N8SA 4P08A 3EQ8A 2H7YA 4B9AA 4Y2RA 4M0EA 1MJ5A 1XZFA 3PI6A 2AJCA 1SOMA 5ALDA 2XMDA 5BWCA 5FLKA 4UBIA 2XUAA 2DFPA 3BL8A 4Q34A 3STTA 4H35A 1H2YA 4N8SA 3O4GA 4X00A 5LZ9A 3Q0TA 1XLWA 1B41A 3VJMA 2ZYSA 5JZ9A 1E8NA 5ALHA 1YS2X 1J2EA 3AIOA 5AM3A 4QE3A 1A8UA 2XMZA 3QVMA 1AZWA 4X95A 1QLWA 2C7BA 2QT9A 3HLKA 1IZ8A 1TCAA 2VJAA 4C4ZA 1KU6A 2OCKA 4PQEA 3ZPXA 3QYJA 5LZ7A 3SX4A 3EIOA 2H7CA 4EY7A 1DWPA 2I78A 3STVA 1WCYA 2JIDA 3VJKA 3TJMA 3NGMA 1FFBA 4JYMA 1LPNA 4WY5A 4LXHA 1MNAA 3D2AA 3T4UA 3ZWQA 1UK7A 5CBKA 2BUBA 4OYYA 2IIVA 3EQ9A 3O4IA 3F67A 1ORVA 3L1JA 4G1FA 3ICVA 1EB8A 3TRDA 2XUGA 5AI5A 4X97A 3C5WP 5ALIA 1OCEA 5IKXA 4GWLA 2EDCA 3OTQA 3PUIA 4RNCA 2GBFA 3HI4A 1K8QA 4N8DA 1E8MA 4BRZA 4H7EA 5CXUA 5KWJA 5CMLA 5AIBA 2QMQA 2RI6A 5JARA 3EF3A 1Q0RA 3KDAA 3H19A 4KAAA 4ROTA 1MN6A 1LLFA 2OGZA 1XRNA 2PPLA 3H2KA 3DKKA 4G5XA 4GXNA 4OB7A 3H1AA 1T2NA 3DOIA 2JF0A 2HDWA 5IVKA 1CUAA 3DOHA 2XB6A 3V1LA 5AM4A 1A8QA 2WFLA 3R3XA 1VE7A 1JMYA 5LZ2A 4KAJA 3BE8A 4BC1A 4ARAA 3HYSA 4AMZA 2DR0A 1LBSA 1FFDA 4W63A 2D0DA 3WKEA 3ESAA 3FYTA 2WLSA 3IBTA 2OPHA 5ALGA 2RONA 1W75A 1BROA 4HAIA 2VT7A 5AK3A 4QA9A 1DQYA 4H7HA 3HEAA 2Y2VA 3WWCA 3IIIA 4MQMA 2HA7A 4LKOA 3HRHA 3B3QA 3WI7A 1W4LA 5FXMA 5A7GA 3G0BA 2GYWA 2RGUA 5A6VA 1EK1A 1BEZA 2B61A 3FVRA 2XMBA 1SC9A 3DL4A 4C88A 3L1IA 4DIUA 4GI1A 1JT2A 3OURA 1BCRA 5JZBA 1DU4A 3QM1A 4DMKA 4U2CA 1HDEA 2QTBA 4NS4A 1UOOA 1UZAA 1T4MA 3QPDA 3ANTA 3VJLA 1BN7A 2PU7A 4QNNA 2VA9A 2XQIA 1Y7HA 1GPNA 2XLBA 3RLIA 2WIJA 4ETWA 2PSDA 4NVRA 2HA2A 1H22A 3N0TA 4PO3X 2PBLA 1MX1A 5IVDA 3DS8A 3I1IA 4Z49A 1MTZA 1ZD4A 2BFNA 1IMJA 2Z8XA 5JALA 3C8HA 3C5VA 1CUDA 5ALRA 2XQFA 2Z5GA 4DYHA 3ESDA 4M0FA 4P92A 4Y2VA 1XZLA 1HLGA 4RPCA 3K6KA 5HF8A 4AX4A 3S2ZA 5A2GA 5D3KA 4AO8A 3GELA 3ESBA 1R9NA 4BP9A 3DDUA 5J3JA 1XROA 5FKJA 5AOCA 1AUOA 4DTCA 3ESCA 1QE3A 4LHEA 5HZGA 3YASA 1KEZA 2GYVA 2PSJA 3AIKA 5LKAA 2Z3ZA 4D9JA 1XLVA 4WFJA 5AM1A 2JGMA 4PW0A 5ESRA 1CUUA 2ZJ7A 4UPDA 3PE6A 4HXGA 2WUEA 2XUFA 4IH9A 4G9EA 4H7KA 2WSLA 5CT5A 1DT5A 1TAHA 4G4GA 2GBGA 3WWDA 5JASA 4U2DA 3WL5A 4AO6A 1MU0A 4B6GA 3LCRA 1GPLA 3AILA 4K6GA 4CCYB 1N5MA 1RWQA 2WUFA 4FLMA 3I2HA 3C87A 1UK9A 1LZLA 1YB6A 2WHPA 4MYDA 1EK2A 4B85A 4WFIA 1P0QA 5AM2A 3QPAA 3WWOA 2WJ3A 1JI3A 3PF9A 4Y2SA 1VKHA 1TK3A 1L7AA 3D2CA 5AHXA 4AMYA 2OG1A 1I6WA 1VXOA 4ZV7A 4F5ZA 2J3QA 1C7JA 1MT3A 2PVSA 2XMCA 2XMGA 3H2HA 4GHWA 1W6RA 5JZSA 1CUVA 3STYA 5AKXA 4H77A 1LZKA 1GGVA 2XMRA 4F0JA 2AJDA 3G8YA 5FDFA 1IUNA 1GQSA 3F96A 3DEAA 1XZJA 5D3ZA 1DWQA 4I19A 2Z3WA 5HFAA 3BXPA 4Y2QA 3FSGA 2WG1A 3ZLVA 2PKYX 1K6EA 3H18A 4W1QA 1W1IA 4F60A 1FJ2A 2WIKA 2O7VA 5DLPA 4NMWA 2ECFA 4BCBA 3D7RA 3A2MA 2G5PA 3H04A 4J0KA 4WDQA 2JEZA 4DNFA 2HA3A 3H2IA 3E3AA 4GDMA 1QIDA 3W05A 3F8SA 4JH0A 4XX1A 3DL7A 2PSHA 3I2JA 4BP8A 4B9EA 4KE9A 4E11A 4BTLA 5JAUA 1QIMA 3DKRA 1CQZA 4FNGA 1YCDA 4A16A 1XZAA 2Y2UA 2UZ0A 4XVCA 4DMCA 1TRHA 1MX5A 1XZBA 4X3CA 3DYVA 3FYUB 1Y37A 1CUEA 3FCYA 5K5EA 3C6BA 2WTNA 5FP0A 2QVBA 5EHNA 1YAJA 1UKAA 2H7XA 2PU5A 3HZOA 1Y7IA 1XQVA 4L0CA 3WQHA 4W9RA 1EVEA 1VXRA 5T4FA 3D3NA 3CCCA 3G0CA 2XUOA 4C87A 4RGYA 5CW2A 3GBSA 2WFZA 2NW6A 1ZI9A 2JGJA 3W06A 2BGRA 4X91A 2YASA 2JGFA 4QDUA 1R88A 4I4CA 1IZ7A 2OAGA 4K6HA 5ALJA 4Y9SA 3ZV7A 4OSEA 1XZGA 2PX6A 4J0DA 4MXDA 5ALEA 1ODCA 1L7RA 3CCBA 2FJPA 5AKZA 5EHXA 5JD5A 5IVHA 1WHTA 3U0VA 4BBZA 3I2IA 1YS1X 5JAOA 1QGED 2RHWA 1XZIA 4QDOA 1E66A 1Q83A 1FFEA 2B9VA 3FYUC 3AUKA 5JD6A 1F0NA 4CIAA 4QDTA 4C01A 4OB6A 2ZVDA 5AKGA 1CPYA 3PF8A 3QBJA 4ZWNA 4N8EA 5AI4A 1EXWA 3GFFA 4UUQA 1QIEA 3FBWA 4PSCA 4B80A 3AZQA 5KWIA 1PFQA 1VA4A 4P93A 1ODSA 5K3FA 4Y7DA 2O2GA 1P0PA 2JGEA 3R41A 5AICA 3M81A 4G4JA 3PDCA 1FFCA 3BF7A 3O4HA 5JAPA 5ALXA 1DWOA 1K63A 2QJRA 1GT6A 3JW8A 3QITA 1EDDA 3O0DA 5DTIA 4MYSA 5I7UA 1SCIA 5AKJA 2GZRA 1ZI6A 1R4ZA 1NU6A 4NZZA 1CUJA 2P8SA 3I2KA 1EHYA 2XQKA 5DTJA 2C58A 2CUTA 1U4NA 1JKMA 3WWPA 2FJ0A 5JD4A 5KBYA 1G66A 1PJAA 4XWGA 1TCCA 3GUUA 4OB8A 4UBNA 2HA5A 3NWOA 2ZSHA 4C4XA 3V9AA 3WKAA 4PV7A 1VE6A 1XFDA 1BE0A 1XZDA 4HTAA 1AGYA 4J0IA 3C43A 2XUHA 2GBCA 3SC2A 1O6GA 2QXUA 4K5QA 4ZRDA 5HKBA 2WU4A 1Q0ZA 2WFMA 1YA4A 4H7DA 1ORWA 2QJWA 4BAGA 3I6YA 4JNCA 4IQ4A 5JADA 1VOTA 2YXPX 6YASA 5CURA 1TKRA 3R3VA 4G4IA 4BE9A 3RM3A 3QZUA 1VA5A 1CUWA 4UHFA 4AN1A 4N5HX 4PSUA 5AIAA 4FFVA 5H3HA 1JMKC 2XI4A 3V1NA 3AINA 5LLSA 1ZIYA 1YB7A 4KE6A 1UKBA 3R0VA 2G4LA 2C0PA 3M83A 5EIHA 1VLQA 2RAUA 2V9ZA 3C70A 2VATA 1YA8A 1MPXA 3BIWA 4JYPA 3BIXA 4WFKA 2X8BA 4DSZA 4G9GA 3VVLA 3F98A 4DLNA 1N1MA 3VISA 4M0MA 3RARA 3WA6A 1CUYA 3CN7A 3A2NA 3FLAA 7YASA 5JAHA 4BC0A 5D7BA 3R3UA 2WILA 1PV1A 1CUZA 3K2IA 2OQVA 3IDAA 5ALUA 2OXEA 1MNQA 4UFOA 5CT4A 2HA6A 3FOBA 2OQIA 3AZOA 1WOMA 2QOEA 4DNQA 3H2JA 4OU4A 5EI5A 2PSFA 5C81A 1C4XA 4B81A 1WB6A 3PFBA 4HRXA 2GYUA 2JGIA 1A8SA 4OUKX 1YSCA 1UOPA 1USWA 4KRYA 4BATA 1SCQA 4Q1VA 3WK9A 1R1DA 3DD5A 2XDWA 1XRRA 2AJBA 2WHQA 3ILSA 1ZIXA 5SYNA 4F21A 5CTAA 5AI0A 4AO7A 4FLFA 2VT6A 2HM7A 3W9BA 1XKTA 3E4DA 4UBLA 3VKFA 2WG2A 4KE7A 4UHCA 4BAUA 2BGNA 3FLBA 3E1GA 1UT6A 1QTIA 4S0XA 4BVJA 2WIGA 1TCBA 2XUIA 4IH4A 5DNVA 3RKSA 2IX9A 2G63A 4UHBA 4YPVA 4FLEA 4HVTA 4QLOA 2VAVA 2WJ6A 5LZ4A 5AI8A 5KREA 5ALPA 1CUSA 1MO2A 1DX4A 4ZV9A 1H2WA 3ZLTA 5AO9A 1ISPA 5I8PA 4QEKA 1CUXA 3C8DA 2VSQA 1QFMA 3BDVA 2WHPB 1AURA 4X6UA 5CH5A 1MX9A 3L1HA 2WUGA 4J0GA 3WKDA 5FPPA 2CMFA 3QMMA 3C6XA 1CQWA 3WIBA 1P0MA 2VEOA 2XUQA 5CH3A 5DWDA 1XZEA 3DLTA 5LZ5A 1CRLA 2BUAA 3WKCA 5AKLA 1K5PA 2W6CX 4Y2YA 3CN9A 5JYCA 1XRQA 3DQZA 2AXEA 2DQYA 4LYEA 5EIEA 3WYNA 2R11A 3GA7A 4J03A 2EEPA 1CVLA 4JUIA 2OCIA 5A7FA 4Y2PA 5ALQA 4X71A 2OGTA 4X93A 3W2TA 3HXKA 4K6KA 4OPMA 4E46A 3C6ZA 4V2IA 1WPXA 3O4JA 4EHBA 4OU5A 5AM0A 1IUPA 1LPPA 3KWJA 4KYVA 4ZREA 1EX9A 1LNSA 4DM7A 2G5TA 2CZQA 1QIKA 3IUQA 2JEYA 1H2XA 4BYMA 2V97A 3PICA 3H17A 1U2EA 5EIAA 1R3DA 4Y2TA 3I1YA 3WLAA 2HRRA 1LBTA 3F97A 1G42A 5FPQA 3IB3A 3G0GA 5D6OA 4U2FA 5K3EA 3PFCA 1LPAB 1MAAA 2CEKA 2W22A 4XIIA 4K2AA 3QH4A 4MEBA 3LIIA 1F6WA 5HFNA 3G7NA 4EA6A 1B6GA 4KACA 3DYIA 1UOQA 1ZI8A 4FBLA 5CH8A 2J4FA 1UWCA 1AX9A 2HU7A 5AK6A 1DINA 1H23A 2Y1KA 1ZD5A 2OAEA 1QIJA 4KJXA 3HABA 1SCKA 1EH5A 1GZ7A 1GKKA 1KU0A 3WZMA 2XQGA 2PM8A 5EFZA 5AKHA 5IH7A 2DHEA 1JFRA 1AKNA 4MEAA 2DHDA 1CFJA 1YASA 4J0HA 1CUCA 1BS9A 1F0PA 3FNBA 4X90A 4LXIA 1QFSA 5LKRA 4AB1A 2QRUA 5AKEA 5C8ZA 4ITVA 1UXOA 1RP1A 2YH2A 4QDXA 5A7HA 3UMJA 4ARBA 5BOVA 3LLCA 1UKCA 2XE4A 5DYTA 4FMPA 4HRYA 1OXMA 3HJUA 4MJ3A 3P2MA 5A71A 2B20A 4UHDA 2I3ZA 3DJYA 3FCXA 5EHQA 2XUDA 1XZMA 2YYSA 1JJBA 1CUIA 5HK9A 5FUMA 5E4TA 1XRPA 4FDMA 5AKIA 3VXKA 2C0QA 4Q3KA 1ZGCA 1HKHA 2H1IA 3D4LA 4UFNA 5ALTA 2ROQA 1WB4A 2X5XA 1D07A 2VJBA 1LPMA 2ONCA 4J3JA 3EBLA 3WKBA 1WB5A 1YAHA 3FLEA 3M82A 2AJLI 1ACJA 5IVIA 3OOSA 5DYYA 2QKYA 4I3FA 2PUHA 1N5RA 2RIPA 3GZJA 3IA2A 3B5EA 4PF1A 2HFKA 2ZYHA 5C8VA 4MQLA 4CFSA 2J3DA 2H9YA 2XQJA 3BWXA 5LZ8A 2Y6UA 1VJ5A 5K3AA 1XKLA 4UBJA 3X3HA 4FKBA 1EB9A 5AKYA 5E4JA 3IUNA 4YX9A 2D5LA 5JANA 3H1BA 3KWFA 3IULA 4KEAA 2VJDA 4P9NA 2BAGA 4U2BA 4FBMA 4B83A 3CXUA 1LPSA 4WY8A 1OILA 4HZGA 4Y2XA 1IUOA 3UUFA 4QLAA 3I6MA 3AIMA 2BUCA 2I03A 1HL7A 2BCEA 3A6ZA 1K4YA 2WHRA 3R3YA 1U65A 2IITA 2WIDA 1XQWA 1DX6A 5ALLA 3EQ7A 1R50A 1FSSA 3M3DA 2WFLB 5HQ3B 1EDEA 1AC5A 1EVQA 3JWEA 5DJ5A 3IURA 4J7AA 2PL5A 4QDZA 1THTA 4IO0A 3WL8A 3B12A 3WK6A 4UHEA 3WK5A 3WJ2A 5HQ3A 4B82A 2Y6VA 1A7UA 4HXEB 1CLEA 4H0CA 1QIHA 1QIIA 1MAHA 3TGLA 2BKLA 3STWA 5FOQA 2WJ4A 2GBIA 4CI9A 1QTRA 4UFPA 1ZD2P 4BAZA 3R3ZA 4BZWA 3IUJA 2XUJA 3WK4A 5AI9A 2RHTA 2VF2A 3ZLUA 2BJHA 3G9XA 3V1KA 5JATA 1P0IA 5A62A 4L72A 4XJVA 4CCYA 3STXA 3UUEA 2WTMA 2O2IA 1HPLA 5CT6A 2I3DA 3WWEA 2XLCA 5ALNA 5ALOA 5FRDA 4BCDA 2WKWA 3V1MA 3W04A 4Q3OA 5AOBA 5YASA 4U2GA 5HF9A 4H7JA 4ZXFA 4L3WA 5HF6A 3I2FA 1BU8A 5AJHA 1TQHA 4X94A 3FVTA 4DGQA 3WJ1A 4G8BA 5AOAA 4CG1A 3WA7A 3K9BA 3ICWA 3GROA 5C7YA 2DSNA 2HL6A 4PNZA 4DSAA 1UFOA 4BDTA 1Q84A 2OLEA 3WZLA 5C8XA
chains in the Genus database with same CATH superfamily
1CV2A 1GV0A 2BZGA 3L7DA 4K28A 3SKVA 5JPCA 1FU7A 1HGXA 2HIHA 3OZSA 3DLBA 1EJ2A 2B8WA 5LFAA 2ZAMA 5FFMA 2G40A 5LP6B 4IH1A 5EP2A 5C34B 1KPGA 3K9CA 4WKOA 3ROEA 2J4CA 3WFJA 2ZSKA 4DBVO 2CLLB 4O02B 1ISSA 5EIBD 5TV2A 4Q7MB 4P4LA 2RGNA 2KSQA 3ANYB 1RIFA 4CLXA 2Q5EA 4MLCA 3FG9A 1ZL2A 3WMXA 1CU1A 3GBPA 4EG0A 2D13A 3IC5A 1YR2A 1T5LA 3BMQB 4R54A 4IUCS 4EGSA 5AW9A 5KTMA 3T1OA 2YJGA 3ZTTA 3Q9UA 4UDNA 5K3CA 3IIKA 1U0JA 1T6XA 1WF3A 1PZXA 3AEXA 4RFVA 1YR7A 1MIOB 3VNRA 4ZVRA 5AKKA 3WGNA 5E7MA 1U0GA 1I4WA 3S2SA 1OXTA 2B37A 5CVEA 3OKFA 4E4TA 3ROFA 5JVDB 2REOA 4FEYA 4PR3A 1T6NA 1CJBA 4I5EA 2HHJA 2P0YA 4M0KA 4QBHA 2W6ZA 1W85B 2ZU0C 1YUMA 4H15A 1HQDA 1U0HC 3ZS9A 1KOJA 1Z25A 2A0XA 1USIA 2ZYRA 4BCCA 3RIGA 5M29A 2C5SA 1ZGBA 1S2IA 1CUBA 1JDTA 1PGOA 2IHUA 4L8YA 5KKCA 5F51A 1J99A 1YOBA 5HJEA 3JSXA 1SA0B 4O2BB 3LXXA 4EY4A 3SQMA 3M6XA 4LGVA 1AQLA 2DCMA 2FSGA 4I0WB 1CHNA 1UFKA 2OORA 3M70A 3KLBA 3DHEA 1RAGA 3TFWA 5EZ6B 5F1OA 2I22A 2IF0A 1N9KA 2WMNB 3G7SA 3HWSA 4JWKA 4UM8B 3TIXB 5TPZA 5GTDA 1CR2A 4Y6RA 2HREA 2C7OA 5KQRA 1OXSC 1WQ3A 4BZXA 2ATVA 1Z4LA 2JD2A 3GVCA 1XDUA 1BQ3A 3ED5A 3HNPA 3NP7A 2HMYB 1JU9A 4X7RA 4B3HA 5FO1A 1ZN2A 4Z8YA 1D03A 5DP2A 1PEKE 5F5LA 2OCGA 4PS0A 1HE3A 3AFGA 4ZAZA 3ETNA 1ORDA 3D4IA 3IJRA 2HADA 4RMIA 1M34A 3RFXA 3RYIA 3T94A 5BSKA 4CKWA 3DXYA 2OXFA 1UQRA 1Z7GA 2YCBA 2I55A 3C6YA 2P1ZA 3P2YA 4CKEB 1U1FA 3RRYA 2YC4C 1DMSA 3D59A 5AVTA 2PAFA 2YWRA 1IXYA 2CNNA 2MMGA 3EARA 3BHJA 2ZETA 2WM8A 3MJVA 4HAOA 3NYRA 1ZNWA 5A1TA 4IDOA 1EPUA 1N2JA 2IBMA 3PGVA 3V8QA 4YRNA 3LOQA 4MHSA 4IEFB 3LAWA 3KV3O 1HFEL 2UZ1B 4FQ8A 1GPKA 3V4LA 3VZCA 2XMQA 3WLSA 5DIZA 4RZIA 3CX8A 1PWHA 2P9ZA 4LXYA 3IIJA 1W4RA 3QI2A 3VOAA 1LQUA 1NC3A 3DOEA 3BXOA 3T4EA 3NBFA 3ZHSA 4O4LA 1CRZA 2VYVD 4HB4A 3K9FC 3E0XA 4IHJA 1E1MA 1E18A 1G4AE 1GRCA 1VJDA 4G5RA 3DULA 4KKXB 3B82A 2FR1A 1U4SA 4GBED 1JSRA 4G8CA 4MB6A 5AXDA 2XA2A 2GRAA 3JQAB 3UC9A 3A70A 4DNPA 3WIVA 4KC0A 2C3OA 2VPZA 3CEMA 3LP6A 3PXBA 4HNSA 3UMFA 1XDSA 1NQOA 3FBGA 3KLOA 1PV2A 3SXPA 3WGIA 2GERA 5ALMA 2ADMA 1NFQA 1OYYA 3PUHA 5IAJA 5IDVA 1FJGB 1LRLA 3FKJA 2UYOA 2GLUA 3A9TA 4AKHA 3WLHA 3TLYA 3KNZA 2VQ6A 1MJNA 3GUYA 3TE6A 2DPXA 1NAHA 4RJJA 1J8VA 1MFZA 2CMDA 1SUDA 2LIPA 3ORQA 2HTFA 3Q6IA 4L8GA 4OG2A 2P2GA 4TLMB 5GZ6A 9LDBA 4MQFA 1V7CA 4R5HA 1EK5A 1MG0A 4GP7A 4L9WA 3R3WA 5DMHA 1M1XB 3MXOA 3QVTA 4K9OA 1NRWA 4YFYA 2BDEA 5BV7A 1UBLS 2F8SA 3D6JA 1T2FA 3IE0A 4CF7A 1P1FA 1KP9A 3JRXA 4CM8B 4H59A 2GM9A 2WJGA 3B6ZA 2ZR7A 5LQJA 3I76A 1JXAA 4WDRA 1QU3A 3QNMA 3UAWA 3G6WA 5DSTA 3NJ8A 1HLPA 4DMHA 5CB4B 4QNMA 3ZWAA 4BJHB 2AXQA 2V1XA 2DZDA 4X6XA 3FUTA 4DADA 3QLVC 1N7JA 1LUAA 1QE5A 3TEJA 1WUTA 4F6CA 2C5BA 2HAEA 1BNCA 3HL4A 2E3JA 2C82A 4L3OA 4D4IA 4MLDA 4R6WA 3QG5A 4KE8A 4ZODA 4JT8A 3NOQA 4LDRA 1OY1A 5DNWA 3UBTA 3DGEC 3OJFA 1IIBA 2G06A 1SKBA 5AJZA 4QDKA 5EZSA 3ELDA 4D99A 1X2BA 3EIFA 3I5UA 4PM4A 3UHOA 5AD1A 3ML1A 4PE5B 1G2OA 1HUQA 2HB6A 4DR5B 1ZD8A 3H13A 2G3YA 4L0QA 3BVPA 1SQGA 1JJIA 1QIGA 2YQ5A 4MWCA 1A5ZA 2QUJA 2G8LA 1P1HA 3KUKA 3QEMA 3LUBA 1ETHA 3QHQA 1MBZA 2BFEA 3ASVA 5FBRB 4O1MA 1H65A 5AJWA 2WE8A 3VR2D 3ZHOA 4R05A 4QG3A 2C77A 1KK1A 4AF8A 4Q48A 3FHLA 4JKYA 5T7BA 1ULSA 5K3DA 4B3XA 4DXHA 3E5HA 3IQDB 5LQAA 2C9ZA 3HSKA 1J09A 5EJ6A 1AHHA 1K68A 1DV2A 3EIWA 3KOXA 3IDOA 1E2LA 4V24A 1GILA 2FY8A 4RD3A 3ND5A 1L4KA 1PR9A 3PNKA 3LNCA 5HK8A 2NZ2A 3ENKA 2R2AA 3I5MA 4W1RA 1O6CA 3OO1A 1VZ3A 2FUKA 2GF9A 4OGWA 3L8YA 4YAWA 1V8DA 3QXSA 4UM5A 1UP6A 1OBHA 4A2QA 2O5RA 3IBCA 2LW7A 1JQJC 3R9KA 5KOHB 4Z4IA 2GH1A 4FGUA 2J45A 2B4KA 5E6RA 3KD3A 4FNMA 5BN4A 5K05A 4EFMA 3LVQE 1TC1A 1ECCA 1KK2A 3KXIA 4INOA 1GQFA 5BN5A 3RHSA 1JJFA 1YZFA 1DG9A 5A4JA 3ZDCA 1SHUX 1RM3A 1PJRA 1NQWA 3QWBA 2PV0A 1NBMD 1BGVA 1ZM2A 4H6VA 1T0BA 1EFVA 4URXR 3HR7A 4G2NA 4CG3A 1JPNA 4KPGA 2IPLA 3OUTA 4K9NA 1BJTA 2ATCA 3PC8C 4EX6A 1J1IA 3B2NA 1Z5WA 3I73A 3BSFA 4PYMA 5CK5A 4J1QA 1W25A 3UANA 5LQRA 2OCAA 4EM6A 3LKVA 4AROA 4B6JA 1ZLXA 2OXCA 3OIYA 5B1IA 1KDYA 4HEQA 4KV9A 3SF0A 4AQDA 1BCSB 3B7WA 4KXFB 5KS2A 2JGNA 1H2ZA 2AZXA 4K9MA 3K9HA 2F59A 3QVXA 3WAGA 3ISJA 2AFRA 3OPMA 2IEGA 4MVYA 4ZAVA 3URMA 2ZDQA 2QUAA 4UMVA 4XJTA 3F47A 3FDIA 1J07A 3ZUPA 2QGFA 3CINA 4L85A 5EWMB 1QJ4A 4N4AA 4OX9B 2YFKA 3U4CA 4ENQA 3DPUA 1DEXA 1HYGA 2MSKA 1ZK3A 2QAIA 3KSMA 1CRQA 1DB3A 4EB6B 3OMXA 1WKVA 3H4MA 4IVPA 5SYMA 3O93A 1A96A 1KPIA 1RJ9A 3NONA 3C3EA 3L7JA 2BDUA 1T43A 4NQZA 2GJKA 1W7AA 2YYYA 3M5CA 2LP4Y 1XJ0A 1Q95A 4BLPA 1U0OC 3VDQA 4RYLA 3PLAE 2EKDA 1USGA 1M8JA 3MAGA 1GARA 3LE8A 4ZGBA 1UK6A 2EJBA 3CNNA 2BBSA 3K30A 3RPEA 4Q37A 4KDCA 4JUDX 4JLSA 3UAVA 2IP1A 1ADBA 1I01A 4CIYA 1K8ZB 3B9QA 4MKGA 2OMEA 3G5AA 1EUZA 1TYCA 2AEJA 4G8DA 4ZCMA 3C7DB 1W36B 3U19A 3IRVA 1QRDA 1R0LA 1M2OB 4GT1A 4WEOA 3AY0A 1JKJB 3KQNA 4NYJR 2VWHA 4ZYTA 3FX2A 4M38A 2P5SA 2ZT7A 2Z04A 2PYZA 2GJ9A 2YWFA 1K3TA 2GQ0A 1T29A 3PFFA 5CEEA 2IIQA 4ZAFA 3COPA 3HKCA 2ZS7A 1SHJA 3ZXSA 2P9GA 3ZHZA 1SBQA 3WSTA 4RSGA 4LF9B 3GYBA 1QC5A 3GMDA 4M1QA 1VPLA 2FF5A 3OESA 4O08A 4TTAA 5E3IA 1ZXLA 5HF5A 3THRA 4YY3B 3KT3A 4WOPA 4BVKA 5G1OA 5EKUA 4QTTB 3RRXA 4MUXA 4QECA 3LSTA 1W76A 1TNDA 5KSPA 4OOEA 4X24A 4UTNA 2ERYA 4BO9A 2A9RA 3L06A 1LLQA 1H5UA 2HQOA 4GFDA 4OQ4A 1V8ZA 3ZV4A 4PZ0A 1WF6A 1WRBA 3H5LA 2OHFA 3D6HA 1L8XA 1YMVA 3HSYA 3E23A 3N7AA 4YLEA 3ZWDA 1C14A 5LC1A 4ARZA 1S6YA 4JAVC 4N3NA 5KVAA 1UIMA 2DJIA 1M33A 2PMFA 3JQ7B 2CHFA 3TZ6A 1A9SA 1L1RA 4PC1A 2JW5A 2VSOA 1ELOA 1JQEA 2JLSA 3CPJB 3GX1A 4FMCF 2HF7A 2AQ8A 2X9LA 3LCVB 3O7MA 3O3OB 4G2TA 3GEBA 1ESNA 2GKOA 5FQNA 4YUVA 1SXQA 2QR5A 1MO3A 3IKJA 1T8RA 3DBRA 4FC6A 1PLJA 5LB4A 1X2EA 5EAIA 1N1DA 2IDKA 1RQ2A 2EARA 4YP9A 1Z4OA 1M0EA 5KNCD 2XYPA 3BXFA 3T5BA 4IDQA 2IUYA 1Q0HA 4F2GA 3MCZA 1UDCA 1L5HA 3BK2A 1SXHA 4JITA 4E5YA 4P31A 2YNMA 1R5BA 4ABTA 3R44A 3C98A 2DOKA 3B8HA 2DEUA 4GDFA 4KOAA 1B8UA 2CXRA 1BE6A 3QXXA 4RE6A 2Z58A 5TDHA 5GADl 1WULS 1NSYA 3PPXA 3LMKA 5E4YA 5FTKA 5KHLB 1VMAA 4MW9A 3IAEA 4Q4LA 1FVHA 1HH4A 5A5EA 1WUKS 1ACMA 3M8KA 3NYIA 1HQYE 1QHXA 1P6XA 3A26A 3C5HA 1IK4A 1VPDA 4RHFA 1WPQA 1CZLA 2WWHA 1HL3A 4TMWA 5DM70 2W2LD 4AXBA 1MX3A 3U16A 2W2NA 2VYVA 4JBHA 5AXBA 2YFHA 3NTUA 3PRHA 2A78A 5CD1A 5C4MA 3MYYA 4C2UA 1THGA 3NRCA 3WP1B 1N33B 3RSQA 1Z0IA 3KXPA 4AY6A 3C3WA 3GIWA 4GECA 3KYJB 4X64B 3IPAA 4TGLA 2QRNA 2Z09A 4MWGA 2PNJA 3SK0A 1EGAA 2CVZA 3DNFA 2PEZA 4MQUA 4C3ZA 2GM4A 3LYUA 5ALVA 2B4YA 3M9XA 2IXTA 4XOIA 1UKYA 1W2GA 3FBTA 2CFSA 4DA7A 3G9ZA 1JZQA 1YQXA 3L6BA 4AU1A 1EJ6A 1BWSA 2O7RA 1S2OA 2WWYA 1ZR2A 5FL7A 1AKYA 4FFWA 1NL3A 3GGSA 2NU6B 1MABA 3OTOB 1FVOA 5DCLA 2OORC 2GSDA 5CCXA 4JUFA 1FUIA 3HJBA 3IP7A 5EZYF 2YV2A 4ENUA 5KIAA 3SQXA 5JECA 4HB0A 2E5FA 5FUBA 1A4RA 2OFFA 2I80A 5ER6A 3LW7A 5IDQA 3K0CC 1ECGA 1SUWA 2EJUA 3HP1A 5A6SA 4RLQA 3L04A 4W5NA 4JYCA 2ZAGA 3JYHA 3MGAA 5IARA 2F62A 4YRBA 5IVPA 2O7QA 3K6SA 3KQUA 1GTZA 4ZQGA 1IHUA 4UMEA 2FVXA 4CR7A 3NFYA 3T7SA 4ZYLA 1M72A 4HL6A 2P6RA 2QZPA 3HC7A 2O3QA 2PKWA 4EBBA 1XQYA 2UAGA 3KL2A 1QB8A 3AEKA 3ZGLA 3W5BA 1Y6GA 2KBFA 1VL8A 1PR6A 1ZJ5A 3IHKA 4X92A 2KPOA 4DV3B 1DDGA 3TNJA 1KDPA 4B7ZA 1XZCA 4C6HA 3OIUA 3RBAA 2C04A 2XIQA 1Y5RA 2R4TA 5KC9A 1R9MA 2X8JA 2EV9A 1DIBA 4REQA 1X14A 3SG0A 3NDIA 2DQZA 1Z83A 2I7XA 3ZTYA 4RKQA 3A1NA 3HGQA 5I7UA 3HRKA 1OZ0A 1E8DA 3DFKA 5IC6A 5I7AA 4D8YA 4CEHA 1G7SA 3B89A 3IBGA 4MWTA 4EUSA 5F3RA 1DBVO 5U9CA 4L1KA 1EDBA 2XOEA 3GUHA 1PKXA 1N8SA 1MT0A 1OKKD 1BE1A 2X9NA 1BDMA 4CMAA 4TMYA 1JIXA 4Y2RA 3I8XA 3MIZA 1A27A 1EWYA 3KKPA 4M0EA 4PFKA 1JQ5A 4BFSA 1P5RA 3CUSA 3WIDA 3PTAA 2IUTA 3PI6A 2CXOA 4CMGA 1P62B 2XSZA 2DT8A 5AW7A 1XQ9A 2CLFB 2AJCA 4ZO4A 3WLNA 1RBMA 2Y1DA 3RYHA 4MUMA 3UJ3X 3RYFB 5G40A 3HO6A 4DCGA 1ABBA 4ESVA 2Q9CA 3B78A 3FJYA 4JLKA 1XOIA 2IE0A 4CDMA 1VMDA 1XMVA 4GEKA 4CGYA 1U3CA 2JAUA 3BMQA 2XD4A 3WNBA 3JQ8A 1GPUA 2A1UA 2NM0A 3UHPA 3B1KA 1GNTA 2Q99A 1G291 4AURA 2XRZA 3KQSA 3OQBA 1KZGB 3NTLA 4TSKA 1E0JA 1UEXC 3EQ2A 3ZZNA 3PRJA 2BE7A 1E1LA 4RQBA 3RVKA 1UPXA 4IQFA 2Z43A 4LY0A 3QF4A 3GG2A 1YU9A 2F1HA 3B5JA 5JS7A 1T5SA 5AJYA 1IWBB 4FDLA 4YYZA 3OHMA 2ZRQA 5JC8A 1Z2PX 3DE6X 1XR3A 4Y1GA 2EW8A 1YU6A 3HDVA 3P2OA 4ZJPA 3HUFA 4GRIA 3O4GA 1W35A 1QZXA 3L5OA 5ENDA 1EVLA 1QHGA 1SKYB 4O5AA 3RC8A 4IIDA 3BK1A 1RHQA 1WR8A 4JODA 4ZJZA 3KSZO 4BO1A 3PXGA 2F9MA 3Q0TA 4EELA 1XLWA 2SECE 1HNXB 3O83A 3WMEA 4RF3A 4P0QB 2NYRA 4OH1A 2FGJA 3BXXA 1X7YB 5EMHA 5F5XA 3B3JA 1MOPA 5FTNA 5GVRA 1XWIA 4I8XA 5IUNC 1XDDA 4C0BA 1C9JA 2AMYA 3KL4A 5IJ0A 2BEVB 1E1KA 1E2KA 2GI4A 2VP2A 1J2EA 3AIOA 3CG4A 4JELA 4OUDB 4YMGA 5AM3A 4O3MA 2CSUA 2WC1A 4JBGA 4D9NA 2ZPTX 3ZNNA 2PGLA 1L5KA 4BO3A 5KYUB 5HWSA 2C7BA 3GNTA 3HLKA 1IZ8A 3F4LA 1TCAA 5CPFA 5H4GA 4ZEVA 1DEKA 5JH7B 3W2EA 2ASEA 4GF5A 4PQEA 3GLGA 2W6NA 4LHWA 5EZYA 3QYJA 2I4OA 3QP9A 2O20A 3SX4A 2C9DA 1KYWA 3EIOA 5KJ6A 1DWPA 2D54A 1WAMA 1UBCA 2P2SA 3BAFA 3EVEA 4II2A 3MJSA 1OTHA 1SURA 1KZYC 3DOOA 3STVA 5CNJA 1UJCA 1L5MA 2VBGA 4Q7EA 2ZSAA 3OT1A 1JKXA 2JIDA 2O48X 3A36A 4KMRA 4CR6A 3GK3A 5DGXA 2VJNA 3B3FA 1KSJA 3BXGA 5AVRA 1X1SA 4YCJA 4WY2A 5E6SB 1ZJJA 5AQEA 3P9PA 4G65A 1LPNA 3GLTA 4ONEA 2P91A 2YVAA 2Z2KA 3A05A 3TB6A 2O6HA 4RKWA 1K66A 2H4XA 4XA8A 4CETA 3VR0A 3DW1X 5EOVA 2NACA 3V42A 2E37A 1A82A 1II9A 2WOJA 5I9MA 3WGZA 1AMUA 1BVUA 3EXFA 3D8NA 5D84A 4ETMA 3GBVA 1F38A 1X0VA 1U5BB 2VQ3A 4G1FA 1ORVA 4NP6A 3ICVA 1K1EA 4EHNA 3ZGNA 3KT0A 1X87A 1F48A 4GUAA 2B9EA 1AKTA 2FETA 4P7BA 5ARDA 1GQ2A 3W4KA 2O2CA 5AI5A 1R0BA 5CDTA 1NY6A 1N0VC 3NPAA 5CCDA 1E1YA 3EGIA 2Z98A 3QVUA 2RI0A 1G98A 2QRMA 2R7NA 1S2DA 1Z35A 2AF4C 4MKXA 4KQHA 5ALIA 4AT1A 2ASVA 1OCEA 5IKXA 2NSYA 1FVFA 3HFRA 3GLGE 4TSRA 4DLVA 3I8OA 1JEOA 5C4GB 4RNCA 5DW0A 2GBFA 4C4OA 4CL0A 1KAMA 3K4PA 4MMZB 2FMXA 3CE9A 3G8BA 4N8DA 1AQYA 2K2WA 5LQUA 4WBXC 4B47A 4H7EA 4ZQBA 5KWJA 1V2GA 3LWDA 5KYXA 1QDUA 2KWIA 3RUCA 3N2KB 1N5IA 1TTHA 2YXLA 4UDYX 3CLUC 3O75A 1JEDA 3PXDA 5K8VA 3T3MB 3HUTA 2AZDA 1TT5A 1GGFA 1PTJA 2FA9A 2GWRA 4OM7A 1PT9A 3MSXA 5F7ZA 3ACCA 3UYKA 3WGJA 1Q0RA 4YALA 4E32A 4AWAA 2QT0A 3X2EA 1GY8A 3ZG6A 3KDAA 3G89A 3F8TA 3H19A 4IO1A 1G8JA 3DZHA 2OGZA 5KDOA 3X44A 3N2IA 1Z4NA 1YJAA 3DLHA 1KIMA 1E3JA 2ZROA 1PJQA 3DKKA 5CNMA 4P7FA 4MRRA 2Z8YM 2ZWPA 3SHFA 3DT8A 1F2TA 3GCWA 1JECA 3K73O 4ZP1A 3H1AA 4YV0A 3FOEC 1Q3HA 3I9OA 1L5NA 5BMOA 1X8KA 3AB8A 3DOIA 5EPUA 2IEDA 2Z6VA 1HEIA 3PDUA 3T5CA 1OXUA 4E1VA 1K7XB 2K4MA 1JKIA 4UNIA 5A0FA 3OAAD 3PK0A 5ITSA 3SF8A 3Q3EA 4CUZA 1NN0A 4JUCA 1T9GR 1VE7A 3LT2A 4OLAA 5DOZA 3BE8A 4BC1A 3R7WA 4D56A 3OLYA 1N2HA 5JXIA 1PT8A 2FFHA 1SU7A 5SZIA 2WF6A 2ODQA 2G77B 1JFVA 3OQHA 3B6KA 4NF2A 3PHHA 4CKZA 2ZKLA 1NT2A 3THXA 1Y9EA 4HOYA 4PQGA 1F12A 3LUHA 2HZ7A 1AOXA 4MVJF 1PL6A 5FBHA 2F3UA 3TX2A 3SLRA 1YJQA 3A7DA 2JIZD 4C7JA 1WBDA 2DX7A 6ABPA 2W2PA 3LA8A 1E9AA 2DM6A 2WLSA 3FYTA 3W5UA 4RD2A 4P98A 5LQDA 3IBTA 1EUYA 1G55A 2VWQA 4G0OA 4OXQA 1YB5A 5ALGA 1U8AA 2YZGA 1PZGA 2B6HA 1J24A 1AUPA 3AR4A 1W75A 2IYWA 2J41A 3GRVA 4OKIA 3PPWA 4FI3F 3SMQA 1TVEA 2FRXA 2YIJA 3L2OB 1CX9B 4MKRA 2WHXA 4HDKA 2B0JA 4LRUA 5AK3A 4Z1OA 1DQYA 4YRSA 1HZZA 2IDZA 4JSTA 3HEAA 2Y2VA 3OO0A 2ZB3A 1SCUA 3QNWA 4MQMA 5GINE 5MFZA 2YRXA 3OZXA 5FXMA 3JSAA 2OBLA 3KO8A 4RULA 2OB2A 2CXHA 3H8VA 3IP6A 1GGMA 2ZIZA 5TGZA 2GYWA 2RGUA 1RPNA 3FCSB 4W7IA 4Y9UA 4UKDA 4E3WA 2B61A 5A9SB 2X0JA 3VJRA 4D9BA 3BXHA 4CKCA 2R86A 3T8YA 5DM2A 1ENZA 3HY3A 1O3YA 1SNYA 1N2OA 1TECE 3DL4A 3LPMA 1O54A 1NYTA 3QA3E 5BYAA 2IYFA 5JQGB 5B4VA 3V6MA 4DZTA 1RXVA 2XTZA 3CG0A 5E95A 3ZCPA 2PLWA 4EYSA 1Y8ZA 4D25A 2VRWA 4HNVA 2GD0A 3OURA 3RYCB 1DU4A 2O0KA 4NFYA 4CKWB 1SXJC 3OTWA 3QM1A 1BAPA 2V6MA 3TVYA 3OQ6A 3IP1A 2YWHA 5ADWA 5I51A 3T5AA 3NMUF 2X0IA 3DXZA 1I0ZA 4NS4A 4U2CA 5JMWA 1W36D 4L7QA 1XCGB 4JFAA 1OZHA 2ONYA 1QGAA 2W6OA 3PD0A 3GZTB 2Y4OA 1SD5A 1KY4A 3KQMA 1M6YA 1N75A 1RABA 1SVIA 1RJ9B 2PU7A 3JQDA 3MTDA 3WBBA 3G2HA 2HR1A 5JCXA 3KAJA 2XQIA 5G53C 5F12A 1C8KA 1Y7HA 3A8TA 1D5CA 2I4NA 4NR0A 1ZOLA 4D3XA 4CL2A 1XTZA 4B79A 3L05A 4ETWA 1YIDA 4AN4A 3CZ9A 3ZDBA 3ERCA 2DFKB 4KIUA 1NV8A 4KO8A 2ZDGA 3O38A 2RKBA 3PGJA 1RMTA 2Q46A 1Z6ZA 1NAIA 1UKZA 2SCUB 3N0TA 2XXAA 4LXQA 2H1FA 2I5PO 2J7PA 2W8ZA 1P7PA 1ZQ9A 4PO3X 4TMVA 2FPWA 1GEGA 3I1IA 2JH3A 2R5NA 3HLTA 3KJHA 4IRXA 2PA0A 2G9ZA 2BM0A 3UICA 3VI3B 4QUGA 2JJQA 3ANNA 4WMLA 5DGDA 3AVUA 4RQAA 1IMJA 5FYDA 1FMFA 2Z8XA 3NV7A 1GZVA 2PCJA 2JIBA 2PKCA 4NJOA 5B3JC 4RA9B 3C5VA 3KEFA 5ALRA 5B4UA 2XQFA 1HFJA 2GFHA 3IEPA 4YRQA 4RHTA 1UAYA 3A1SA 2ACVA 4M7RA 3R77A 3T9AA 5JJCA 3AERA 1FCJA 1LS1A 3ABOB 3DBOB 3H1FA 5KYYA 2PX2A 1X74A 1OH7A 1QGUB 3CWZA 4KR7A 3SICE 4KDRA 4H6XA 4A2PA 1E3WB 1HLGA 1ND6A 1QORA 3F7MA 4BFTA 1SUCA 4IXNA 4POOA 1S02A 4CLOA 1U3TA 1Y3BE 1XEAA 2AFHE 2UVPA 4TXHA 4AX4A 1E0AA 1H8HA 2O3TA 2QRZA 4MR8B 1JLRA 5D3KA 5A2GA 5KTKA 3BT7A 1YDWA 3BWDD 1B6TA 2VRBA 4M9RA 2RC5A 3VPXA 4Y1EA 3SNHA 1V9CA 2CCKA 1IG0A 2I4LA 3DDUA 3SFVA 3WB9A 4BP9A 4POAA 4URUR 4KITB 1KJIA 4MKHA 1HE4A 1R64A 5AOCA 5C35A 1AUOA 2I9KA 1JVNA 5DRYA 3IHTA 3FE2A 5FL3A 2PTGA 1OAOA 4P81A 1XLVA 4D0SA 1YJ8A 4Z0TA 4CEIA 1Z2NX 2EZ4A 2ZE6A 4GO1A 2JGMA 4OMDA 5ESRA 1CUUA 2GKSA 4UPDA 3UGKA 2IU6A 2J08A 2EJTA 2WUEA 2XUFA 4IH9A 5E9QA 5AVKA 4HBGA 4M7WA 3ETGA 2GZAA 1V1RA 5J40A 3RTBA 3REGA 2QTCA 4H7KA 1ZMRA 2GRJA 1HDGO 2C57A 2HRDA 2WSLA 2FPOA 1LFAA 4RH3A 4YRJA 2B5OA 1RPAA 3ZYZA 2JJ1A 4RGBA 2Q1YA 3EGDA 2DU8A 2XYVA 5FWDA 1TAHA 2IZOA 4JVLA 2Z6UA 2GBGA 3WWDA 3LPDA 3NHMA 5BR8B 1OXKB 4FUQA 4IF6A 2IXGA 3E9YA 4ZYWA 1C9NA 4OK6A 4MI3A 3REFA 5KNCA 1FUKA 2JGRA 1M6HA 2CBZA 2OLJA 1FQKA 2D2XA 1D0VA 1XYYA 3HJTA 4A4DA 1EESA 4YJ3A 3M4YA 1I1QB 2V6JA 4RCVA 5F4BA 2Q5QA 3IQIX 3V2HA 3GRRA 4YV7A 4RVSA 5JHHB 1STOA 1H93A 1MU0A 3LY7A 2FX3A 3EZ7A 3LCRA 3KC2A 3M89A 3D8TA 1W6UA 2C95A 1KYYA 4MW2A 4QBIA 4AUNA 3LK6A 3QOFA 4UASA 5EUMA 4K6GA 3SYNA 2NZWA 1XEXB 2G4CA 4LNAA 4WLOA 3MBOA 3PT9A 4LECA 4P4GA 3ZQJA 3AR6A 2J5XA 3DXXA 4LOHA 4FLMA 3I2HA 4P2BA 2A8YA 1R8SA 2XA1A 4O4LF 4RBNA 3U26A 5ESDA 2FWBA 3R1IA 1UK9A 4ID9A 4WOKA 3W1EA 1D1TA 1GPJA 2OV4A 4G0MA 3Q8LA 3O3MB 1SOVA 4J7UA 5AHRA 4C0QC 2VHWA 3E8XA 5IU6A 2CF6A 3ITDA 4F2DA 1XMSA 3ZDDA 3RIEA 4AP6A 4JP1A 3CZAA 1X1DA 3PWTA 1GG2A 3OA0A 2NU6A 5AXAA 2OV8A 2GT1A 2RJOA 4XR9A 2HLHA 5B55A 1JI3A 4IHJF 3PUJA 1J97A 2JIOA 2CBXA 4B2YA 1SVKA 3SYLA 4ERXA 1J2TA 1N4DA 1KS2A 2CDAA 1WZUA 1NLZA 3FFAA 5H4HA 1A95A 1U7ZA 1KK3A 1VKHA 4DCMA 5TPWA 4L5IA 2F1KA 2CDCA 2B82A 2DP4E 4C4TA 3TW8B 1QLHA 4OMFG 4OF4A 1YE3A 2DLDA 4GYKA 2QLBA 2LD4A 5HGJA 1I6WA 2QWXA 3JATB 2K5UA 3ZWKA 4PRLA 4M0CA 3GFTA 4ASUA 1G18A 1SXPA 2FWJA 1XYGA 3PFWO 3NTOA 3O73A 1T5OA 3TNLA 1DZ3A 1PQYA 2WAAA 2AW3A 2JZCA 1CVRA 3EY9A 1P8AA 1GQQA 4OHPA 5JZSA 4QYSA 1UXKA 2IA5A 3AFHA 3VZBA 4C7MA 3LG2A 5DP1A 1YL7A 4L4XA 1RWPA 5AKXA 5K6AA 1DLIA 4LV8B 4F8JA 1NBOA 1PRYA 1Y1SA 2GUGA 1P4JA 2FE1A 2AFHA 3DKVA 3MWEB 4JX9A 3EC1A 1GGVA 3KFXA 5HE9A 4AYWA 2XMRA 3TTWA 1S3GA 2LBPA 4LY3A 4OXYA 1IRIA 4BFYA 1NATA 3MLBA 3G8YA 5FTLA 5KEIA 2WF7A 3Q72A 4WXMA 1IUNA 4P6VF 2GCOB 2W6QA 1PJ4A 2HBQA 3BK7A 4HFNA 1XZJA 1JAYA 1YKFA 1YI1A 2WPNA 4DGSA 4BRWA 4LHZA 1PWEA 4XVQA 1ORIA 3BXPA 4NENA 3A1WA 4Y2QA 3FSGA 1XLTA 2Y93A 1I7SB 3ZLVA 2PKYX 4BV2A 4CR8A 1MHTA 4W1QA 4CQLA 2WIKA 1Z5GA 4EMTA 3TXXA 1BTOA 5P8WA 1CS0B 4BO4A 2GNOA 5J63A 3IAFA 2LCFA 4PQYA 4IM7A 3QI7A 4UEWA 3LP8A 1DADA 2VXOA 3H04A 3LUDA 1GCGA 2Q4EA 4Q4HA 4B1FA 4DNFA 1NKTA 3HKCB 1XNGA 5BO5A 3OFKA 2J0VA 2CSXA 3KBBA 4B2IA 4Z51A 4ACBA 1AV7A 2QX7A 4DLRA 1TK9A 3I04A 4LW8A 3UB3A 1NR7A 5A4AA 2C42A 2I4MA 1QOQB 3LECA 3W7BA 1EBFA 5TQ2B 3AI1A 4CIWA 3JAWB 3LX8A 4XX1A 2BKUA 3I2JA 4R68A 2DWPA 3P45A 4IILA 1XB2A 4R1NA 2OLKA 3Q41A 4KE9A 3T7RA 4YCCA 5HM8A 3K0SA 1EGMB 3UXEA 1U8TA 2GPBA 3Q15C 4E11A 1MH1A 1U7XA 1Z4IA 3A31A 3H84A 3VOSA 2WT8A 5F64A 3FVVA 2XNDD 2CNLA 5U1PA 3IP5A 4O0LA 3UOWA 4EATA 3JQ6A 4MO9A 1YXMA 4HFJA 4AUMA 1YIOA 1BMQA 3L1UA 3LX4A 3ETLA 5KYTA 2NSJA 1SGWA 1EBBA 3B20A 3JASB 4DVGA 2IS1A 4NXNB 2CE7A 1IDOA 2ZBQA 2FN3A 1TRHA 3FMVA 3GMTA 1P73A 1A5BB 2B8NA 2G7ZA 1G6KA 1U6IA 2C03A 1A8HA 3B9PA 3GOHA 3EZLA 5KKNB 3Q40A 3C6MA 4I4TB 1GUFA 5D86A 4EJSB 4DR2B 2HHHB 1CUEA 1L5HB 4XQEA 1JG3A 3FZEA 4QFBA 3SQLA 2IS4A 2HQSA 3S99A 1ATIA 1QV6A 4AJ4A 4FCVA 2BI4A 4JLBA 1IJFA 2GPJA 3NW9A 4EJ0A 2JVKA 2Q3EA 4TS3A 4AS3A 3OF2A 4LV5B 3VOTA 4DM4A 3GP5A 3W9SA 2CHGA 2X2PA 4GOOD 2BZ1A 4L28A 5EHNA 3V80A 4F97A 1C80A 1E5DA 1H5NA 2ID7A 3BHNA 2XGOA 1NJ6A 5FHQA 4D9KA 3CQ9A 1NXOA 2H7XA 2PYIA 3HZOA 2VCHA 2FQQA 4LDPA 4OFXA 4XGRA 1U9IC 3IKMB 3N7TA 4F9EA 1EQUA 5EC8A 5ICFA 5F2NA 2ZUEA 1X7XA 3A10A 1QGZA 4L0CA 1G16A 4XYGA 1FDIA 3VPDA 3WDKA 4C7BA 5JVDA 3WQHA 4DMRA 2AMLA 2I7CA 1JT9A 2AR7A 1KH3A 3AOEC 3AXSA 4WRRA 3WYBA 3VR6H 4AVYA 2CC2A 1RADA 4QVGA 1MPTA 3DDOA 2YHIA 4BMVA 1Q7RA 3CCCA 2C7PA 5BR4A 4XUDA 3GEGA 2OC4A 3ZGZA 1YDGA 1GGJA 2R00A 3EXAA 3G0CA 4RMGA 1ZHHA 1AHIA 1VL5A 3DE2X 4HFRA 4KK4A 4MUEA 5F1KA 1NI4B 3GBSA 1YS9A 2WPDD 3TM5A 1N2XA 2XTAA 1IJBA 1KSFX 4P3KA 4DZZA 4XEHA 4EW2A 3LLUA 2PRSA 4KSCA 4CM7A 2V03A 4MIEA 3K2BA 4D8XA 4JHXA 1FU8A 1CZOA 3ITNA 4EW3A 4LTDA 3R4VA 2JLCA 4P5EA 3KT6A 3LYAA 2J30A 4R1SA 2RGYA 4MA5A 1F1JA 4JCCA 2F55A 2VF8A 1RWOA 2I6XA 2YASA 1QBGA 3NCTA 5AQ1A 5KSWB 5AW4A 5IKOA 5GP1A 3IT1A 2XZDA 1TO1E 3L92A 3MNFA 4K6HA 4B8ZA 1APBA 3BTVA 2RMKA 5DM0A 4Y9SA 3FCOA 3PX2A 1NF9A 1YZUA 4TM8A 3HL0A 1E64A 4R31A 2JIQA 1XZGA 4OI1A 4ARIA 2GTHA 2CLSA 2ZKIA 1HRKA 4MQ6A 4MXDA 5B1HA 1U0FA 3SE7A 3TTYA 4MIKA 2ZUUA 5ALEA 1XPUA 4YUZA 3AK4A 2DECA 4G24A 1B23P 2CE2X 1CY1A 3ZJYA 4EOGA 1L7RA 1DE0A 1RAIA 4FCTA 1R0CA 2V4MA 1G0NA 4QOSA 1Q0TA 5D8DA 5AKZA 2H18A 1QFJA 1HE8B 4TMTA 3M4XA 2EYUA 3UCFA 4UCQA 1NLMA 4K87A 3SHWA 3U5ZB 2HDNB 4JJZA 5L4NA 2CXTA 3HYLA 1GV1A 2QN2A 3ICOA 1DQNA 2HWWA 3KELA 4GQBA 1MO6A 4K8RB 4M49A 4WKBA 3CWQA 3EEQA 3PFNA 4OQMA 3KFLA 5ECDA 2CVQA 3PGMA 3RJMA 3S2FA 1BG6A 3E2IA 3OF5A 4H0FA 5FQOA 4WEQA 1P91A 1M0TA 4BUJA 4DANA 4YLYA 3GDGA 4YDQA 3HN7A 4FHCA 1DAMA 1T2VA 1BJRE 3QRWA 4KBFA 4M36A 1FF9A 1NHGA 2AG0A 3AIIA 3A1UA 1JHUA 3VYSB 3NALA 1FFEA 3IUBA 3AUKA 1ONBA 2ZRNA 1NJ1A 3B1WA 3F9RA 3HKBB 2VZ8A 3MINA 3O2NA 1E7QA 4E08A 4DV0B 3DV0B 1ZRMA 1D2MA 1L8AA 2XNKA 4X0EA 4YC7A 5H81A 2YNMD 4TQUS 3B52X 1OXXK 1MGPA 3DA8A 3H5WA 3Q1LA 4MPJA 1LKZA 4PICA 5AKGA 4NYIQ 1CPYA 4FP9A 4ZWNA 2QQ0A 2H5IA 3NANA 4QXAA 5AHOA 2FW0A 3R5XA 5C1IA 3F5DA 3ZX4A 1EXWA 2GEUA 4CZ2A 2A1UB 3GFFA 3HFGA 4OGKA 1AUVA 1M2HA 3TVTA 1UFRA 4FE7A 3IMFA 1QIEA 3P0HA 4NDAA 1DV1A 4PSCA 2PZBA 1Z4PX 1H8EA 2YTZA 121PA 4ZO7A 3ZXXA 3GZ4A 4YRMA 1R6DA 1F3LA 1JLSA 6REQB 1ZDMA 1GU7A 2A3NA 2WNIA 2O2GA 2UV8A 3UO8B 2EZTA 2JGEA 3D4PA 4LWQA 3WBKA 4EO4A 1XAHA 4FEGA 4RSHA 4AF6A 2FMUA 3SEAA 4Z53A 4LXXA 3R9XB 3CKMA 2UDPA 1RVV1 3M81A 3MG9A 1DO2A 3UH1A 3BFPA 1FFCA 4G09A 5IF3A 3ZY3A 4UPEA 1WXWA 1X39A 3QITA 5KNBD 2P40A 4PGMA 4NOJA 4FONA 3FWPA 5LJLA 1KEPA 1CEEA 1KQ3A 1Y4DE 3H5AA 5AKJA 2GZ1A 5GONB 1R4ZA 1XNHA 3QBEA 4NZZA 4BNWA 2JJ8A 4GL2A 1WCIA 4OHXA 3H9GA 3DD1A 3BG5A 4F93B 2Q3DA 1NN5A 2OFPA 1LW7A 2P8SA 2X9QA 3OZEA 1JEEA 1EHYA 2XQKA 1S2GA 2C58A 2OE2A 1N6RA 1BWPA 1IHPA 3Q3GE 2HEIA 3WFIA 2G88A 3RI3A 5B1DA 3FB4A 4ZIRB 4JVNA 5JD4A 1PT7A 5KBYA 3DHWC 5JRDS 2DLCX 4B6SA 1SBHA 3DOJA 4HD8A 1CJKC 4WZAA 4C0KA 1V4NA 1DKRA 1SBIA 1NGSA 2X14A 1DAPA 3SN6A 5ECGC 2GPYA 4A7PA 2A9JA 4C4XA 1U9CA 1TLTA 3V9AA 4HFMA 1DWUA 3DR5A 3U13A 3DMPA 3TBHA 4DIOA 3VPCA 4BNKA 5A5FA 2AEEA 4NPCA 3NWJA 2VI5A 5GOZA 3VU8A 4ZICA 1MH9A 4QHTA 4BXOA 5K0EA 1AGYA 2VHJA 4J0IA 2ODNA 3I37X 3G3EA 1I2MA 3FDZB 4K6MA 4CM4B 2GBCA 3LKZA 6Q21A 2WWVD 4XCXA 3OJLA 4J0EA 1YQTA 1W5FA 2QXUA 3G17A 4CE6A 5C80A 4K5QA 1XXHE 2C3UA 3C7CB 2BL4A 5DWQA 4U4AA 1W581 1M8GA 2WU4A 4QHSA 2GZDA 1Q0ZA 1WY7A 1YZNA 2WFMA 4AMGA 1LNZA 1QJCA 4KO1S 3SR0A 3FXAA 2AXPA 3FPHA 1R12A 1CNMA 4H7DA 3OEED 4YI5A 4F92B 2E2WA 1KI7A 3DBLA 4LHYA 4R0MA 2OFOA 1MD9A 1WDWB 4MB2A 4UULA 3W2IA 3E9DA 1SCJA 4JNCA 4IQ4A 5F2OA 4H1WA 5JADA 1VOTA 1X1AA 1TKRA 3RUPA 1Q44A 2J5RA 2ZIUB 4MKFA 4TV9F 1B14A 1ZH2A 2NUPB 1GTRA 3ASYA 2MYUA 4G4IA 3CMCO 2WICA 2YV5A 3A4VA 4RTNA 3FUVA 2FSUA 1T91A 2P7IA 3KQTA 3RTEA 4I46A 1Y5LA 2ZYUX 1LEHA 2R6HA 3VM6A 4UU1A 1OFVA 1PJCA 1JEQB 3RR2A 4ERNA 1UPUA 4FJ2A 1AQUA 4BX0A 1VKZA 2CYAA 1LLUA 1QU2A 2IYNA 1IXZA 2XI4A 3RRFA 4I4TA 4EJSA 4PYIA 4PHTA 1WSWA 4JS0A 2BFBA 3ZWOA 2BELA 2ZS8A 2A59A 3KVNA 1UKBA 4R7GA 4EGFA 2RGDA 2C0PA 3N53A 5J58A 5JO0A 1VFNA 2CXNA 3ZJ5A 1RJFA 4Z9BA 3L7LA 1VLQA 2JZOA 3DOCA 3ER6A 2HO4A 4KGZA 4EHDA 2BVNA 5KTPA 1O95A 2V9ZA 4W5QA 3C39A 5HJ2A 3HCAA 4N12A 3FPGA 4OSPA 2JH8A 1X13A 1N6HA 3BRCA 3Q9SA 4MCAA 3WLKX 1PGNA 1JVBA 2MSCB 3HN2A 2X1VA 1H42A 4WFKA 1UBRS 3OCXA 3GFSA 5K0FA 1M10A 4JGBA 3CUYA 1FYVA 1PEAA 3VVLA 5B3JA 2QLJA 1SKUA 4QU0A 4URZR 4ADSG 1IVNA 4L8WB 1CUYA 3FLAA 4E03A 3ROMA 7YASA 4J1TA 4MMXB 1WOYA 4YR7A 1U7PA 5EJ9A 2J0SA 2Q1WA 2MR6A 1YR3A 3ABRB 4LAFA 1U8ZA 4I08A 4L4ZA 4B3JA 1ZK1A 4K05A 1VDMA 3OU7A 2OQVA 4CT0A 1Z5NA 5JCOA 1E4VA 2RHDA 4IHKA 1B3BA 1WZIA 1XV5A 3EGCA 4K6OA 4L51A 5CT4A 2Y66A 4BNDA 1AXRA 4NE2A 5A05A 1WOMA 2YV1A 2GESA 2YXNA 3ADPA 5BUZA 1LI7A 3H2JA 7ADHA 4Z86A 4GSYA 1M1NA 1T2EA 1ZESA 2G0TA 3O0TA 4MV7A 4WK6A 4CMEA 3F5MA 5HHTA 5KKAA 1ULZA 4HMQA 3PX7A 4GGPA 4B81A 2CZCA 4GM0A 4D4MA 2GO7A 1X1BA 4G1MB 3PL1A 4QYIB 4BKPA 5DNYB 1SOUA 1Y6FA 1A8SA 5CJPA 4OUKX 1IG3A 1YSCA 2WWTA 3F90A 1ORRA 4JK3A 1V7PC 1USWA 3DUFA 3EXIA 4FD3A 4KRYA 5FPKA 1J70A 1SCQA 5BSVA 4Q1VA 4UTOA 3G1TA 2C84A 2VNKA 4DMMA 5AVVA 5AVZA 5JFTA 2Y3IA 2CLKB 2I7VA 4DLYA 5CR9A 3OVMA 3TI9A 4OBEA 4DC9A 3LNTA 1TADA 5ARBA 2DTDA 4ZYXA 4R2WA 2AJBA 3D8BA 2JIPA 1ZR4A 2Q2QA 4ER6A 4IKEA 2WE7A 2J8ZA 1LBIA 4G56A 2Q45A 3L6CA 4B44A 3I4CA 5F98A 4XWOA 4GM1A 1ZCFA 1SZDA 1V25A 2QVXX 2IK8A 2R44A 2R1VB 4YTEA 3TQRA 5K6RA 2HSJA 2EJVA 5DHPA 5C9ZA 3HDHA 4HDAA 1AGNA 1VE9A 2BF4A 1E5XA 1OASA 1YVRA 1XKTA 1DBIA 2HM7A 2XE6A 5JCZA 3TW8A 2FWRA 2Y0CA 1UMBA 5HDBB 3VKFA 1ZX1A 1KFEB 2XF8A 4YCDA 4IXMA 4I99A 5KNDA 3I58A 3O31A 4YXFA 5LDHA 2PR7A 4QFMA 5B2EA 4M9QA 4OJTA 3DMGA 3PVZA 1ZSVA 1P44A 1GL3A 3PQ3A 2NX2A 2H16A 1U3FA 2FG7C 1Y1KE 3NHUA 3UV3A 3VTFA 3S70A 4DUYB 2C2XA 1QTIA 4S0XA 3RDPA 1R8XA 1H4SA 2JHFA 4MA4A 3K92A 4ZVNA 1NE7A 1TCBA 1UZLA 3LY8A 3ETJA 1VKNA 1G1MA 4AS2A 2HCFA 4HH0A 1CZHA 1JLLA 4OQPA 1K5HA 4G97A 4XVHA 3MWDB 3A1EA 3AI2A 3OIDA 1DDIA 2PX0A 3F2IA 4LJSA 1YA6A 1B76A 2BLLA 1SU4A 1ZGAA 2IX9A 3R7FA 3VYUB 4NZPA 3GDOA 3GLRA 2N0SA 4UUPA 2C88A 2Y67A 5KYWA 4QTYA 5DLDA 4JJAA 2FMFA 6CHYA 4RM2A 2GVDC 1FX0A 1C0IA 3L1KA 1RWKA 5AI8A 1GNQA 5LZ4A 5HNKA 3KWMA 4P83A 3ZQ4A 4P38A 5IX8A 1MO2A 1DX4A 2I3GA 3TKYA 5IHXA 1NJFA 4WCFA 4PO1A 1ZRHA 3ZLTA 1SC6A 2ZWVA 3JYPA 3AERB 1NUAA 5I8PA 5BQ3A 3NDPA 2NPFA 1Z36A 2CD9A 1ECBA 4F3YA 5F1PA 5K0GA 3ER8A 2E4UA 5BXYA 2AQIA 3QJYA 1P1BA 3CEPB 1EFPB 3AI3A 2G9VA 3CIOA 4PCLA 3C8DA 3D0RA 1TKCA 3BDVA 1AURA 4X6UA 1JHAA 2IEYA 4LNUA 5CH5A 5F7XA 4NOKA 3T38A 1ZA2A 4TRNA 4ZV4A 1PSDA 3L1HA 1QO0D 1KAHA 1V96A 2M6SA 3OOJA 3ADOA 4PHGA 2ORVA 1WMAA 1PZEA 4UW9A 1M2FA 2H57A 3CCFA 4XB2A 2JS7A 2M98A 3OEWA 2CMFA 2EGUA 1G64A 4CNBA 2W2TA 1ISMA 1RQRA 2O4UX 2GD1O 2V5UA 2UZAA 3AKEA 2FZLA 5G0WA 5LSAA 4ZDKA 3Q87B 2UXDB 1P0MA 1GFSA 1KRHA 4XD2A 3WL4A 5FUYA 3LUCA 4ARUA 1JL3A 2VEOA 2N42A 3BJIC 3E9QA 5CH3A 5DN9A 3PCRB 1VCNA 5LR6A 3H97A 2JATA 4NFSA 5FJIA 4YP7A 4EW6A 1L4NA 2JJ2A 4S35A 4DBLE 5ER9A 1W36C 2AFIE 3DAYA 4LJ4A 1FDRA 3GVPA 3TLMA 3VDRA 2IY7A 1T4CB 2JFXA 1GU0A 2DSTA 4K86A 4PEVA 1H2FA 4KZPA 3CN9A 4PSAA 4B4UA 2EGHA 2BKEA 2H08A 3IO5A 4KWEA 3OZBA 3HU3A 3FMGA 4Q24A 2DQYA 2CHVA 3D7MA 4UUMA 3OP1A 3OF3A 1E1QA 1XTQA 4RDCA 3WHLA 5HVNA 3KR9A 1TYEB 4M6WB 5KYNA 3EGDB 1SK9A 3GZNB 1B4DA 3KTOA 4P5PA 1YT5A 4PYQA 1UF9A 5F9FA 2BTQA 5M34A 1T3TA 1Q2XA 2M9MA 3PQFA 4M0DA 4PAOA 3V6LA 2OAP1 4N39A 3H6KA 4TMKA 3ZWMA 4HTFB 4B2PA 1KJ9A 2BKVA 4BGUA 3DE7X 1VHQA 2QM7A 3QGMA 3UJ8A 1FDTA 2ZJYA 4JIMA 2BMDA 4TOIA 1EEXB 2Z2XA 2BSXA 3C8ZA 3LDGA 3PNVA 4RF2A 1M75A 2BY4A 3RROA 3MB5A 1VLJA 1RLTA 2YWGA 3NNDA 4RPLA 1TU0A 3VC7A 1Z2DA 4FT2A 4K6KA 4OPMA 3TSWA 4S05A 1PFWA 3BMOA 4P53A 1E7RA 5JFGA 2AFIB 4TLEA 3D6TB 3EGXA 1FY2A 3FDFA 1KEVA 3WGMA 1GRVA 5KREA 3MGBA 2YN2A 4TT3A 1RRCA 1ZN7A 4EHBA 1AGXA 5AM0A 4IDDA 2OKGA 2H06A 3H87A 1KMQA 3HCPA 2R47A 3QSGA 3TQIA 5BSFA 2O14A 1GRRA 3BWBA 5HBGA 1Y34E 2BN4A 3DBHB 1LPPA 3I6QA 1KC1A 1KP2A 3JD3A 5JYBA 1GADO 4WXRA 4ZEWA 1AQ6A 4YQYA 4LJAA 4KO3S 4XQCA 1GZ3A 4G1CA 4EW1A 2IWRA 1OXBB 2G5TA 4J9VA 1ML4A 4OEHA 5IN5A 1FYWA 4PIVA 1XMIA 2C94A 3PICA 1GNLA 2QXYA 1OLSA 3V7NA 4GH5A 1U63A 1WD5A 2VK2A 1GRNA 3H17A 2A0UA 1FK8A 1FRNA 1WMFA 4H17A 4JJ4A 3DB1A 4R9VA 5EIAA 4B6PA 3AHJA 3LK7A 2JFFA 3KPWA 1YFLA 3JQAD 1HE2A 1KVQA 1QVZA 3MMNA 1G42A 4G67A 4LRQA 5EFOA 3IB3A 4RVFA 1L5GB 2QL9A 1TUIA 1NVGA 1QQ7A 3I34X 3I9LA 1E9BA 3IQZA 3SEQA 2WEKA 3D3WA 4GNRA 1U9IA 2I2FA 2IC5A 5AJUA 4YB8A 2HSDA 1J8YF 1QAOA 2WMYA 3PFGA 3CNHA 1DOHA 1Z0UA 1RC0A 5L51A 3C1AA 3KZ1E 2BI8A 1MAAA 2O9JA 1E96A 3LUGA 1SKAA 1YC5A 1EHCA 3EF0A 2FEPA 2PX8A 4CQJA 2QK4A 2C5LA 1JHPA 1P17A 1DIRA 2RH5A 3L9XA 4TYPA 3HEBA 3QWIA 1OAOC 2V7GA 1BMFD 3OZDA 4O2AB 4PYLA 2AKEA 1I51A 2J5KA 4AD8A 4AUEA 1NXPA 1ZUNB 3K09C 5HW0A 2GEDA 5JBIA 1KORA 3GJ0A 3G7NA 2LGJA 3ZCTA 4EA6A 3G2LA 1RYFA 2R7AA 2R8YA 3GQBB 1ONPA 4IEIA 3F8WA 1ZHFA 3G2PA 3ZVLA 4BX2A 3OQMA 5CH8A 3NQ41 4B35A 2PWYA 4KLRA 1TAUA 1F4LA 1CF4A 4OJKA 1I2ZA 3WB0A 3L8MA 3TTTA 5IXJA 3HXQA 1PZMA 4M83A 1H23A 1KTVA 5FA8A 2CMKA 1TJ5A 2Y1KA 4BJ3A 2NYAA 3SXUA 1ZVVA 1N2IA 2AOXA 1VPEA 1JI0A 1ZD5A 1D2EA 1MEJA 2E48A 3E18A 1SCKA 3R5SA 3WHIA 3WLEA 4QYXA 3WRYC 2AT1A 5GAJA 2G0NA 1NF3A 4YJ2A 1VYUA 1RSZA 5E3JA 2OXIA 4BIIA 5EXEA 2XNJA 2FPPA 3A6LA 5JWRA 3SNKA 3HTXA 1B3RA 2DJ5A 2NU9A 3NC1C 4CMIB 2HO5A 4NFHA 4ENSA 2DHEA 2QZ4A 1AKNA 2Q9BA 3CUUA 5C32A 3TRKA 4DW8A 3D81A 2CV2A 1YASA 4AY5A 3RSZA 1J9GA 4RMHA 2VDMB 3K0FB 4UUAA 2FNAA 3FNBA 5EA2A 2H52A 4B5LA 4CLDA 1W4BA 4RZQA 1J0AA 3KOWA 1FNCA 4CDNA 5CVCA 1GLVA 4K7JA 5ITVA 5LKRA 2ZK7A 4R41A 3S1AB 3U44A 5AKEA 2LKCA 1GSHA 3DHYA 2XCOA 3IIEA 3RS0A 4LJKA 4KIGA 4V0ME 5G4LA 3GRAA 5HIIA 3N0RA 2XHZA 3REOA 4DEYA 4G1BA 4ITVA 1UXOA 1COWA 1RP1A 3HBAA 2JHGA 4MTCA 1NPTO 5HIJA 2PZ8A 4KQMA 5JAIA 2EFEB 5LQKA 4RTPA 3FSJX 4IIJA 3UJ9A 4R1MA 3W5CA 2YFYA 5BOVA 4ICIA 5JY1A 1MRSA 1UKCA 4WFQA 2XE4A 4GYYA 5DYTA 3Q8KA 5B7PA 2R8PA 2QVGA 4AW9A 1QKKA 1DOZA 1NW8A 3DLCA 3RNOA 5ELXA 4P33A 1AF4A 1KEUA 1ODKA 1F7UA 4GNKA 4U8HA 3CNOA 1HSOA 1P6UA 2E6KA 2D06A 3NHWA 3PEUA 3HJUA 3NIDB 3RC1A 1NDHA 2HCBA 2B20A 1JLLB 2MHCA 4P7GA 1BFUA 1ZN8A 2I3ZA 3GFPA 1OV6A 2AX3A 3LL7A 1YK0A 3JZDA 4EARA 1YI0A 2PJDA 3E81A 4U3JB 3EIQA 1R0RE 4COKA 4F06A 4M99A 2XUDA 1XZMA 1QYIA 3FROA 4MARA 4MVJM 3STHA 3V1TC 3C6QA 4BLOA 5KQSA 3QUTA 1CUIA 4YIKA 5GV7A 1AA6A 4FOOA 4UM9B 2ONKA 3S1SA 3PNBA 4N7BA 3K7EA 5TIIA 5FUMA 1WWKA 5AKIA 3HBFA 2W4MA 1VTKA 4JOSA 1I7PA 3OLWA 3JWIA 5C18A 3A3YA 1I8TA 5E3HA 2QIOA 3Q88A 4EJMA 3GFBA 3AL2A 2YBDA 1VJ1A 1X7XB 1U7DA 2YQZA 5ALTA 3RCBA 2WHYA 3RIXA 4DA0A 1J00A 1YDFA 2GA9A 4RWZA 2E21A 3LXRA 3HXOA 3AETB 3HBNA 1BIFA 4W5RA 3RVQA 3P2IA 2QROA 3P9CA 2ONCA 4J3JA 1ZOPA 4EGQA 1XWFA 1F8YA 4AJPA 3R76A 3AM4A 5DH9A 1Q14A 3N2EA 3RVLA 4JLUA 1HMPA 3IT3A 4H08A 2E9SA 1Y3AA 5ELLA 2VZ9A 4RX1A 3WQSB 1CQIA 3NKFA 5GM2A 3AKCA 1Z06A 5FWAA 3U3KA 3C3CA 5DYYA 3RYIB 4X66B 1ULAA 4EGCB 1CD5A 1VL6A 2NU7A 2X0RA 3IVAA 1RC8A 3ZDXB 1US8A 5EJ8A 1TM3E 2RKOA 4TSFA 4YCBA 4Z2AA 2ZIAA 4ARZB 3L0YA 3RTAA 4TQGA 3BZBA 3SIPA 5BPHA 4U0JA 2EF1A 1XTSA 1TF2A 2VHQA 1GR0A 2VLIA 4Y0AA 5U4QA 3ZDRA 3IA2A 2ODEA 1O8CA 1KL7A 3VSDA 3KUXA 2B94A 4FHDA 1NI3A 1ICIA 5AVYA 2EVWX 2Y0BA 1YD7A 4JYBA 1E2MA 3GNQA 3P94A 3S5JA 5FBVB 1JEYA 1X80A 1JXQA 2Z2YA 4P3OA 3UIEA 1U04A 2CNOA 2Q3BA 2IEIA 2JFPA 1SOAA 1XF9A 2QRVB 3X1YA 2YVKA 4CU2A 2P1RA 1ZGHA 4Y6OA 2HXSA 4U63A 4G07A 4KFRA 1E2QA 1MCZA 3JCZA 4UBJA 3X1DA 1VQ1A 1ZNYA 2WKPA 4DQVA 1VI2A 1EB9A 2CLHB 3K53A 4A0FA 4DFDA 3DFFA 3LUJA 1LF0A 2IT1A 5JANA 1OA1A 1IM2A 2VDNB 1RQNA 1KZ6A 1GWNA 5IBPA 3EFBA 1GCIA 3VPAA 3HADA 5CB4F 2IHYA 2BAGA 1IN6A 4D80A 1X7GA 4XUEA 5E8JA 2IPNA 3C4JA 1A72A 1ISJA 2X5NA 3K1JA 1C1DA 4TTIA 4D3YA 4DR3B 1JALA 4KHPB 4NAUA 4LSMA 5LLDA 2DXIA 7MDHA 3LL4A 3MJ4A 1JDZA 4G1VA 1M2JA 1RQGA 1QR6A 2D4AA 3FPEA 4Y2XA 4EG5A 3KAPA 3FWNA 1M54A 4QLAA 1Y4SA 3R2JA 2NTEA 2OHXA 4EPYA 3THYA 1NN1A 1CVIA 5DGIA 3PITA 1X1EA 3VR3D 3T06B 1E6EA 4LDJA 3ZKWB 5A04A 1A7AA 3D6AA 1SAYA 5F2KA 1QK4A 5CB4A 3N0XA 2F6RA 4LJ8A 2NQTA 4TKUB 1CWUA 2PPVA 2CLEB 1N2CA 1WLYA 2GGSA 4PZPA 2NADA 3OLVA 4P54A 1XTUA 2FGKA 3IS3A 2HXGA 2F8TA 1UOEA 3DHNA 4FGZA 4OHBA 1YULA 2GEJA 4HGRA 3EVAA 4IKPA 5DCWA 2OOSA 3BIOA 1D9ZA 2I91A 5G1NA 2O05A 4K88A 3WG9A 1KE1A 2GJ8A 2EBUA 4Z7OB 1Z34A 3IPRA 5DJ5A 1V5FA 1KI4A 4LXTA 4B4WA 4D0RA 4D82A 4NIMA 2PL5A 2A4KA 2XT9A 3VR6D 2WZCA 2BC9A 3LZDA 1YR1A 4HAZA 2O23A 1MEEA 1U6JA 3R7BA 3L6DA 3D6UA 4OHFA 3B12A 1WQ1R 4GOND 4HWTA 3AEKB 3UJAA 4KMMA 5I4CA 1YRBA 3P4YA 1UM9A 1ZHOA 4KQ6A 2VCEA 3WK5A 1USUA 2A86A 2BEKA 3LWBA 5SY9A 1V1RB 3RFUA 5JCOC 1E77A 5JXHA 3MD0A 2PE5A 4B6OA 4RAQA 4Z6KA 5B5SA 2Y6VA 1DEOA 2ET6A 4JI3B 3U17A 2QNBA 5D00A 4AJNA 3WC4A 3PB3A 2ZTHA 3W8EA 3TGLA 1N2ZA 2VJPA 4M21A 4RVOA 2GZ3A 4X41A 4KN5A 3TZBA 3PGXA 4PX5A 2PFGA 3M6FA 1UMBB 2WAYA 2YC2C 3E9RA 2JCVA 3HVRA 1KRXA 2CLCX 4PY2A 4X7PA 5EE5B 3WZ2A 4R0NA 3IUJA 4LE2A 3KPVA 4NS1A 3BERA 4BO0A 2RHTA 2ZRKA 1XTJA 3JYOA 1K27A 4IJVA 4MINA 3S8EA 2MINA 1R4NA 2AG6A 3PG5A 3R6GA 1LWNA 1VCOA 3ZLUA 1SXJA 3GLVA 2QSJA 4OL0A 3V1KA 2TMDA 5MGBA 4EP1A 4IIFA 3AUUA 2AR0A 1P0IA 3KPJA 4DWJA 2PGJA 5L40A 3R6WA 2AX4A 3X1XA 4L72A 3SSOA 1YQEA 3FTFA 2AI2A 2QVZX 1XEWX 3AVPA 3PPVA 3TZEA 1EFAA 4RY9A 1RBYA 4YJHB 2B2CA 2O2IA 3N6RA 1VIMA 4NL4H 1I80A 4ZAYA 5KYVA 3SSAA 1JKFA 3ZWXA 1ZIPA 2WMDA 2WWWA 4PYJA 2C4MA 1EX7A 2GXSA 1F5NA 4RS3A 5CT6A 4RJLA 3HXPA 5FWXB 1DI0A 3HMQA 1HQCA 3WLPA 3S1AA 4KP7A 4OP2A 4V0NA 3LA6A 4BFWA 2OYSA 5ALOA 3F6RA 2NMVA 1QGYA 1Y9AA 4MEJA 3VI4B 1KDTA 3EUWA 4JOBA 2FEMA 2WU0A 5HKKA 2FFQA 2DQSA 2G9RA 1AHNA 3QA9A 4U2GA 3O4VA 5LDGA 4CEJA 2JHAA 4XYLA 3ZD7A 1JSCA 5FO0A 3W6ZA 1EWQA 3AP3A 2G83A 2I4TA 1NNSA 5AVXA 2AMVA 2PFKA 2WTAA 1PX0A 2BGKA 5DK4A 2QTHA 3NNNA 3S29A 3FF4A 4UXIA 3UXHA 3COWA 3I2FA 4L8LA 5AJHA 1NP6A 3MGGA 4IQ0A 2EC5A 2P65A 4XFJA 3HB1A