2ODBA

The crystal structure of human cdc42 in complex with the crib domain of human p21-activated kinase 6 (pak6)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
177
structure length
177
Chain Sequence
QTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human Cell Division Cycle 42 (CDC42)
publication title The crystal structure of human cdc42 in complex with the CRIB domain of human p21-activated kinase 6 (PAK6)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 58
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2odbA00
3EWAA 1FX0A 1P61B 1DAGA 4PHHA 5DHAA 2VTKA 2IF2A 3LQRA 3ZVRA 4DBLC 3FMOB 4F93B 2OBMA 3X2SA 4P4TA 2AK2A 1JAHA 3I8SA 2XB2A 3VKGA 2OEPA 5C4MA 2FSGA 4ACBA 1ZYUA 4TSFD 1Z0IA 1N6HA 2FPLA 2CEAA 2DB3A 4TYNA 1RZ3A 1NJFA 2HF8A 1NG1A 2XITA 3DMNA 2ZI9A 3T5DA 4TQAA 1P9RA 3WBKA 2H16A 3KZ1E 1NBME 4MDFA 2O8CB 1WCV1 1YVDA 5FL3A 2F9LA 4O3MA 2Z4SA 3KL4A 2IC5A 2ZVQX 3T15A 4NYIR 1MH1A 3ZS8A 3R8FA 3T61A 3QUSA 2Q6TA 621PA 3EPJA 4LC1A 2IXFA 4M9ZA 1S8FA 1NJGA 1DE0A 1L4UA 4DLRA 2P0EA 3RABA 2K5UA 4B3GA 3GFPA 3NDPA 2OUKA 3RS7A 2A30A 2OG2A 4GZMA 3ZZ0A 1L4YA 1CR0A 3RSLA 3WRXC 3JZAA 3ZD7A 2SHKA 3DOEA 2GVDC 3BOSA 2GBLA 3B1YA 3A4LA 4Q7JB 4MUAA 2BKEA 3ND9A 1R2QA 1YU9A 3TIFA 2CJWA 2DPXA 4JYCA 4BFSA 3V4RA 1G5TA 3BJIC 2W2XA 4LPKA 4EPYA 1RRFA 4A0RA 4M9XA 2YC2C 4C3ZA 1SGWA 3UIEA 2O0JA 2RGDA 2J7PA 4XD7A 2FFHA 3NHBA 3THXA 4JT2A 4M1TA 4M1MA 3LBHA 1RW4A 1ZBDA 3AUXA 2MSDB 3EG5A 3HR8A 4KITB 1DG1G 2RAPA 3IPYA 3A36A 3GJ4A 4ZCLA 3H84A 3AF1A 3KQUA 2W83A 2ZRDA 4KFUA 4OI4A 3VR5A 2GCOA 3MD0A 4FIDA 1ZM4A 3ZGXA 5SZIA 2Z6VA 2WWXA 4FCVA 3SYLA 4A2PA 3AP2A 4BLOA 3AH8A 3BXZA 3RHFA 3QXCA 1KYIA 2FNAA 3T06B 4DSUA 3SJZA 1W5SA 2GJKA 1KNQA 1VYUA 1Q57A 2QI9C 2XOKD 1E3MA 3R7WA 4V02A 3N2IA 2OCBA 2ZJZA 1EX6A 3EASA 3W6PA 3FFBA 3B9PA 4POAA 4AKIA 1FZQA 2Z4RA 1TPZA 3UG7A 4IFEA 5JSZB 1PLJA 5AUOB 4CIDA 5CB8A 4LOAA 5GVSA 3ND8A 5KYKA 3TMKA 5EP4A 3K8YA 2Y8EA 1UBCA 1E0AA 2JASA 2YWFA 3LFUA 4ZI3A 3OIYA 2C95A 4MITA 2PJRA 4NPHA 1N5JA 4A36A 1XEFA 2G0NA 2UKDA 2WWFA 1K5GA 3C14C 4TWZA 2JLYA 3PCRB 4Q1EA 1LB1B 3KJHA 2UZ3A 5HCIA 4UXHA 3VQTA 2QT0A 1G291 2CLSA 4PQYA 4B44A 1NBMA 3CF2A 1E9CA 4LV5B 4OHVA 3TQFA 5JEDA 2ZJYA 1AN0A 3BFVA 1S3GA 2QAGA 2IUUA 4W5HA 2GZAA 3QEOA 3KKPA 2GTPA 1FFHA 1XFAA 4HATA 2YWGA 2BM1A 1BH2A 3IQXA 3ADKA 5DYIA 3GLIB 1TQ2A 2VP2A 1R0XA 1XMVA 4Q4HB 1VKJA 1WA5A 4V0ME 4DIDA 1F2UA 2BEJA 4I81A 1CJTC 4UXJA 3KXLA 3U7HB 1GKYA 2AL7A 4X8LA 3VU9B 3UMRA 3CM0A 1E98A 3E5HA 1O87A 4ZDKA 4TL7A 1CBUA 1W0JA 2WM9B 2WSSD 3U3KA 4BECA 2F43A 2BHRA 3PITA 4RKFA 2Q9BA 4CEIA 2ZJ2A 3TSZA 2ZAOA 3I8XA 4JLKA 4A0GA 4HLQB 1NMYA 3AP3A 2VP0A 4Q48A 3NVAA 1NIPA 4LHVA 5LB2A 1EFRA 1ZP6A 2NO7A 3AF4A 3LXXA 4Q1AA 5DHFA 1SVWA 3BS4A 1K6MA 2F1RA 2QROA 1RPZA 2O8BA 3HP1A 2OFXA 1Q3TA 3RANA 2PEYA 4TMXA 1G16A 1YR8A 2WAXA 3GLFB 2X1VA 2C96A 3CLVA 3IO3A 3HU2A 1JI0A 3QBVA 4IDHA 1T3HA 2OLKA 3Q72A 3QNUA 4DCSA 1OKKD 1DTSA 2BMFA 2P3SA 3LXRA 4DUGA 1SQ5A 1FP7A 2FV8A 4Q1DA 5HTKA 2BC9A 2QBYB 3RS3A 3D8BA 3SYKA 4DCVA 1LF5A 3V00A 1Z0DA 2O8CA 2ZR7A 5GVRA 3REGA 3AB3A 1IONA 2J9RA 2J41A 2ZRGA 1VG1A 2VLIA 1OH5A 1E1RD 1VPLA 5EXSA 4Q5IA 3LLUA 4IDNA 2G0TA 3PVSA 4URUR 3WNDA 4FMDB 1VG8A 2V9PA 3KUDA 1P75A 3NBXX 4C2TA 4YC7A 2C77A 4JBWA 1Q12A 4P32A 2ODEA 3B1WA 4PC2A 1JR3D 4IEIA 1IN7A 4ESVA 2AFIE 3QJYA 2GEUA 4NDZA 4ZI2A 3X1DA 3SU8A 3BERA 4AYXA 1AKEA 1GRQA 1QBKC 2BCGY 2EYUA 2ZUCA 2FPMA 3P4XA 4MGYR 2BJVA 1ZW6A 3AKCA 1VCIA 3ADCA 5JHHB 3C5HA 3IPXA 2FZ4A 4JYBA 4Y0AA 1YE8A 2J3EA 3F3YA 3IIMA 5H68A 3WRYC 5FPKA 3HU1A 1GM5A 1W44A 2FE4A 2EFGA 2XTMA 2A2ZA 3GLGB 4Q19A 4M22A 2PEZA 3B2EA 4JKYA 4MYTA 3D3QA 1PVOA 5E7JA 2NG1A 4KLZA 4WIAA 1D9ZA 2FGKA 5FOVA 1VG9B 2PH1A 1U94A 1M34E 3P26A 1E9AA 2F7SA 2QP3A 1XEXB 2GXSA 1NL3A 3Q8XB 4A8JB 3AVYA 1SKYB 1VECA 1PJRA 1PLLA 1Z6AA 3BAFA 4K8OA 2JEOA 3L0PA 5C1BA 1M7BA 1NKTA 1AGRA 4L9SA 2R9VA 1IJEA 1D8TA 3K0FB 3VX3A 4PHTA 3SFZA 5BW8A 4QGGA 1JQLB 4PC7A 2Q9AA 3FDIA 3FOZA 1SVIA 3OAAD 1CXZA 3ZVMA 3JVVA 4JLPA 1MO3A 3SE0A 4II7A 5HCNA 2D7DA 2KI5A 1W4RA 4X8HA 2ZYTX 3F8TA 2RGGA 2BMEA 2IBMA 3U3JA 4DCNA 2R44A 2VHQA 2WWIA 5DH9A 1Z2AA 1MV5A 3VHXA 1J70A 1UBEA 1KDRA 4IFBA 2RH5A 1OB2A 4KV9A 4EFLA 1PV4A 1YZUA 4TQ9A 3N5CA 1E2IA 1D2EA 1VCOA 3TUIC 1BMFA 2XTZA 4P31A 3BWDD 4PPQA 4C0SA 1EFCA 1FUKA 2RGNA 3L0SA 4PPFA 1TQ6A 1R0WA 4BFWA 4DXAA 1I4LD 1RYHA 3UG6A 3NDBB 4DT1B 2YOGA 1U0HC 5TVKA 1A7JA 4GFDA 2C04A 1KTVA 1SVKA 1T3LA 4Q9KA 2RGBA 3G82C 1BIFA 1QG2A 4KSBA 4GP6A 5F9HA 2GJSA 3FE2A 1S9DA 4OQXA 1KSFX 5E3HA 5JLJA 4UNPA 2IW3A 3W6NA 3T34A 1NVVR 2D4HA 2ORVA 1TQDA 3T12A 1T8TA 4L15A 4G5QA 4TZ6A 1YJ5A 3CRRA 2OBNA 4TTRA 1IM2A 3IGFA 4NBSA 4X8MA 5FOXA 4EQ6A 3BFXA 5JJLA 2QTFA 1N6LA 5CIWA 3M0EA 2GCNA 3VHLB 4QNRA 5HKKA 4TYYA 3L2OB 4EPRA 1FQKA 5EXTA 1HTWA 1MABA 4US2R 4F92B 1D6JA 3R20A 4IKEA 3KQNA 2MSEB 2GA8A 1GNRA 2ZRBA 4RVCA 3TR0A 1UPTA 3GJXC 2O52A 2I1VB 3GLFA 3R9WA 2VH5R 1T8UA 3R8CA 1KGDA 4RZUA 2YKGA 1A82A 2YYZA 3QOFA 2GNOA 3H1TA 3PG5A 3TQCA 4MGKR 1QHNA 2IYWA 1NBMD 3KJIA 4PAOA 4L16A 3CR7A 4YMSA 1W49A 3OF5A 4LV8B 3RYTC 2WBLC 4TTPA 2P65A 5LD2C 2GKSA 1E2NA 1KO1A 1R0ZA 4V0MA 1KSJA 4TZ0A 4M1KA 3GMTA 1E0JA 3CW2A 4JJKA 1KI6A 1WXQA 3FKSA 5EE5B 2WZQA 4JS0A 3PEUA 4JJZA 4DEXA 4BLQA 4B43A 3CRVA 4EPWA 1G8FA 1QDEA 4AYTA 4DLTA 3LVQE 1Z63A 1D2NA 2OCYC 2QPTA 5FBQB 2W6ID 1GL7A 5CYPA 1TF2A 4Q02A 4NCNA 1KKMA 1DO2A 2NGRA 4D80A 2W0MA 4TN1A 5KNCA 5JS8A 2Q3MA 3LA6A 4ZDWA 1RJ9B 4NYMR 2EVWX 3NWJA 2OILA 1PUJA 4B74A 3UMFA 1HA3A 3H2YA 3IUYA 1Z3IX 4Q9HA 1Z06A 4QXAA 4TYQA 4CEJA 4XTCS 1NNEA 1W7AA 1F2TA 1IXRC 2FA9A 4P4UA 5L3RA 1PLKA 3B1XA 1ESMA 2JGNA 5KNDA 2Z5FA 1G3MA 2EFEB 4D25A 1KMHB 2BV3A 2YZ2A 2ZJOA 4XSHA 3SOPA 1DAKA 5AUQA 1E2PA 3L0IB 2ZI6A 1OKKA 1NN3A 2QQEA 3CO5A 1NI3A 2IHBA 1YR7A 4RD4A 2DFTA 1ZUNB 1DO0A 2WOJA 2CE2X 5JECA 1D9XA 2ZRJA 1NF3A 5M04A 1D2MA 5FPTA 1AJEA 2EQBA 1IXSB 1SXJC 2GZDA 2ZRNA 4WXRA 4AWXA 2CVFA 2XJ9A 3WYGA 1HT1E 5E7IA 5KTYA 4HEJA 2DFNA 4MKGA 3K0FA 2W2VA 3KQLA 1AS0A 2XJ4A 4FXPA 1OB5A 3SBEA 3V4FA 3EIQA 4EJSA 1CRPA 1ZAKA 1LW7A 2GXQA 2JIZA 2ZSDA 4I4LA 3UWKA 1TTTA 1CJMA 1JR3A 4DLSA 4RD6A 1Z22A 4URYR 4NCJA 5H70A 1OIWA 2YNMA 1E2QA 1RRPA 1ZM2A 1J7KA 4DLUA 1SKYE 1G6HA 1Z0AA 3R7WB 2EW1A 5CITA 2PT5A 1E69A 5CJ2A 1N3BA 5EP3A 2OE2A 1IJFA 3TVDA 1BYUA 2V1XA 1DAEA 5FI0B 4A0FA 3SHFA 5FUVA 2D06A 2ZJAA 4US0R 4IVQA 1XTIA 5B30A 1G8PA 2ONJA 2QAGC 3RS2A 3U44B 4B75A 4ACAA 1KKLA 2Q3FA 2ZSFA 1SXJD 3LLMA 2CL0X 4UJ3A 4QM6A 1IN6A 3CWZA 1R5NA 1S96A 4JSTA 4M53A 1Z08A 1HE1C 3U6KA 2A5DA 1WB9A 5IK2D 2VSOA 2ZI5A 3TRFA 5BQ5A 4DT1A 1XMSA 4D0GA 1WMSA 4BZPA 4KAXA 4OQNA 4OHZA 4HAVA 1C9KA 4LPSA 2IS4A 2IYLD 4TLBA 3K09C 1EFUA 2GZHA 3A8TA 3WHLA 1NLFA 3ZIAA 1E0SA 1G7SA 3REFA 3PEWA 2O8FB 1II8B 2X2EA 2BMJA 1LV7A 4DLZA 1EFHA 2GVZC 1XTJA 3I62A 1E1QA 2IYSA 2JLRA 1FL9A 1S3SA 2CVHA 1X1RA 2WIBA 2FG5A 5G3ZA 3WNCA 1HE8B 4BZQA 1GWNA 2QTVB 1OPXA 3RS5A 1N0WA 4D4LA 4WW0A 1GRNA 1SXJE 4Q47A 2NO9A 1GKIA 4RY2A 5AJZA 2OCAA 1VCMA 1M1YE 4OQLA 4RCYA 2H1LA 2R2AA 4XH9B 2WTUA 2YV5A 3S1AA 3HJNA 2HT1A 3MWLA 1P62B 1TQ4A 1JJ7A 1KDTA 1E99A 4RD0A 2ZXUA 1W4AA 4HAZA 1OFHA 1G41A 2FFBA 5KSPA 4FCTA 4OK6A 2XXAB 2CL6X 4ERNA 3RDPA 3FB4A 5G41A 4MKIA 2QTHA 5DN6A 2ZRHA 2PMDA 1QHYA 3KTAA 4WAUA 1QZXA 4PHGA 4GI7A 2VP9A 1B0UA 1R5BA 1XXHA 1I4TD 1E9DA 1IY2A 1WQ1R 1YQTA 3MG9A 4MGIR 4FN5A 4PPGA 4QL3A 2QEQA 1JR3E 2D62A 2E9SA 3LX5A 3QPWA 5L3VA 1UKVY 2WPDD 3A1VA 1QVRA 4IDQA 4DDUA 4BUJA 1P60A 3B1VA 4NCIA 3MWKA 5EZ5A 4QRHA 4Q1FA 2X8AA 4FWTA 3BC1A 3KXKA 4PZYA 3TKLA 1HQYE 4RZXA 2GWHA 1KI4A 3CH5A 2J59A 2QU8A 2XB4A 4LK2A 3ZZTA 2FN4A 1G7CA 4PTLA 4PR0A 4EKDA 4CEJB 1UKEA 4N0EA 2IYXA 5JI3E 3E1SA 3KFXA 2P67A 5BWMA 2JLVA 1U2RA 2C2HA 2DFLA 1QHIA 5KPDA 2B8TA 1KI1A 2ZYVX 2O0KA 5J4KA 1N25A 4QJ3A 5JCPA 3IIJA 5A5GA 1MO5A 4QKQA 1E4YA 1R7RA 2ZRPA 3VR1A 2CXXA 2XNSA 3VR2A 4NMMA 2A78A 2GF0A 5TV2A 2QRNA 2OAP1 1XU4A 2G83A 4TMKA 1KAGA 2WV9A 4PO8A 2WMOB 2VP4A 2P6NA 3BH6A 3PR1A 3EZFA 4MUBA 4HLCA 3EARA 1Z5ZA 4URWR 2FMXA 5DSZA 4FMBB 3E2IA 1MKYA 4Q03A 1I2MA 4KCGA 4DB2A 4GDFA 3B78A 3IBGA 1P2TA 2ZR9A 1X8LA 5JHGB 4B32A 3LQQA 2OV2A 3UATA 2BBOA 3KXIA 4GPTA 4B6FA 3DZDA 1DARA 4HAUA 1JR6A 3MRSA 3SC3A 2WVJA 1XTSA 4B2IA 1I4DD 5C2JB 1BO6A 4PO1A 4PXAA 1P2VA 4G5OA 5BYKA 4BEBA 3FTQA 2JA1A 3RS4A 3MSXA 1OIXA 4A82A 1FTNA 1UDWA 4H1VA 5TMPA 1ZIOA 3EZ6A 4MA4A 3RWMB 3BORA 4Y0VA 3B60A 4R2IA 1R5OA 5CLLA 1ZCAA 1F48A 1KNXA 3QXSA 2C9OA 4BE7B 4WZAE 2GXUA 4IDOA 1TMKA 1RE0A 3TJZA 1ESNA 1JXMA 4DDWA 1YZQA 2AD5A 4RKEA 2VL7A 3P20A 2HUPA 4M0LA 4NL4H 3QVVA 3BE4A 1T0JB 4WBSA 3GFTA 1N0VC 5DE3A 1C4OA 1E4VA 5BN5A 3Q7PA 1QG4A 1YZGA 4BEJA 3OIVA 2RMKA 1E79A 2PLRA 4RCZA 4F7WA 2CNWA 4Q7LA 3W6OA 4C2UA 3CX8A 1XXHE 3IHLA 4NP6A 2TMKA 2GK7A 3NTUA 4KLNA 3H0KA 3C41J 4JL5A 3CUEF 1SVSA 3QKSB 4LJ6A 4BZXA 4E07A 1ZD8A 4TLDA 1TUIA 4FWIB 1BOFA 1JALA 4TMWA 3U61B 1DVRA 1YR6A 1UAAA 4LGMA 3U2QA 4XWAA 4C0HA 4XVRA 3GLFE 2ZRLA 3RNLA 5DYGA 4HYYA 4FD2A 4JT4A 4UNNA 3GQBA 3NC1C 2W6JA 3QVUA 4OK5A 2PMKA 1GILA 2AX4A 5AR1A 5FPSA 5DNYB 3U4QB 5CK5A 1W46A 2ONKA 3HPQA 1ETUA 3PIRA 4ABYA 1CR1A 2CCKA 2BBTA 1SVMA 1FW6A 2LKDA 1JEEA 2VSXA 2NQ2C 5KSOA 2P5TB 2JLSA 1XBTA 3ASZA 3S1AB 4D6PA 2A3RA 2KSQA 1E79D 3MCAA 4E22A 1VYVA 2CHVA 1LS6A 3KUCA 3RC3A 3TLXA 3V9PA 4OI2A 1XD9A 4LHZA 2X19A 5GJBA 2HLDD 2IS2A 3EA0A 5IK2A 5J4YA 1MOZA 1OH7A 3AQ4A 2F55A 3IBYA 1DS6A 1SKQA 5C18A 1VHLA 1C1YA 3THYB 1P2UA 2CHQA 3OEED 1OH6A 2IT1A 1W47A 2JCSA 3OFND 4Q66C 5C4GB 1UJ2A 3AVOA 5L3QB 4A15A 4LHWA 2C8VA 2CMKA 2H8KA 2NOAA 4BGDA 1NY5A 2GF9A 2WKPA 1KI6B 1NLZA 1WE2A 4V0NA 4C0KA 1P4SA 2WWHA 1NN1A 3I72A 2FFQA 4Q7MB 2W2TA 2EWVA 1CU1A 1Q44A 1A5TA 1CP2A 1CRQA 2REXB 2BVNA 1N5IA 2HV8A 3CIOA 1UEJA 2QAGB 4B3DA 2GAOA 5B2ZA 3AGPA 4U00A 1H8HD 1NN5A 3K9NA 4HLUA 4HLDA 4Q4AA 2VP6A 4GBMA 4PC1A 1FTSA 3EPHA 1II9A 3TSOA 1BKDR 1F2TB 3UWOA 4A0HA 2IK8A 5JBQA 3PEYA 1Z6YA 1T91A 1CJKC 4DSTA 4CF7A 2BCJQ 3EA5A 4E5UA 4AI6A 4NKRA 4LHYA 3FVQA 4LJ7A 4C0BA 4CZ2A 5J47A 5DO9A 1EX7A 2JLXA 1CEEA 2P2LA 2ZS9A 3GLGE 3ZDQA 1RRCA 1NMZA 3IDQA 2HEIA 2VF8A 2DWQA 2WWWA 4PHFA 3KJEA 4PSAA 4HSEA 1E32A 1N6NA 5SZKB 2HYDA 3PUYA 4YMTA 4DZZA 3IEVA 1RVDA 2RGNC 3CH4B 1VHTA 3NBZC 1G18A 5DGXA 3I92A 4K81B 1OIVA 4OQFA 2O8DA 4G5SA 1LNZA 4DJTA 4MRVA 2I3BA 2ZJ8A 4NYJR 2OM2A 4U7DA 3LH5A 1G8YA 1DG3A 3UK6A 3SQWA 3I4LA 1ZVQA 1E2FA 2MMGA 1ELOA 3GJ5A 4HB0A 4NCHA 1W0JD 2F6RA 3D6TB 3TAHA 1H8HA 3O8BA 1N0UA 1KY2A 5FL7D 1ZM7A 5FPYA 3BH0A 3IHWA 4G1UC 3SYNA 221PA 2QAJA 3P4YA 1Z0FA 3A4NA 3PFIA 1XD2A 5EXPA 1IXZA 1S0UA 3B7GA 2CK3D 4AC9A 4M1OA 1H8ED 3NG1A 4KODA 1UEIA 1QHHA 3Q3JB 2GILA 1AZTA 1JBKA 1KI8A 5EQTA 2W0SA 2RKOA 4D0LB 4TYWA 1N6OA 1P6XA 4US1R 4C0AC 3B1ZA 3EZ9A 1U8YA 5TY0A 4DUGD 1ZM3A 4JBXA 5JZVA 3OE7A 2H18A 2C78A 4AG6A 2YC4C 4Z51A 3DHWC 1X8KA 6Q21A 1SZPA 5B58C 4Q18A 2D2FA 3VKWA 1M74A 4F4CA 5FTJA 2KWIA 4FMCF 4ARZA 4ZCMA 1Z8FA 4DHEA 4OBEA 4LV6A 2QMHA 4R98A 5CDFA 4XSGA 2OXRA 3B6EA 3QG1A 1XMIA 4MGZR 1R8QA 1YZKA 3C16C 1I2DA 2IS6A 4BLRA 2QL6A 1OSNA 3A1WA 3GEHA 3MWJA 4IOLA 5E4FA 3OEHA 4FCWA 5EP2A 1CS4C 1F3OA 1M6NA 4Q1BA 4JL6A 3EZ2A 4NYIQ 1NRJB 1XEXA 5E95A 4OL0A 1B23P 1KJWA 4OHYA 3L8ZA 1U99A 5FBLB 3DO6A 3NH6A 4O2RA 2ZI7A 5FI1B 3CZQA 4BFZA 2CCJA 3GEEA 3GJ0A 2ERXA 4XVQA 1OHHA 3QE0A 4LYJA 2HCBA 3SJBA 3A1TA 2IL1A 5AWFC 1NP6A 2ZIAA 3GFOA 3AV0B 1N2CE 4TMVA 2WJVA 1FMLA 5FOTA 4C7OB 2V7QD 4KFRA 1Z6XA 1P73A 2F3RA 3VR3A 4P0TA 5FOWA 2ZETA 1ZC4A 2IUTA 1KAOA 1KK0A 4M2LA 2BWJA 2ZS7A 4UKDA 4B3FX 3FHOA 4B76A 4IRUB 1P7CA 1KO7A 1N5LA 3Q7QA 4TLEA 4GRAA 1VIYA 4JLAA 4YDHB 3CBQA 3K70C 3W8NA 4WZ6A 3NXSA 1CR4A 2ZJBA 2BBSA 3WY9A 1HUQA 2IX3A 5AJYA 1E9FA 1E2GA 2WAYA 3B5JA 5L3SA 3VTKA 3W5IA 2FFAA 2VHJA 2W6JD 4LHXA 4BQSA 1G3UA 2FX3A 2WSMA 3PJRA 4LDJA 3A1UA 2UZIR 1GRRA 4ZIRA 1SHZA 4QNMA 4HI0E 2WJYA 4IW3B 2E1RA 2QZ4A 4JL8A 2J5XA 5HR5A 3GLIA 2H17A 4Q4HA 2ZRKA 4PAMA 1OJLA 3THWB 5KSYA 1F2UB 2JLWA 1S1CA 3ZD6A 5F3WB 1UFQA 3TNFA 1BMFD 4HAXA 1EWQA 2H57A 1FNNA 1NVUQ 1R0YA 2HLDA 3LD9A 2J0SA 5FTNA 4LJYA 3SNHA 2G88A 5F9FA 1KI7A 2JDID 2R62A 2GK6A 3RVBA 2ZRIA 4P3YA 2F43B 5FPHA 3RLFA 2NO0A 2FSIA 4Q9JA 3AF0A 1QHGA 521PA 1KK2A 1U8AA 1E9SA 3CRW1 4OI0A 4M1WA 3SQXA 2R6FA 4OI1A 2P6RA 1R6BX 5FR2A 4NONA 4KSCA 3K0AA 4H1UA 4MQBA 4DLWA 1NLYA 5DLQC 3QKRB 2C03A 2NPIA 3DOFA 4YMVA 1QHXA 4ON9A 3LDAA 5J5CA 3RSOA 1OYYA 2YINC 2QQ0A 4GMDA 3QIAA 1DAIA 1EXMA 4DKXA 5DI9A 1JAIA 2B7BA 5IT5A 1CIPA 1OXXK 2QY9A 1U8ZA 1Y3AA 1HT2E 4BASA 2IHYA 2V6JA 1Q21A 1NSTA 4TLAA 4XIGS 3RWOA 3HPRA 3KDSE 1XPUA 3SS8A 3ICQB 2VPPA 3IIKA 2QORA 4RFSB 3T1TA 5KO2A 4H9GA 1L2TA 1T9HA 3VR6A 2Q3HA 4G0NA 3TUZC 2W58A 3SDZA 3NEJA 5CLQA 1GFIA 1OXSC 2P5SA 3DKPA 2Z83A 2IUSA 3QENA 4M8NE 2XEXA 1DADA 3A1SA 2WOOA 1S4QA 2YWEA 2C9YA 1GP2A 4IOJA 3FMIA 1RJ9A 3QXHA 4HAYA 4IVRA 2GESA 4KYIB 5EE1A 1Z2CA 4ARZB 2ZI3A 2JJ1D 4AKGA 4X8OA 2DWPA 3DM9B 1T5IA 2OFWA 4PX9A 1OFTA 4GOJA 3TUJC 4MKHA 2D74A 3QKSA 4JLMA 4DLVA 5FUYA 4KHZA 3GEIA 3ASYA 3B85A 4EPTA 1XDBA 3EIEA 5LDDC 2PBRA 1JPJA 3L0OA 2PX3A 1N6IA 3FWYA 2G1KA 1Q0UA 2C9CA 5ELXA 1T4GA 2ODWA 3SN6A 1Q20A 4CT5A 1COWA 3WP0A 4OQMA 2OCPA 2ZROA 5EXXA 5IF9A 1E9EA 2JLQA 3AVXA 3NC0C 5J4HA 4ASUA 1LTQA 1ZIPA 4IXNA 1MRSA 3W8RA 4G01B 4XVUA 4EFNA 4EJSB 4C7OA 2PCLA 1RIFA 1CF4A 5EE9A 1W2HA 4GNKA 2GRJA 3ZJYA 1XTRA 3DDCA 3K9LA 1ANKA 4KVGA 1AK2A 3QI2A 2B92A 1SVLA 4LBYA 5AJXA 2JJ1A 5J4VA 2CHGA 2V6IA 3GCGA 4BLTA 3WMFA 4R9UC 3CKLA 3U3OA 3LV8A 4QBIA 4TYPA 1J8MF 2QE7D 2DFKB 1XB2A 2EFHB 3MWYW 1K5DA 2QSZA 4JBYA 1Z6GA 2QPAA 4V03A 3CNOA 4OJKA 1UBFA 2VEDA 3HR7A 3NHAA 1KZ7B 4F38A 4DDTA 4C0LA 3M1IA 1G21E 2AWNA 2OT3B 4JVMA 1FP6A 2QUZA 4CEHB 3MAAC 1ODFA 1Z47A 4YMUA 3MUFA 3K9GA 1KDOA 3OAAA 4ITRC 4W5WA 4Z8YA 2JLUA 2ZVPX 1QRAA 3QEJA 1G6OA 3MLEA 2IYRA 2VRWA 3TK1A 2PLFA 5EUMA 4D4MA 2FWRA 2QMUA 1OT3A 1ZNXA 2ANCA 4ASUD 4BRUA 2PZEA 1QHSA 4TT3D 2BIFA 3BIFA 1GDDA 1II8A 2ZRMA 5KUTA 2DR3A 3UANA 3VAAA 1G20E 4TSFA 1NY6A 2LCFA 3D31A 3GD7A 3CPJB 1GNPA 3PUWA 2ZTSA 1L7VC 4M4SA 5B64A 1XEWX 1Q1QA 2WIAA 1BYIA 1G8HA 4B3XA 3ZYCA 4ZPXA 5DI3A 2G9NA 3U3MA 4LJ8A 8OHMA 5LPNA 2HXSA 4DB4A 1W4BA 5JEEA 1AS3A 2VF7A 2ZRAA 2RB4A 3SJAA 5CM9C 3VR4A 5EUQB 2ODBA 3W3ZB 2F1IA 4HDOB 4Q01A 5CIQA 2OBLA 3K53A 5AK0A 3Q5DA 4RD1A 5FBVB 1U90A 5IRCD 1JEDA 3NKVA 4HLUC 4P33A 4A8JC 2QM8A 2REOA 5HZKA 3T1QA 3Q5EA 1YZNA 1Y63A 4AD8A 1ZD9A 3OHMA 1MR3F 1NVXQ 3QBTA 1J99A 1YHNA 2ZANA 3A37A 3BB1A 3KTAB 4OJQA 5FOSA 5JWRA 1II0A 1XMJA 1W0KA 1Z29A 2L0XA 1TEXA 4A1FA 4GL2A 5LBIA 3IEUA 4GP7A 5GJCA 1RC8A 4N0DA 2ZSEA 4MDEA 3VNVA 4RFSA 4RD2A 4EAQA 1TU3A 1QHHB 4JIMA 3L8YA 1YRAA 2AKYA 1K8RA 1XRJA 2E87A 2ZUDA 5G3YA 3AM1A 2HF9A 4PC3A 4MYCA 2J87A 1E9BA 2ZQ5A 5B57C 4FW9A 1OLOA 3SHWA 3ICEA 4YONB 1UM8A 3WXMA 4Q4JB 4C0QC 3ONWA 1QF9A 5JCZA 1JXOA 1R8SA 5HPYB 3FPAA 2V55B 4OYHA 4DDVA 1GOTA 4JLNA 1AM4D 2F9MA 1TADA 3LO5A 3EC2A 5FH9A 2OSBA 1A1VA 5KHOC 1IHUA 2GEDA 2WKQA 1CTQA 1OXUA 1VCNA 4NE2A 3EX7C 2BDTA 4FINA 4XWOA 1DAMA 2VIIA 1L8QA 4HAWA 4HB3A 3K0CC 3FMFA 2XSZD 1W0KD 1KK3A 2FF7A 4IDPA 4JLJA 4HDQB 4LCBA 2EFCB 3MFYA 4C9BA 4B35A 1PUIA 1EGAA 2GCOB 4Z1MA 2PZGA 3RAPR 1PZNA 2GAAA 3NBFA 4MRSA 5K8IA 3AVWA 4JSYA 4Q9LA 3QPUA 2QP9X 4WOPA 2CDNA 3LW8A 3UMSA 1HURA 4U5XA 4M9SA 1XPRA 3RRMA 2A7QA 4CT4B 3EC1A 2J46A 4EUNA 2OESA 3PQCA 2BMDA 4IXMA 4GOKA 3EW9A 3TE6A 4D4JA 2FGJA 4K46A 2DCUA 1IN4A 4A9AA 4PQFA 4IEEA 4ZDIA 3CWQA 1MT0A 1R4AA 2ZUBA 2IYYA 3EXAA 2ORWA 3CX7A 2XSZA 1G19A 4CEHA 3VKHA 1MO4A 3CR8A 1G5PA 2RHDA 1ZJ6A 2EFDB 1E2MA 3GJ7A 3LBIA 3SZRA 3BK7A 3LBNA 2NTYC 1UADA 2QT1A 5JMTA 2GCPA 3I61A 2H5EA 2QG6A 4JLOA 4ZIRB 4A4DA 3QF4A 5KOYA 2V8OA 4LC0A 4AURA 3DMDA 2ZPTX 2FSFA 4L8GA 1E2DA 4R7ZA 2J0UA 3OIWA 2CCGA 3T1VA 5UKDA 121PA 2VP5A 1N6PA 3T1OA 2QN6A 3VMFA 3GJ8A 2R6GA 5HE9A 3LNCA 1G3QA 5IDVA 4IJMA 5C46F 3ZQJA 2ATVA 3CF6R 2PZFA 1XNJA 4KXFB 5BXQC 2GJ8A 1SXJA 1OW3B 1X3SA 4BFUA 2VHUA 3KKOA 3U4QA 3EPKA 3K09A 3M6AA 1X6VA 5BYJA 1DEKA 4IOMA 1DAFA 2ZU6A 3FHCB 2XNDA 4KO8A 1U0JA 2RCNA 3A4MA 3BFKA 3AF3A 1GSIA 2FEOA 3OZXA 4KFTA 2QMEA 4HZIA 2F3TA 1FX0B 4QC2A 3WYAA 2G1JA 3QG5A 2NO6A 2I1QA 1CULC 3WYFA 1S9HA 2NZJA 3R9IA 2IYUA 1W1WA 3LX8A 1E1QD 2ORIA 1KI3A 3I73A 4QBHA 2KBFA 4MRPA 4PAQA 3ZVNA 2KBEA 1T0HB 2NMVA 1D5CA 3AF2A 1KI9A 2A5FA 3PUXA 4IVPA 1WP9A 1FUUA 3AVUA 4KFSA 4RJLA 5L3QA 4QM7A 5KDLA 1OXTA 1XEWY 3OESA 1NG9A 1UKZA 1J8YF 4KBGA 2QGZA 2JATA 5EP1A 1IN8A 3AKDA 1XXHB 4L9WA 3HYTA 3RC8A 4ESHA 3KB1A 3HYRA 1OFIA 2QP4A 4WA7A 3BB3A 5KDDA 4EPXA 1U81A 2D7CA 3A58B 4GZLA 4TL8A 2FPKA 1X8JA 2ZE5A 4S35A 3C8UA 4G3XA 4PO9A 3CZPA 2A5JA 2XNDD 4Q4JA 1E2HA 2F1JA 1YKSA 3GPLA 2J7PD 4MH0R 4XD7D 4LYFA 4B2PA 1GNQA 3OFNA 4Q4AB 4EPVA 1VYTA 3MMPA 4KYUA 4BLSA 5K8LA 5HZHA 4MYUA 2Q9CA 4AKEA 4AIIA 3EZ7A 3HU3A 4B48A 4JVNA 4UXIA 4ZV4A 1MRNA 3O8RA 1U0LA 4G5GA 4CRWB 3CPEA 4LJAA 3T35A 3L43A 3ZLJA 4LBVA 1N5KA 3J81k 1YZLA 2CJWB 2ZITA 4N3NA 1NVVQ 2VSFA 3TH5A 2XOKA 5IHPA 2BEKA 4IOKA 3ZZUA 2BJWA 3IKJA 1A4RA 2IYVA 2ZR0A 3K9HA 1GL9B 3O8DA 2OZEA 4NHOA 4UJ5A 3QF7A 4ZO4A 3GP8A 2O5VA 5FBWB 4A8JA 1TL7C 2VHTA 4FMDF 1XPOA 4GOXA 2YOFA 1Q22A 3WNBA 1KJZA 2O8DB 4D82A 5G53C 4Q21A 4BFYA 2ZM5A 2HJGA 2FH5B 3PUVA 3MGCA 3EAQA 2QRZA 1LY1A 2BKUA 5P21A 1JPNA 2HJVA 3KJGA 2RGCA 2AKAB 4AG5A 1VG0B 2XTNA 4LJ9A 4LUCA 5EZ6B 4OK3A 1P72A 5JWOA 1JB1A 3WHKA 3GJ3A 3FKQA 4MRRA 1G4UR 3KKNA 2OAQ1 1ZUHA 1LS1A 1TUEA 4HZUB 1GKUB 1KK1A 1DOAA 1Z0JA 1E9RA 1JECA 2FEMA 4P4SB 2XAUA 3AEZA 3O47A 2FZLA 4F4IA 3BH7A 1CR2A 2WJIA 3EPLA 3VNUA 1G7TA 3DVLA 5FR1A 3CRQA 2YWHA 2HT6A 1KI2A 2VYFA 2CLCX 4NZYA 5FUXA 3SI7A 3X1YA 2CBZA 4DLXA 1Z28A 2QENA 4Q7KA 2ODNA 2WJJA 2J0QA 2WSSA 4RSGA 2WWYA 1GIAA 3QXXA 4G5RA 4I1UA 2WJGA 4M1SA 1OV4A 1XP8A 2AK3A 4B2LA 3U6BA 1DPFA 4HUQA 4RFVA 2PX0A 4QBGB 2IYTA 4GT1A 2CE7A 5LB4A 1EFRD 3FGNA 2DWOA 2WMNB 4Z1MD 2CK3A 1H8EA 2VHCA 4OHXA 3E70C 1S1MA 4QGFA 1IOZA 1M7GA 2EWWA 3I32A 1HY3A 2OXCA 1W2GA 2AFHE 1A2BA 1J90A 1EK0A 3AVVA 4A6PA 4WZBE 2IWHA 4HUTA 4C30A 5CK4A 4JLDA 3W34A 4EQ6B 4TL9A 4B34A 1X1SA 1G9XA 5TXGA 3I1FA 1US8B 1ZNZA 1ZCBA 1OFUX 1IBRA 1LF0A 3FFAA 3JZMA 2CNWD 3LVRE 4CEIB 3UPUA 4E09A 2V1UA 4BFVA 3GLHE 4TL6A 4DRZA 2A9KA 3LY5A 3LAWA 4DCUA 3I3SR 3MJRA 2B6HA 4WVFA 1P9NA 1P2SA 4RZ3A 1RKBA 4R2HA 3EIHA 4L4UA 2A5YB 5GJWC 2IS1A 3G5UA 4XJXA 3QPVA 1G64A 4W9MC 4JKIA 4PQRA 5ANRB 1E94E 3X1XA 3CF0A 3L82B 2W6IA 2AHOA 2W00A 2Z0MA 1G4AE 3OEHD 5HE8A 1P5ZB 4EFMA 2ATXA 2R65A 4OKSA 1XX6A 4YMWA 3FHTA 4AY2A 1IAQA 3QKTA 2R6DA 3K70B 2X77A 4M21A 2HXYA 3THYA 1XCPA 3AGQA 3SEAA 3QQ5A 1FNMA 5JI2E 4W5JA 3U7GA 1BS1A 3ETLA 3CPHA 1CJVC 2Q21A 2ZAMA 4U02A 1AA9A 2IA5A 1WBDA 1G3RA 1TF5A 2KB0A 3AP1A 5CB6A 2JJ2A 4RZ2A 2GJAA 3CNNA 2QSYA 1AQYA 5L3SB 4TMTA 2RGXA 2Z43A 4DSNA 2N1BA 2VQSA 1NIJA 1ZU4A 1CLUA 1M7HA 1V5WA 2ASEA 2V54A 2PT7A 4LJ5A 4Q00A 3O8CA 3TBKA 1X86B 1ZU5A 2G3YA 2IYZA 3GLHB 2FSHA 5K8TA 4QHSA 5D3MA 3N70A 4HB4A 3K70D 3KKQA 1GUAA 1XJQA 4W7SA 1ZMXA 1AIPA 2O8EB 4C0JA 3K0CA 5KSZA 5KU1A 3TVTA 1KO4A 5SZHB 3THWA 3CNLA 4I1SA 1W48A 4B71A 1FQJA 4EDHA 4DIEA 1XZQA 4PSVA 4A6XA 1XF9A 5EE0A 4YDSA 3RRYA 2XGJA 4I99A 2WHXA 3GLGA 2YHSA 5JWHA 1T3SA 2MSCB 4UNSA 2FOLA 4JLBA 3UKDA 3W5JA 3CX6A 5FFMA 5JRJA 2V4ZA 4V0LA 5D3QA 2HDNB 4DC9A 3ADBA 1HH4A 3MJHA 3NIBA 3SFVA 1E96A 4LYHA 4JZKA 1O3YA 4LBZA 5BN4A 5JS7A 4I1VA 3NBYC 4D4KA 3KFVA 4LX0A 4CVNA 4URZR 3U7FB 1G3IA 1XJCA 4NTZA 2QPOA 3NEYA 1AQUA 4LSGA 4R71A 2LKCA 4PC6A 1Q1BA 5CJPA 3QKRA 4D2IA 2UVQA 1FOEB 3TSWA 1TX4B 2R8RA 3Q85A 2IXEA 1W5TA 1IY1A 4DCTA 1E2JA 1KHTA 2JDIA 3P27A 1JQJC 5A0FA 4A92A 4EIWA 2GEVA 3RRNA 1ZINA 2OLJA 4E03A 3QXJA 3ZIAD 1GG2A 3F0TA 5GADl 4B33A 1SVOA 4QHTA 2PJZA 4D81A 2ZSBA 4KU4A 1XD2B 2X2FA 4PSKA 5AJWA 5F98A 1WRBA 2YJTD 3N2EA 3TW4A 4D0NA 3K0SA 5K8UA 3Q9LA 1IY0A 3PUZA 3F5FA 3U44A 4PZZA 2OO7A 1J2JA 4DLYA 2KE5A 2B21A 2DBYA 4S2EA 1Z83A 3B8HA 1WF3A 3EWSA 1ONBA 1KSGA 5L8VA 2REBA 4QHYA 2YVUA 3DL0A 2ZRFA 2N42A 3ZQ6A 1U9IA 1HV8A 4HUQB 2NPFA 5HKKD 4YXWA 4B3BA 2KJQA 1E6CA 5CDFE 5DIFA 2IEYA 1AGPA 1SHKA 4UNQA 2O8FA 3RS0A 1N6KA 1VMAA 3QF4B 2FU5C 3G0HA 1W36D 2J0UB 3X1WA 1YR9A 4C4PA 4QOSA 2NZ8A 2ZE8A 2CLDX 4URXR 2NIPA 1XD8A 2QGNA 5FTMA 3THXB 1US8A 1Q3HA 2FDCA 4MRNA 3KKMA 4OHWA 3ECCA 4YLGA 3I5XA 5TDHA 2N46A 4O2LA 3WMEA 4F4JA 1KMQA 3OE7D 1R10A 4KI0A 2AXPA 1Z0KA 2P6UA 3A6PC 5DISB 1A2KC 4MYHA 2IEZA 5TARA 3U3RA 3FKSD 1ZRHA 2XZOA 2R6CA 4QFMA 4CYMA 4Q4LA 1NN0A 3CRMA 5AUPB 5FBRB 1LFDB 4O25A 2IWRA 1KJYA 1F60A 3I5YA 3HWSA 4MKFA 2B7CA 4QBFA 3K1JA 3OIUA 5CYOA 3WMGA 2C98A 2PCJA 2A5GA 2NO1A 721PA 3TGPA 1V43A 3TAUA 4UNRA 4BLPA 4QGHA 1RRGA 4Q9IA 4DEYA 3AUYA 2ANBA 2ERYA 5KDOA 1UBGA 1TNDA 4DSOA 2BM0A 5FOUA 4BPBA 2ECKA 1OHHD 2YOHA 3PEVA 1KIMA 4NCKA 3VX4A 5FUWA 3BB4A 2BBWA 4Z8XA 1DAHA 4Q1CA 1NKSA 1VTKA 2VO1A 4D26A 1G1MA 5LD2B 1UKYA 1TEVA 1CKEA 4M1YA 1Z07A 5J4LA 4CGZA 3IILA 2V7QA 1YRBA 3VFDA 2ZU0C 3C5CA 2GJ9A 3AVQA 2VA8A 1KOFA 1EG7A 2IXGA 3GLHA 4CDGA 2GHIA 5JJKA 4ILEA 3QSYA 3UXMA 3C4JA 1H65A 3PV0A 2V3CC 3GLIE 2ZRCA 1NSFA 1HEIA 4DVGA 1GITA 3LW7A 4PPNA 5J40A 2O0HA 2ZE6A 1HYQA 4L5BA 4TQUS 3TW8B 4Z54A 2J45A 2LWIA 3C7KA 1G7RA 1XWIA 3AKEA 5KPJA 4HDCA 1AKYA 4IHQA 4PANA 5AJVB 1UDXA 2H92A 2JIZD 3JVUA 1KMHA 3AVTA 1ZC3A 1KDPA 1P9WA 1CJUC 2J0VA 4LJ4A 5DI3B 3T5GA 1F6BA 3DZ8A 2XZLA 5G40A 5E7MA 4BFXA 1LVGA 2EU8A 2ZSAA 1WDTA 2GDJA 1M8PA 3W9YA 2GBLC 5BN3A 3R9XA 1XJ0A 3C15C 1AZSC 4TT3A 4BWYA 2AWOA 2O8BB 1OF1A 2JJ2D 3KQHA 2HCJB 1YZTA 4LBWA 3SJCA 1G8GA 2WICA 5H8WA 1W36B 4A2WA 2G6BA 3D7MA 3GJ6A 3K0AB 3U5ZB 3B13B 4M9QA 3WP1B 1Q1ZA 2DYKA 4KJZA 3H86A 1EFTA 1Z6TA 2QBYA 2QMOA 1FMJA 1T5LA 3BBPA 3QKUA 4NYJQ 4HZUA 3IO5A 4QG7A 2VBCA 2QM7A 1KZGB 2CL7X 4P4SA 3ZVLA 2OHFA 2AR7A 3KX2A 2J7KA 4B47A 5JFGA 2GXAA 1KY3A 3ZS9A 1F5NA 1KSHA 2ZE7A 3U7EB 2Q0HA 5H1YA 3AKYA 4AK9A 4TTQA 2I4IA 3SR0A 3BRWD 1QVAA 3LWNA 2OFOA 4LWZA 1OXVA 3KB2A 1XZPA 1IN5A 4ZDJA 4FMCB 4EJSC 2DHRA 821PA 4LI0A 1VIAA 1SULA 1OH8A 3B82A 3B9QA 1TU4A 1GL6A 4NH0A 1VDZA 1TAGA 4AKHA 1KO8A 1W4CA 3FYHA 1U98A 3LRPA 4PFSA 2B8WA 2RHMA 1KO5A 4TMZA 1DBSA 2GETA 2QNRA 1XCGB 5TB5A 2JLZA 4B73A 2G77B 4J0QA 2RGEA 5FTKA 3NH9A 2ZYWX 3WBJA 4JVSB 4BFTA 4DWJA 4PZLA 1EWRA 2RGAA 5EE3A 3OEEA 1NMXA 3BGWA 4XTRA 1GTVA 3W90A 4FI3C 4JVLA 2IYQA 2QA5A 2AXNA 1OYWA 5A4JA 3QY0A 4QJ5A 1JNYA 2C99A 3CB4A 3DM5A 4GSYA 5DN6D 1E0KA 1E2KA 4RD3A 2HYIC 1HQCA 1GVNB 5KNBA 5GJVC 4F91B 3SBDA 4KBFA 4WXPA 1E2LA 3DKVA 4XOIA 4V0OA 3IQWA 5JJIA 2ZEJA 2F1HA 4B6EA 2WPDA 4A2QA 2JAQA 5F2EA 4XWKA 2D3WA 5CM8B 1IQPA 2ZS8A 1TF7A 4ZKEA 1DELA 2ZJ5A 1N6RA 4O0MA 4YXWD 3CONA 2H7VA 2XXAA 1OE0A 2ZI4A 3K0EA 1XTKA 3PENA 1ZUIA 4URVR 2IF0A 1S2MA 2PL3A 3M4YA 4NYMQ 5JSZA 4CW7A 3KQKA 1COWD 2WWGA 5FTLA 1EESA 2MMCA 1G5RA 4JLVA 2JJ8A 421PA 3AVPA 1GZSA 4LZZA 4KVAA 1NVWQ 2XX3A 1AS2A 4N1AA 3HDTA 5SZJA 4GMXA 1ZD1A 1P3JA 1Q1EA 1T6NA 1W36C 4ZKDA 1M2OB 4V0KA 2D2EA 3RRZA 1G17A 2BOVA 1RFLA 3P32A 3DEFA 4B3CA 1XCMA 2AN9A 5AUNB 1WBBA 1UF9A 5EJEA 4LY6A 4QGAA 5D3MB 5JRZA 1MO6A 1ZNYA 1XTQA 3TR5A 2QE7A 2C5LA 2O8EA 2R6AA 3P1JA 2ZREA 4LYAA 3ZH9B 3FMPB 1GAJA 1E1RA 4I1OA 3U60B 3DPUA 4JMPA 4BRWA 4TLCA 2DY1A 1JJVA 4LRWA 3PXGA 3VU9A 2J1LA 1SXJB 1FPMA 2XZPA 5FL7A 3X1ZA 3BD9A 2WKRA 1ZNWA 3H4MA 3THOA 2ZYUX 4QJ4A 4AYWA 4YQFA 3ADDA 2AD1A 4UQOA 1ZM9A 3W3AA 1MABB 4HB2A 2EYQA 2FJUA 4ZCIA 1RYFA 1E2EA 4NU0A 2WJHA 1U9IC
chains in the Genus database with same CATH superfamily
3EWAA 1WHSA 1FX0A 3CKMA 1K68A 13PKA 1DI0A 4V1CA 4PHHA 5DHAA 3UMMA 3AINA 2VTKA 4UFPA 2IF2A 1WHTA 3LQRA 4P7GA 3MB5A 1OYOA 3PQ8A 4W9NC 4D3YA 2CJXA 3PXCX 4NBLA 3VKGA 2Q9UA 1PE0A 4OJNA 4ACBA 1UPAA 1FVFA 1J5PA 2FPLA 3E4CA 5GY7A 3WR5A 5JQGA 3W77A 2PZAA 4BUCA 1NJFA 2VG8A 3L6CA 3TZKA 5EIBC 4K9LA 1Z56C 4UU1A 4TQAA 2A0WA 4MI1A 3TXXA 1P9RA 4X1YB 1E63A 2PANA 5T7BA 3KKEA 2O8CB 4H1HA 1M73E 2BM9A 4N7MA 2BFFB 1UOQA 2Z4SA 5TNXA 5AW2A 3VR4D 3T15A 3R8FA 4ESOA 3I2KA 1QFMA 3UY4A 4BLVA 1GN9A 1S7CA 1NUSA 4F71A 1JIQA 4Y1EA 1GNVA 4QWMA 3A9VA 4DLRA 4HDKA 1KJ8A 5M2QA 1RHUA 1DCMA 3RYHB 5GONF 4HAIA 3GFPA 1IUPA 1YS7A 2OUKA 1Y9ZA 3RS7A 2M6SA 3WIBA 1L4YA 3AM3A 4G5XA 4JUBA 3ZZMA 5MN4A 2EW8A 3WMXA 4RABA 1DBIA 1L4GA 2PG3A 3ZD7A 4JYZA 3RAEC 1QUEA 4M83A 4A6EA 4X90A 1IXKA 3B1YA 4BEWA 1O9BA 1KOJA 4Q7JB 1M2FA 2JFVA 4RXMA 1LC0A 3QEKA 3TIFA 1UOEA 1NULA 5HOEA 1L7MA 1RE1A 1Y82A 1SUWA 2W2XA 5EIBD 1ECGA 4LPKA 4BNXA 4HQ6A 1RKQA 4M9XA 2XB8A 3JZIA 3H19A 4X6YA 1DT5A 1T2UA 4H60A 3UGTA 5KOHA 2IOFA 1JUDA 1SGWA 3G0DA 4BZWA 5CW1A 4JROA 1VLJA 2D1SA 3L7NA 4XD7A 3E35A 3NHBA 1OFVA 1NW8A 1YL5A 4M1MA 4MLPA 5K5EA 1RW4A 1ODTC 2P0YA 3EG5A 4KITB 3IPYA 3E0XA 4FHZA 4TKMA 4IHJA 3TRDA 3AF1A 5GOTA 1IVYA 1J2EA 4KFUA 4IMPA 5A3QA 1L5ZA 1V41E 2JHAA 4PFKA 1ZM4A 1EQAA 3ZGXA 1QPGA 3MWEA 3KSZO 3U7IA 4XIYA 4FCVA 3IMFA 3PPIA 4V2UA 3RHFA 2C2ZA 2Q2OA 1KYIA 2WVGA 4WGGA 2OQ2A 4DSUA 4CTKA 5HQJA 3SJZA 4DR7B 5JRDS 2GJKA 4LWPA 1KNQA 1XFDA 1Q57A 2QI9C 2XOKD 5CB4A 5CG2A 2OZVA 3O8OA 3A10A 3TLZA 2OCBA 3U37A 1B4DA 3IP3A 3CSUA 3B9PA 4ED9A 4RL4A 4EYEA 1FZQA 1Q7TA 1TPZA 3UG7A 3ZOZA 5JSZB 2CLOB 4EEKA 2C5EA 5GVSA 3W34A 4L8WB 2LV8A 2WY2D 3TMKA 4PNPA 2DFPA 4I36A 3K8YA 2JASA 2G06A 2YWFA 1Y5LA 1YB2A 4NOKA 1QM5A 3VOSA 1RWKA 3ZV7A 2PJRA 1L6RA 1XEFA 4EUHA 3QVOA 3CC8A 3EVTA 1N1MA 1CUYA 3O4IA 3V2GA 5AVUA 4JP2A 1UJ4A 1MGOA 4WPGA 3X44A 3KJHA 2D8AA 1YJ8A 1G5HA 3E8XA 4DMFA 1G291 4CG2A 3ABSB 4NNJA 2HI0A 3O8QB 3NAMA 3JQGB 3UA3A 5JEDA 2LGJA 4HJXA 1QPBA 2ZJYA 3KQMA 2JGDB 1S3GA 2QAGA 4GR9A 1DRKA 4IGEA 4MW5A 3RUIA 4CWAA 3QEOA 1Z2OX 4FJ1A 5FOVA 1XFAA 2R84A 2ZDGA 1UOPA 3IQXA 3O26A 3ADKA 3GLIB 1TQ2A 3SOZA 1CQXA 5ADUS 1WA5A 2XMGA 5IEBA 1PZXA 4A5OA 2GBIA 4OM8A 4I81A 1CJTC 1DZIA 3ZGNA 1T9DA 2VJMB 3C5WP 3GD5A 3D43A 3HRKA 3KB8A 5EFOA 4TMFA 2WB2A 2DBZA 1YU6A 4J1QA 1PWYE 1SHTX 1CNEA 5T67A 5JUWA 1KHHA 5HIKA 3WVNA 3A9UA 1NV9A 2W4MA 4PV7A 2R8ZA 4UTZA 4BECA 4WFQA 3HEBA 1QLJA 4JBGA 4B3SB 4BNVA 3S2EA 4CEIA 3BKXA 1WCYA 3TSZA 4NG5A 4LSWA 3DDWA 2J5QA 4Y1RB 2KLHA 5LB2A 1EFRA 4D7AA 3WWOA 2VVTA 5K0EA 1Z6PA 1GGVA 2CBGA 1QORA 1VXOA 2HGSA 3OJWA 1D4ZA 4HS4A 1XRMA 1RAEA 5LUAA 3LXXA 5DHFA 1K6MA 3F2VA 3U9TA 1RPZA 3OLYA 1DUVG 1FX1A 3HP1A 3NHZA 4W1RA 1DCTA 3WIVA 4R1LA 4TMXA 4YRFA 3MS7A 5DMXA 4ALLA 2H4HA 3FHLA 1G60A 4JSRA 4IDHA 3WMRA 1JI0A 3LSYA 1DIHA 5KC9A 1T3HA 4JX8A 1A9PA 4DCSA 3LQ4A 1MXFA 1OKKD 4F1KA 2WU1A 4DUGA 2ZYSA 1V9LA 1FP7A 3E48A 3PHBE 3UMYA 3FX2A 2JS7A 2OFPA 2DPLA 4JJ7A 2W4QA 4N48A 2DY0A 1MJGM 4N01A 5JYBA 2A58A 2TMGA 4H6WA 4LNUA 3T4UA 4PAWA 1KR2A 4B7AA 1BX3A 4GI1A 3A9WA 3KR0A 4MIEA 4ZD6A 2J3DA 1IONA 2J9RA 1EZZA 3EXEB 3FWHA 3UGQA 2ZRGA 5KTTA 2G82A 3BXEA 2OCGA 4BJ3A 1UBLS 1K86A 4Q5IA 4DYDA 2OCXA 2G0TA 4URUR 3WNDA 4FMDB 4L4XA 2A9QA 3ABIA 3UBMA 3Q2OA 3R5KA 2OO5C 3RT9A 4YC7A 1PVOA 4N82A 4KRYA 4U9HS 4D9NA 3EQZA 3TX6A 4D56A 5FWXB 3EA4A 3AY0A 2E1PA 3GWGA 1JR3D 3M9XA 2FHPA 3PGLA 4IEIA 1N7GA 3FWZA 2CFOA 4PC2A 3ENQA 4ESVA 3AT1A 4EKEA 3A11A 2ZCJA 2BDEA 4ZI2A 1H1LA 1IHPA 3BWXA 3BERA 3OQOA 4IZIA 3KLMX 4N5HX 5IARA 2EYUA 1UK9A 4KI7A 2FQXA 2V7EA 3ESBA 4I9FA 1SU7A 3B48A 1EFPA 3ZHVA 3MT8A 1ZCJA 1FP4A 2O6LA 1GM5A 2EATA 4EHFA 2GK4A 1HMPA 3LYLA 2XTMA 2F8SA 5KNLA 3N7AA 2FZ5A 5CVCA 1N0HA 2WTNA 2VNHA 4JKYA 4U7PB 1M6WA 5HYVA 5E7JA 2NG1A 2FGKA 2QTTA 2JCYA 4HEA1 5J58A 4ND7A 1U94A 1WKBA 2X4LA 3IX7A 5ISMA 1WO8A 3OM9A 1XNHA 2FR8A 2QNBA 1NL3A 4NU5A 4A8JB 4FZJA 1D0SA 5KCMA 3V7NA 3JQ7A 3ESCA 3P2IA 3LY8A 3AHIA 3EDOA 1SUCA 4G0WA 5C1BA 1C7RA 3JASA 1AGRA 2WLSA 3I9LA 4X97A 1JJFA 3UJBA 1YNOA 1J24A 3SFZA 4J3JA 1QCZA 5BMVB 3IV6A 5BW8A 1OLSA 1TYEB 3EVFA 3ICWA 4MVJG 4QUJA 3VC2A 3HJRA 2Q9AA 2EBWA 3F9CA 4QPCA 4U7GA 3FDIA 2GGSA 1SVIA 1ZJYA 1I33A 3U7JA 2IZ7A 1E62A 4FFDA 4Z0TA 4R81A 3RSFA 4EW3A 1PDOA 1F8GA 2W8ZA 1OAOC 5K0BA 2VDNB 3I5UA 4I1PA 3DHYA 3QE3A 4IXWA 5DZSA 2ZUVA 1A9OA 2YFHA 1EVJA 4FOOA 3QTTA 5CVVA 3AEUB 3Q0IA 1Y5IA 2UYOA 2VAWA 2R44A 2WTBA 5GM1A 1J8DA 2O2CA 1Z2AA 1MV5A 3KBOA 1NWCA 1S2DA 1TCCA 1WVGA 4L85A 3GLVA 3VOBA 1EXVA 4FMPA 3EUAA 4FT4A 1DB3A 1X8XA 3C3CA 4KV9A 4BRZA 5IUNC 5DM4A 2WHQA 1XI2A 3SIWA 2WIJA 4DADA 1QIJA 1E2IA 1D2EA 1QGAA 2AMYA 2QB5A 1NTOA 4ZQHA 1V6SA 3FD8A 4HJRA 1U1EA 4L27A 4PYKA 3TUIC 1KP9A 4JEUA 3EJWA 3OC6A 1TDJA 3TQTA 3V7UA 3ZW9A 4D5EA 3WGYA 3ABOB 3L0SA 4PPFA 5A9TA 1TQ6A 2HO5A 1R0WA 1RXVA 1RYHA 3MJVA 3OOEA 4WKBA 2EJWA 3OE4A 2C04A 4RPHA 1KTVA 3TGLA 2B8EA 3MB8A 1P5FA 2OHXA 3EVAA 3G82C 5LQUA 1BIFA 5M5BA 4YVFA 3LQ2A 3Q8KA 5F9HA 3O4JA 4IIEA 3VC3A 5LR6A 2GJSA 1TUBA 2Q4BA 2Z5GA 3FE2A 3IAUA 1K2VN 4MKXA 4XCQA 3SLKA 3UFXA 5JLJA 3FYSA 2YJNA 2GM5A 1N34B 1WXDA 3O9VA 5AW4A 1EKXA 3JZDA 4KWIA 3C97A 1ISIA 2F4NA 4DARA 2G5GX 4L15A 1L1RA 3MJFA 1YJ5A 4WY8A 2OBNA 1N8NA 4O0LA 5FEUA 2VXYA 1I3LA 1LRKA 3COPA 4KC0A 5A7HA 4KGZA 2HF7A 3KPVA 3SQDA 2GCNA 3VHLB 5LC1A 2DAPA 4YACA 3PDHA 4AN4A 4TYYA 3HG7A 1UC9A 4YRJA 4EPRA 3LQFA 3GROA 5DLPA 2H48A 4PIMA 4US2R 1D6JA 1EINA 1W5FA 4CTMA 1F2DA 1T43A 2GA8A 1AQ6A 5JDCC 1TW2A 2AW3A 1IUKA 1QK4A 4KXLA 2AG6A 3X2EA 1JHMA 3FRJA 2I1VB 5LIPA 1YO6A 3ILYA 1BDHA 2VQDA 5CX1A 1FRVA 4TKVB 4TRJA 5JZMA 4J7CA 4TVSA 2JI9A 1TQHA 2YKGA 4B5KA 2EWMA 3BD7A 4OMFG 2GNOA 3H1TA 2XKKA 2F90A 1V5EA 4MVCA 2VXOA 4E5SA 4ZAGA 4JJGA 3IODA 5FADA 2EV9A 2YV4A 1AJEA 3WGHA 4DBVO 5JAPA 5TIIA 5DHTA 2CJYA 3E58A 2YJ3A 2WBLC 4ALKA 5DW3A 2QDXA 3EFOA 4TTPA 3SE7A 5LD2C 1MX5A 1K3UB 1E2NA 3DZIA 4UULA 4MS3B 1XEAA 3I39X 4M1KA 1EPUA 4UFOA 1E0JA 3OQMA 2QRVA 1KETA 4RHYA 1KI6A 3IDOA 4JD5A 5KVQA 4G23A 1D5WA 1Z88A 2HNKA 1B43A 2QL9A 4OGLA 5IYZB 3EEQA 4NBKA 1WSAA 4JJZA 4U8GA 1B0AA 2DSTA 2XZTA 3JQ8B 5FV7A 3EE6A 2EFYA 1ONNA 1F9EA 2Q5HA 4AZWA 4DEXA 3KOZA 1G8FA 1QDEA 4K9DA 4DQ0A 3CX4A 3ZOKA 1D2NA 3WAGA 3PIDA 2E89A 1GGFA 3CLSD 1C9MA 5BWOA 1P2BA 2W6ID 5CYPA 4BV8A 1I4OA 1VI6A 3EFBA 3KPUA 2HRQA 4QDXA 5EVJA 4Z3KA 4TZKA 1B1AA 4L5YA 1HDZA 4D80A 5KJ6A 1T2AA 2OHOA 4G0UA 1YRQA 5CXQA 3Q7RA 1RJ9B 2HMYB 3ESAA 3M5CA 4NYMR 2EVWX 4DA6A 2OILA 1PUJA 1XU7A 3TL3A 4B74A 1UL1X 4FR5A 1XZCA 2WW8A 4LIPD 1CUAA 3S55A 1Z06A 4CEJA 3P71T 2X8BA 3PFKA 3QUTA 4XTCS 3W7VA 1NNEA 1FSSA 2BGLA 4WJZA 1RJFA 4J2HA 2IQIA 2EJVA 1FF9A 2TRSB 2VZLA 3H8JA 4D9IA 1ESMA 2FZWA 5KNDA 2Z5FA 1TT5A 2EFEB 3GRCA 1C8LA 1L5YA 2BV3A 2JL1A 3EOAI 2ZAYA 2C3UA 1XALA 1DAKA 1YD7A 4UVHA 1GARA 4C4ZA 3CO5A 4AU1A 1N92A 2DFTA 4H6PA 5TLSA 1RI2A 1D9XA 2ZRJA 3LPDA 2ID4A 4G1FA 1DXHA 1D2MA 4KXMA 2GPBA 4C04A 1IXSB 1HC7A 5BQOA 3ZIUA 1PJTA 5KTYA 2CVFA 4FDMA 1TJYA 1HT1E 5JSFA 3FUWA 3KOMA 2UDPA 2GEFA 1Z5WA 2C1EA 2R8EA 5JD5A 2JFGA 4YS6A 3JW8A 3BRQA 4CKEB 1AS0A 3D5QA 1QE3A 2XGOA 1L8XA 1U4OA 2FMFA 2PBZA 2XJ4A 3EVZA 3Q3VA 4HF7A 3AU8A 2ZYRA 4FXPA 1U8XX 2OVBA 2ZB3A 3EDRA 1WW8A 3EUFA 4DJAA 5JVDF 2C2YA 1IL0A 1IY8A 3BL8A 1LW7A 3WDMA 3I2GA 4PZEA 2JFWA 1CJMA 2EQ5A 3DVAA 3GGOA 4WY5A 2E4XA 5LXTB 4UCXA 3S3TA 5T4FA 4XXHA 2X9NA 3FY4A 3KVRA 1G6KA 2YNMA 2H1HA 3D4BA 1J7KA 1ZM2A 4GIBA 5CITA 1G6HA 2RHWA 1X14A 1PNQA 3CWCA 5CJ2A 3CF4A 4EH1A 4FZ3A 1E6UA 1GZDA 1GNTA 3DZHA 4ZVOA 1B26A 2V4UA 1BYUA 2R86A 3D6MA 5H80A 1ISSA 3TMAA 3HR4A 2RHLA 5KI6A 1FNSA 2ZJAA 2H2FA 3ZJ4A 4DUGD 5KYWA 3IAM6 1T9GS 4IVQA 4WKCA 2JFOA 3ENZA 4BB9A 1PTJC 3F5QA 9LDBA 1IVSA 1TTPB 1UOOA 3P2MA 2ONJA 2QAGC 2H1SA 2BR3A 3MCWA 4B75A 4IJ6A 1KKLA 2Q3FA 2P7HA 2VCHA 2ZSFA 1SXJD 5TEVA 5I9LA 1IN6A 1PJ3A 1M2VA 3CWZA 1S96A 4H4CA 4U7FA 4M53A 1A4UA 4V39A 1HE1C 2GPYA 1SEVA 5FA5A 3KZNA 3WGOA 4D0GA 1WR8A 3FF4A 1E58A 1VXRA 2GBGA 3NM5A 4KAXA 3G8CA 2EC5A 4OHZA 3RBXA 3IH5A 3HE3A 3T5TA 3UJ8A 4QO8A 3VGPA 5A62A 3O5AA 1XVAA 4QT0A 3I6QA 2WF8A 1H0HA 1EFUA 4ZV9A 3A8TA 1JZSA 3ZBUA 1JG1A 2C5GA 3OX4A 3T3EA 1E0SA 3ZNQA 3MXTA 4FFSA 2X2EA 4EKYA 5LKAA 5T41A 5EWJB 4AULA 1RXUA 1E1QA 4L8LA 4F8EA 2V9ZA 5IU6A 1UJNA 3ZKAA 1Z4QA 4UTXA 1LK0A 3A7DA 4TROA 1N32B 3FGOA 3NU1A 2ZT7A 3OX3A 1D6MA 3LOUA 1N2XA 3HJCA 2X40A 1OPXA 1PNVA 2E18A 3JQFC 4U63A 4IYJA 2QVLA 5FA8A 4DC1A 1T25A 3NFYA 1JYFA 1OGJA 3LKBA 3WGVA 1M83A 1C3VA 1U7PA 4Q47A 3ETEA 2IJGX 4ALIA 5D6NA 2W6OA 4BKPA 3AEXA 2NUAA 4FNMA 3BSWA 2QZZA 2ZJ6A 4KQJA 3TJRA 4MMXB 4GVLA 4YP7A 4MPPA 1U28A 4XH9B 4ARVA 2M6LA 2YV5A 4K05A 4UQPA 1XTPA 5ILQA 2HT1A 4F5DA 1TQ4A 1MXHA 1JJ7A 1UWCA 4WKNA 1XROA 2A8YA 2QRPA 2FPGA 3P52A 4RD0A 5JD4A 3FSRA 4HMOA 3GPBA 4FFNA 4FSDA 5GQSA 4ER7A 1CJSA 4JZYA 1TUGA 4XQ0A 4FCTA 2DECA 4QOHA 2B25A 4OK6A 1Z5UA 5CPBA 3SAJA 3FB4A 3FLBA 5J2UA 4CPDA 1NUQA 1Q77A 3FAZA 1VB3A 3QFHA 4PG6A 3MHTA 2X42A 1FU7A 3STTA 3KTAA 5CA1A 1T8YA 2YH2A 4KYVA 5ALSA 4GI7A 2SNIE 3ONFA 1CRWG 1R5BA 4O4HF 2H06A 2OV4A 3EXIA 4PM4A 3ESRA 4FSHA 2YN4A 2FPPB 2FY8A 4BKMA 3DE4X 2QEQA 5F64A 4KDRA 4DA0A 6REQA 2D62A 3AHEA 3SQNA 3QPWA 5IDWA 5L3VA 1UKVY 3BGDA 2WPDD 1MHTA 1MVOA 1QVRA 2OOSA 4IDQA 3UGJA 2PX6A 3O3MB 1GDTA 3D3WA 3MWKA 1XZAA 3FRIA 4YR7A 4G0MA 2QUHA 3KXKA 3L0YA 1ZRSA 4PZYA 5A0TA 3KCNA 2I87A 2YHBA 2HUNA 3CURA 1G66A 2PIDA 3L8EA 4LK2A 1LU9A 1FRNA 4WBNF 1UKEA 4FHDA 3SSMA 3FDXA 1E1YA 2OUIA 5L9AA 1YSCA 2E4AA 2DFLA 4LTMA 4Z1OA 5ERGB 5JANA 2FR8C 5KPDA 2VTBB 1ZITA 2G5CA 4JHXA 1KI1A 1XZDA 5LYJA 4HFJA 4YV1A 2O0KA 3ONVA 4QJ3A 1CF9A 5G0TA 1KFCB 3KXPA 5K3AA 4XEHA 1MO5A 3EIOA 3VTZA 4JGGA 2QI9F 2Z5VA 1BA3A 1Q11A 3OOWA 5IVKA 1R7RA 3WTBA 3LGXA 2XNSA 3R44A 4NMMA 4YCDA 5KX5F 5TV2A 1RLIA 1OC4A 2OAP1 1PWHA 1DOZA 4B2YA 5LA6B 1PZEA 2AN4A 1Y6ZA 3Q3HA 3D6UA 5KVCA 4PO8A 4FXOA 3GAZA 5FNVB 4Y7DA 4HLCA 1HBJA 4BTLA 3MBIA 1XO1A 1QYDA 2A1UB 3QA3E 2IW1A 4RKRA 5B6PA 1UXHA 1I2MA 4K26A 3BQNB 4XPZA 1UMBA 3IBGA 1P2TA 3R1IA 4G0VA 4PAGA 2WD7A 3UATA 2ZJ1A 2BBOA 3KXIA 4M60A 4GPTA 5EZSA 2Y1LA 4F1WA 3DZDA 1SBZA 3KBBA 4FEYA 5DT9A 4BV2A 5AQEA 3WKEA 1XTSA 3RIHA 2XB9A 3D3JA 1UJMA 1YIAA 5JQGB 3OTGA 1BO6A 1SXIA 2BL4A 3IPLA 1E3WB 1HMYA 4II3A 2QR5A 3K3PA 4PO1A 3FTQA 5AK3A 4B3IA 5K0FA 5A6SB 3RS4A 2HA5A 2ZBUA 4L8FA 4RVUA 1OV6A 4HWTA 4KP7A 5F1PA 3RWMB 3UT6A 3NHRA 4X1YA 3INTA 1KDZA 1VE6A 4O5AA 5EHZA 1BW9A 1SRQA 2VNIA 5E0KB 5T6MA 2VH1A 2GXUA 1T8RA 5EQJB 3NJRA 1OT5A 3H7AA 4YRQA 2DOKA 1UZNA 1I9CA 3E7XA 4RKEA 3H1EA 1MVNA 3AESB 4M0LA 4P35A 3BE4A 1FRZA 3W4IA 4YBZA 1DC5A 5DE3A 2AC4A 3KZCA 1WS6A 3RFXA 2G7MC 2B6NA 3CG4A 2RMKA 2IUFA 2WVHA 3F2IA 1UINA 4RCZA 1E1MA 5FCDA 1SUSA 2DLDA 2NTNA 4QLAA 1XXHE 1V8FA 1TC2A 4JK3A 5ALPA 3RKRA 2AOVA 1HLDA 3N75A 4NP6A 3ZWYA 1YDMA 3RM3A 1CUSA 1SIWA 1L5HB 4KLNA 5DTMA 5ADWA 2XGMA 1RXCA 2PRYA 3CUEF 3RIXA 1IMOA 4F6RA 1FSFA 3QKSB 1B0PA 4O33A 4TOIA 1VA4A 5KOJA 2OQIA 2G9RA 2Y76A 4R9VA 1LCIA 3ISJA 3CT6A 2L18A 5FWYA 2ZBGA 1TUIA 1UK7A 3OF2A 3R3SA 3E5MA 1DKMA 3PRJA 2OLEA 4TMWA 4EO4A 2BGJA 2QAIA 4LGMA 3U2QA 5KOHB 1YKFA 4R31A 5DTRA 2BEUA 4XVRA 1QONA 1C9EA 5TPWB 2GEBA 3LLCA 5IULC 2YJ5A 3GQBA 3QVUA 3VA7A 4TVKA 2CNOA 4GKBA 1Y8ZA 5FPSA 1DX4A 3PGMA 3QM1A 3N2GA 3AFNA 2ZUEA 3FHJA 4X7MA 2GXAA 3F4KA 1DKNA 2FQQA 4MOWA 2BBTA 2COEA 3I28A 3SZOA 2PQ6A 5F4ZA 4DG5A 4EI7A 1Z4OA 3N0XA 4MV4A 5IJ9A 1FW6A 1JHYA 4TN5A 2O19A 5KSOA 1G4HA 1FS4A 3GUYA 1DC8A 2VNSA 3G49A 1XBTA 2XAAA 2XCTB 2PLAA 4D6PA 4RIGA 2IZZA 2P9HA 3IUEA 3GRRA 3I23A 3J81A 2CHVA 1IHYA 2O1SA 2W71A 3DCIA 4G4SO 1WUIS 3OJ0A 1YA6A 4RK7A 1UDRA 3AI7A 4J0CA 4DRXB 4KRFA 5C52B 4UVEA 4D4IA 2ZSKA 4UBMA 3HXTA 4XIJA 5E9WA 1OH7A 3AERB 3K1ZA 1PN3A 1SKQA 3N6XA 4GI2A 5C18A 3PFWO 2E21A 3THYB 2VP3A 1CDOA 1AMUA 1O5OA 1S5PA 5C4GB 1QYWA 1R4NB 3NXKA 4NULA 5IZCC 1U9CA 4A15A 5K8CA 1V7PC 2Z1DA 3AUFA 5C7OO 2YFKA 3OJFA 2GPSA 4BGDA 2B1QA 2AMFA 2GF9A 1SD1A 4IDBA 1AQNA 2FPXA 1ZVMA 1ECCA 2YUTA 1ZH8A 4V0NA 1J06A 1IXYA 1DTWA 4MB0A 2HDOA 2WWHA 3A2MA 2VF2A 4CQJA 5JE8A 2EWVA 1BXGB 1CU1A 1ADCA 3O8QA 2HSJA 4Y2GA 2AI1A 1JPUA 3EXG1 2BVNA 1CFJA 1UEJA 2QAGB 5LDGA 3PQFA 2PU5A 1WB6A 1NQ5A 4PGGA 1NVFA 2Y2UA 3K9NA 3ZWKA 2R7KA 4CKXA 3ZLTA 1F06A 4PEVA 1ZGHA 2D0IA 3H2JA 4ZO7A 1SU4A 3DE5X 3AILA 3WGKA 4EUSA 4BFLA 1Q7GA 2VJMA 2PD4A 3NW9A 4P3KA 3R76A 1BKDR 4G07A 3FCXA 3WYNA 1SCQA 4R8VA 5HJ7A 3FSGA 2GLUA 4CM4A 1K3FA 2WA2A 2WVAA 1TM4E 1BHQ1 3UC5A 2OK7A 4NBRA 3USES 2QOEA 4X60A 4IYRA 4ZO6A 3HXMA 2EF1A 5FQOA 1GUZA 1ONPA 3K6SA 2P2NA 3GELA 1IEVA 1OTXA 3SBXA 3V34A 4Y1RA 4PSAA 5K3CA 1E32A 3KSDO 3ITDA 4CCYB 3ROQA 1PJLA 3SWWA 3CGGA 1U8CB 1I2CA 3CH4B 5GAJA 3T0IA 1K4KA 4R8LA 5JAHA 1OIVA 4I66A 1MT3A 1VHJA 3RUPA 5YASA 1A3CA 2VYNA 3HY6A 4AMGA 2ZJ8A 1SIOA 5JOQA 1EB8A 4N12A 2X0DA 1U3GA 1PFGA 1TGYA 4BC0A 3I42A 3HCEA 1EUZA 5LZ4A 4EMSA 1E2FA 3V4SA 2J07A 2HGZA 4NCHA 3ZGOA 4YREA 2R2GA 1H8HA 4QXPA 3O8BA 1DXQA 3KG2A 4G9EA 2P0AA 4OA8A 1KY2A 3MJ4A 4FS3A 1LTHR 4CHGA 4FGJA 3V1UA 4RF4A 1IG3A 1AT1A 2G09A 2PGDA 4FDUA 2ZZNA 2W2MA 3I52A 4Y9RA 4LMBA 3PR2B 4RK5A 3HY3A 3TFWA 3A4NA 2PVPA 5AI5A 4OATA 1S0UA 4AC9A 4K9RA 1H8ED 4H0NA 4QOJA 2PMEA 3NG1A 1PL7A 2C9MA 2GPNA 1EHYA 4GC9A 1W34A 2Y0CA 4UZEA 3SZLA 4EI9A 3KVNA 3KYCA 4MVWA 4R40A 4IJKA 1M5RA 4RMGA 5E4YA 4EHAA 1U2PA 3DAPA 3FLEA 3K0KA 5C3MA 3CE6A 4ZT7A 2PHZA 2W0SA 4D0LB 2ZIZA 2PUHA 1Z3CA 4BBZA 3HLTA 5EZYF 1U28C 3B1ZA 5CHYA 1KH3A 1BHO1 1PK7A 4ICIA 2HWYA 2ID8A 5JZVA 3UWSA 2H29A 1OZAA 4AG6A 4WBXC 4WE3A 1DGQA 3S2IA 3C39A 2FFJA 2XE6A 3PI6A 6Q21A 4G8JA 1JFRA 4OP1A 4Q18A 1RHJA 4GE3A 4IIJA 4MR8A 5IG2A 4ZU6X 4MUFA 2GK3A 4BFCA 1QK5A 1UCFA 1WKVA 3UAOA 4LV6A 4PS0A 3B3GA 3G9QA 1G9SA 3FPEA 2OXRA 2QMYA 4MGZR 5ALNA 3KOWA 4JJEA 2SICE 3N5KA 2FMKA 4YPFA 2ZIEA 1ZISA 3A1WA 3R4VA 1YAJA 3MWJA 3SHOA 4FCWA 2C0CA 3KLBA 3TTYA 1CS4C 2X86A 1F3OA 1M6NA 3ORSA 4Q1BA 3VBEA 5K0TA 1GCGA 1WNFA 2BTOA 2Y9PB 1B23P 3C6MA 3B5IA 1RYYA 1KJWA 3L8ZA 3HCDA 3JAKA 4PPYA 5JNWA 3NH6A 2IU0A 3K6JA 3LC7O 1XZGA 3GEEA 4DJ5X 1UJBA 1I7DA 3H5AA 1EFAA 1OHHA 3IERA 1ZD5A 3SJBA 2AMLA 4HXGA 5L51A 2IL1A 3ANTA 1IHXA 4KE7A 1BQ4A 1EM6A 4M37A 1NP6A 1U7OA 2X3YA 1OGIA 3GFOA 4MCJA 1A8PA 1I6MA 4OAQA 1KMMA 1ZIYA 2CLFB 4UBKA 2V7QD 5B3JA 1Z6XA 1GHTA 1P73A 5C5IA 4WA8A 3U5TA 3UVEA 4MROA 2J3JA 3ZYZA 1BFKA 1BN7A 3BMQB 4Y2JA 3SF0A 4P08A 4P0TA 5I5GA 1C0IA 1TOAA 2NXCA 2WJWA 1X92A 4IH4A 4IO0A 4PQGA 4UVIA 4EWLA 2BSXA 3N1UA 2YICA 4EABA 4M2LA 1K88A 2ZS7A 2CLEB 4MV3A 3UH0A 3HL0A 4B3FX 3P0RA 3Q7QA 4HGNA 3FFXA 3URKA 4UCFA 4J1SA 1CDEA 1NBOA 2PS9A 3DO5A 1KORA 3PE3A 4GRAA 4YDHB 3CBQA 1ZZGA 3K70C 5CXXA 1I7SB 4JR1A 3SGLA 5JISA 3G5TA 1CR4A 3KE9A 4MS1B 4ENUA 1A8IA 3EIFA 1RU3A 2X22A 2ZJBA 3BD6A 4GDMA 4GECA 3LPNA 5T57A 1L5LA 4BGVA 5AQ1A 2PUFA 1CUVA 3TZ6A 4WUVA 1E2GA 2NN3C 2WAYA 3OI7A 2QJTA 2NSYA 3VTKA 5BQFA 3CB2A 3OZRA 2WJZB 4WLOA 5EN4A 4CG0A 2VHJA 4EG1A 3G2HA 3D64A 4LHXA 5JMWA 3DMGA 2BGNA 1G3UA 3G17A 4ZOCA 5DP2A 2IXTA 1WABA 4QOIA 2NQTA 2YWXA 3K8ZA 5FP0A 1M3SA 2UZIR 1H9BA 2WR8A 3UJ6A 1SHZA 4ZIRA 5BMOA 2R00A 3PJFA 3TTUA 4U6QA 3ZUPA 3AUSA 4UE2A 4PYLA 2X5JO 1U3WA 4QYMA 4KQ1A 1TUBB 1W581 4ENQA 3GVPA 1CUFA 4QNMA 1DRWA 3AHFA 4PLGA 1E7YA 1HDYA 2QXUA 1X9GA 3O92A 3U4CA 2ZRKA 3IUPA 4FZ5A 3R74A 2CDAA 4REOA 5KQGA 5KSYA 1WZ2A 3JZFA 4BMCA 1XHEA 4LGCA 1PCXA 3N2ZB 1S1CA 1WCWA 2BFBB 3CEAA 4HX9A 4IJWA 5ALUA 4BBPA 1BMFD 4LRUA 5DN9A 4HGZA 2HLDA 4WLNA 1NVUQ 1O97D 3I5MA 1UUFA 4LJYA 1KA9H 1THGA 2CN1A 2GK6A 2JDID 3RVBA 3UJ3X 4P3YA 3ZXSA 3VJRA 1V96A 5FPHA 1PRYA 1Y4SA 3NX4A 5FPPA 1TA0A 2X0KA 1MQAA 3F6PA 4Q9JA 4V0RA 3DFKA 4KQCA 4OIFA 1QHGA 5ADHA 521PA 4TRNA 5ALMA 1QU3A 2Y27A 4PVDA 4ZHQA 4KR3A 4M1WA 3W78A 3K92A 2IV7A 5FR2A 2XVAA 2BTQA 3RU2A 2PUCA 3L1UA 4BOYA 5BOSB 4HDKB 4H1UA 1ZL0A 3U9LA 1PFYA 3VR0A 2H65A 2BRUC 3P5BA 2XR1A 3KTDA 5B37A 1XMQB 3ZDBA 3DOFA 3W2FA 5CDUA 4DLNA 3WOVA 2HU5A 2MU1A 2PIAA 3SJUA 4EHLA 5F76A 3V6LA 3ZCVA 1OU4A 3VM6A 5FLXA 1DTEA 4OUDB 1KOGA 4LFAB 3DPSA 1S4MA 1QRSA 3WGUA 1LBQA 2QY9A 3BE5A 3EUEA 1N7JA 5TEWA 3LNTA 1C81A 1VJTA 1O03A 5EMHA 4BASA 3BIWA 1NSTA 3LUPA 4D43A 3OSUA 1X39A 1K06A 4KNYA 2VK8A 1A71A 2HBRA 3KDSE 2VPPA 2D5AA 2QORA 2RHBA 3TZLA 5KO2A 1L2TA 1WETA 3IQFA 3IE0A 2GRAA 1FRQA 1M8KA 2LE0A 3HA7A 3KU1A 3NEJA 2WHYA 1NPTO 1WY5A 1M9NA 1GFIA 3DKPA 4GMFA 4H08A 4RDXA 2Z83A 1DLJA 1X77A 3MT0A 1T2FA 4X6LA 1DADA 2WOOA 1I3MA 2YWEA 2LTAA 2R3SA 3V2HA 1OBHA 2TECE 3MELA 4MULA 1RJ9A 2IITA 3IJRA 1L7BA 1GEGA 5EE1A 3DAYA 1PGJA 3P0EA 4KMRA 1C3XA 4JUAA 3QOYA 4ARZB 4X8OA 4LNAA 1T5IA 1FSGA 5G0SA 2QMZA 3I30X 3TUJC 4P82A 1DJQA 3HVUA 5J5AA 5TPZD 1TT5B 2GPWA 4ID9A 2J9GA 3N28A 4JLMA 4R6WA 4QLBA 1VZ3A 2GZSA 2QD1A 4JAVC 4KHZA 4OPMA 3GEIA 3D6JA 1WMBA 2ON6A 3ASYA 3PF8A 1DEAA 4EPTA 1XDBA 3EIEA 4QELA 3K4PA 2PBRA 3L0OA 4LVOA 2PX3A 1QYXA 1NMSA 4X85A 5LDDC 3UJ9A 5KWVA 5DKFA 4RPGA 1F17A 1E59A 4WL0A 1EYZA 1JGTA 3ZU3A 4HK4A 3SN6A 3F6SA 5I4BA 1RQGA 2VTDA 4PLFA 1Q20A 4CT5A 2QZ9A 1A7UA 1SZDA 2Y1OA 2R96A 3L92A 5HFNA 1NGSA 4OQMA 3DFUA 4FILA 4M88A 5EYPB 2OCPA 4R1UA 1QJ4A 2PXHA 3G2IA 3N6VA 4ZRMA 1SG6A 1U5CA 1A7AA 3D3NA 2X8JB 4QU9A 5JNLA 1QE5A 2FJPA 3KSRA 4Z9FA 1CF4A 4C7OA 3AETA 4B4DA 1RIFA 4YRIA 3EBOA 1Y9JA 1QRUA 1QG6A 4ZMRA 5AVYA 2VJDA 1Y6RA 3GARA 1U0SY 4YH1A 3RUCA 2CV0A 1VBKA 2OG1A 4RZHA 1X7HA 3ASUA 2HWWA 3PDJA 4XB6B 3AYXB 1KQFA 3TLYA 3ZHZA 2JJ1A 4TKUA 3PPXA 3NGXA 2CHGA 1K8QA 1IOVA 1DIRA 1NKVA 1ADGA 3GCGA 4DYVA 1YKGA 3F46A 3FNQA 4N7JA 4QUDA 3U3OA 4AMUA 3NCTA 2VT6A 1NXOA 4DZTA 3STVA 4BQNA 3DLAA 4NJMA 2QSZA 1PKXA 3CNOA 1XWWA 2ZJ7A 4MVJD 4CV3A 1Q2XA 1UBFA 2QUBA 2VEDA 3FCYA 4V38A 4KPFC 5JADA 1VI2A 2QV0A 3EH2A 4N7RA 1FDTA 4EKNB 2OT3B 3MTJA 1R6DA 5ALDA 4CEHB 1OLUA 1ODFA 1T5SA 2FETA 3PNLA 2PA0A 4BC1A 1FMFA 4M8LA 1PX2A 4ZDKA 1PFWA 1U3TA 3OAAA 4HDRA 5AM4A 3EPRA 4HQOA 1MHPA 1G6OA 1ZMRA 5I7OA 1A72A 2AUTA 2VRWA 4RMNA 3TK1A 2PLFA 3CT4A 3GT4A 1BDMA 3LLSA 3E7FA 4LF5B 3QVGB 5E6UB 2CBXA 3TCXB 3OBBA 3NBKA 3JQAD 4GZ5A 2PZEA 2BIFA 3BIFA 2NU8B 5B1HA 4HEHA 5KUTA 2X23A 2DR3A 1HQDA 1T6ZA 2Q1UA 4ENWA 3KDAA 2W2LA 3DFIA 3PFNA 1ZJJA 3S28A 2DETA 2OYCA 2J4FA 3PPVA 1FYVA 1TMYA 2CD9A 1BA2A 2QIPA 3G9UA 3JYQA 1PW7A 4MRMB 4R1NA 2XVYA 3QFTA 4FJ0A 3KALA 3VR3D