2OFWA

Crystal structure of the apsk domain of human papss1 complexed with 2 aps molecules
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
200
Chain Sequence
NVTYQAHHVSRNKRGQVVGTRGGFRGCTIWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLNERDILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APS kinase domain of the PAPS synthetase 1
publication title Elucidation of the Active Conformation of the APS-Kinase Domain of Human PAPS Synthetase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 200
sequence length 201
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ofwA00
3IIKA 3I8SA 2REBA 2FF7A 2KBEA 5FL7A 3MUFA 4CZ2A 2VBCA 1LVGA 4XSHA 1OIVA 1Z0JA 3L0OA 3FVQA 3S1AA 2QTFA 4AG5A 4BFSA 3TRFA 1TNDA 2F1JA 2FEOA 3VR5A 3D6TB 2D7DA 1XXHB 3CONA 1E9DA 4YDSA 2FGJA 3AM1A 1L8QA 5JI3E 2HJVA 1RRGA 2PCJA 3RWOA 2EYQA 3NKVA 5JSZA 4E03A 1ZD9A 3IO3A 5J4KA 4QBIA 3CIOA 3FMPB 2X2EA 4B74A 1ZUIA 2PCLA 1WP9A 5D3MA 4MDEA 1Z08A 1WRBA 3REFA 3RS3A 4E5UA 4DKXA 4JKYA 4DLXA 1HA3A 3GLGE 5KSPA 2VQSA 4FINA 3GLIB 4OQNA 4YONB 3K8YA 1F2TB 1NG1A 3BRWD 4HUQB 4YDHB 3OF5A 3GMTA 4ILEA 5L3QA 4RZ3A 1KTVA 2XSZD 5DN6D 3PEYA 4US2R 5EXTA 1J70A 2J7PA 4LC0A 4LJ7A 1TX4B 4TYNA 3VKHA 4KFUA 4NHOA 2JDID 4D80A 1M1YE 4A0GA 4DDWA 3UMSA 3F8TA 3B1YA 1TUEA 3A4LA 2ONJA 4GNKA 2VP4A 1GG2A 1MO3A 3KZ1E 2RGCA 4PSVA 1PUIA 2IWRA 2FMXA 3SN6A 4GDFA 4CEHA 1E4VA 2XZPA 5FPYA 2IL1A 4LYFA 5JCPA 4HB0A 3CKLA 3W34A 1XPOA 2HXYA 3LBHA 5BYKA 1ONBA 121PA 2CJWA 1Z6AA 3LQQA 4NZYA 5GVRA 2QORA 3UANA 4N1AA 1D5CA 1NBMD 2QM7A 3B1WA 4PC1A 5H68A 4DVGA 5CLLA 3PJRA 4L9WA 5EP4A 1NMZA 2QMUA 1N5LA 2WIAA 1MO5A 1R5OA 5H70A 4C30A 1Z5ZA 4OI4A 1IBRA 2A7QA 4Z1MD 4Q9IA 1HH4A 4YC7A 1R0YA 2ZAMA 4IOMA 4CT4B 4LV8B 2OE2A 3RVBA 5HKKA 1MOZA 3ICEA 2QBYB 1G6OA 4MRSA 4BFVA 3K0CC 3OEHD 2EWWA 4TN1A 4IEEA 5TVKA 1DAKA 3LQRA 2IS2A 4TSFA 1N5KA 2ORIA 2REOA 4M9QA 2REXB 2HT6A 4BECA 1NVVR 1ZUHA 1EGAA 4JS0A 4OQXA 5CM8B 3DKVA 2W0SA 2NOAA 1XU4A 5JEDA 2PBRA 1MT0A 4PC6A 3TR5A 1COWD 2F3RA 4JBYA 3QPVA 1Q3TA 3GFOA 4U00A 3RS2A 4NE2A 3VX4A 1GRNA 4JJZA 4NYIR 1ZM7A 4LDJA 1BKDR 3BD9A 4L4UA 3HDTA 3LXXA 4JIMA 3CH5A 2IK8A 1XMVA 2ZRDA 2YINC 4IVRA 3RNLA 4M1WA 3KJIA 1HEIA 2BBSA 4P4UA 2O0KA 3PR1A 4ZDKA 1CJMA 4DLUA 4ON9A 1XJCA 3RS5A 2NMVA 1NSTA 3LLMA 4QHSA 1CBUA 1XRJA 1VCNA 2GZHA 2GILA 4LV6A 5J47A 1FUKA 4G5QA 3EARA 3HU1A 4HZUB 1KZGB 3EIQA 4CDGA 5JRZA 3GLFB 4D81A 4PPFA 2FX3A 2XXAB 4U02A 3AUYA 3HP1A 4RKFA 5FI1B 2J0QA 2OZEA 1KI2A 3EAQA 4PAQA 5DI3A 3IIMA 4HUQA 3THXA 2V7QD 1KSGA 3K0SA 1Y3AA 4IOLA 3IQXA 4GFDA 4OQMA 2GA8A 1Q3HA 2QE7A 4K46A 5TXGA 3RSLA 1P2TA 2N42A 3OEED 1Q1EA 2JJ1D 4M22A 3K9GA 5AUNB 4DSTA 3I5YA 1XD2A 4Q01A 3AVTA 1G64A 1Z0IA 1PV4A 2OCPA 4PPQA 3IPXA 1CJTC 1A82A 1RE0A 3DZ8A 2AR7A 1JALA 4PZZA 1JQLB 5FOVA 3KKOA 3QJYA 3X2SA 4JL5A 3NBZC 1I4DD 4BGDA 4KO8A 1II9A 3VX3A 4B3CA 2YOFA 4B71A 1II8B 4ZKDA 4UXHA 1N5IA 3NHBA 4EDHA 2IXEA 4TWZA 3F0TA 1UADA 2KWIA 3WP1B 1TU3A 5JZVA 1P3JA 1NN1A 4M9XA 4HLQB 3SJCA 2VP9A 1NKTA 5TV2A 2ZYTX 4L16A 3CO5A 4V0MA 1VG8A 2LCFA 3GLHA 5DYGA 1VYTA 4G5OA 2NPIA 4IXMA 4YQFA 5FOXA 3A37A 3TUIC 3ND9A 2CCKA 5D3QA 2DY1A 3NVAA 3OE7A 2SHKA 2ZSEA 2EW1A 4OHXA 4PAOA 4EQ6B 3VU9A 4HATA 4KHZA 5JJLA 1F2TA 3K0FA 2X1VA 4M0LA 1OFHA 4RFSB 3FHOA 5C4MA 3AF2A 2WAYA 4QRHA 2PMDA 5K8UA 3KUCA 3GJXC 1JJVA 1U8AA 3R8CA 1A1VA 1J90A 2YKGA 1IAQA 2ZRIA 3MSXA 3VFDA 4JLPA 4A8JA 4D0NA 2ZI3A 1G3MA 4DSNA 3WBJA 4ABYA 3DVLA 3QXHA 3T35A 2JJ8A 2XJ9A 2GXUA 1Q44A 3KXIA 1DG1G 1YVDA 2FDCA 3BOSA 4Q1BA 5KNBA 4MYCA 1FMLA 2GETA 1Z3IX 4W5WA 721PA 3KXKA 3G82C 1W4BA 4TTPA 2C98A 2F55A 5FOUA 3PXGA 1GOTA 4B35A 1K5DA 4G5RA 4IVQA 2ZS9A 4N0EA 1E2NA 2CJWB 4O2LA 1T8TA 4UQOA 1SGWA 1G16A 1HQYE 2C8VA 1W5TA 1VPLA 1Z6GA 4G01B 4LUCA 1OPXA 1LFDB 1M2OB 2P5TB 2ZR9A 3FGNA 3Q5DA 4M1YA 1M34E 1ZD8A 3DDCA 4WVFA 4CVNA 3B82A 4DCTA 4NP6A 1PVOA 3SNHA 1MRSA 1Z28A 3THXB 3TSZA 3G5UA 2IA5A 4M9SA 4OK3A 4P31A 4XWAA 3BORA 5EUMA 1E2EA 4C3ZA 2GJ9A 2C9CA 2YWEA 5CJPA 3I62A 2XNDA 4QBHA 3SU8A 3W8RA 1RJ9A 1RRFA 2R65A 4BLTA 4PSAA 1YZQA 4BLRA 1P75A 1G9XA 3CZQA 4V0ME 1LY1A 1OJLA 2WBLC 4C0SA 3D8BA 1KO8A 1U98A 1DO0A 1EX6A 4DB2A 2AFIE 4BEBA 3BB4A 4LHZA 1CJVC 4G5SA 4NYMQ 4ITRC 3V9PA 3SJBA 3N5CA 1JR3E 4EPVA 2JIZD 1EWQA 4KXFB 1SQ5A 1OXUA 2BKUA 2FPLA 3FFBA 3Q9LA 2O0HA 3N70A 1NY5A 2VH5R 3A1UA 2KSQA 3NIBA 3QENA 4NYJQ 5B58C 5L3QB 2A2ZA 4BRUA 2W58A 3CX7A 3TAUA 2QI9C 4PC7A 4GP7A 4DBLC 3ZLJA 3PUYA 5HTKA 2A5YB 4DUGD 2ANBA 2JLUA 1N0WA 1R0XA 1AA9A 2HEIA 4IEIA 1J8YF 3O8BA 3P32A 2QAGB 4ZIRA 1G7TA 3FKSD 2A9KA 5AJVB 1JQJC 3GLIE 4O25A 1ETUA 1E0JA 4D2IA 3GLGB 2IYWA 2QPTA 5FOWA 1SVKA 4RZXA 4NYMR 1IJFA 1OE0A 3CR7A 3A58B 1SVIA 2HJGA 3WMFA 4FN5A 2ZETA 3R7WA 3K70B 4OK6A 4UXIA 2N1BA 2ATXA 2P6UA 3M1IA 2G0NA 3U3RA 2WIBA 1ZU5A 1E9FA 2OEPA 3K0EA 3AVYA 2DCUA 4NMMA 3CWQA 2IW3A 1Q1QA 4BFTA 3ZS8A 2J5XA 1XXHE 1KK1A 1SVOA 4QGHA 3EC1A 2F9MA 2ZUBA 3KKMA 3NDPA 4PSKA 4A2QA 4D26A 1E94E 4X8OA 1WQ1R 1P61B 2VRWA 4BFZA 1ZYUA 3IKJA 4DXAA 3IBYA 4BZXA 1ZU4A 1W36B 2ZRHA 3VHLB 2VP0A 3SE0A 3U6KA 2BVNA 3MJRA 4CEIA 3UWKA 2WOJA 1XF9A 3K0AB 1Z63A 3TW8B 1ZAKA 1IY2A 3IBGA 1WF3A 4KU4A 1A5TA 1ANKA 4CF7A 1SVSA 1U0JA 4HEJA 1E2MA 3FB4A 5FUXA 2CVFA 1OLOA 1TPZA 2AFHE 2JGNA 4XD7A 3LXRA 1UBGA 2NG1A 2EFHB 5K8IA 3K9HA 2GCOB 3AGPA 4HZIA 4KYUA 4WA7A 2YJTD 2ZVQX 2ZJ5A 5JFGA 4FCWA 4BUJA 4QJ4A 5KPDA 3U3KA 5FBLB 2B21A 3U7GA 2B6HA 1IOZA 2QBYA 4GOKA 2BBTA 8OHMA 3B7GA 1D2EA 4DLSA 4NTZA 2JDIA 4MQBA 4FW9A 2RGNA 1P4SA 3DKPA 4AG6A 1OHHA 1S1CA 4US1R 3SEAA 1KK0A 1VIAA 3GJ8A 4WW0A 5LD2B 3C8UA 5HE8A 4LOAA 3JZAA 4A6XA 4KBFA 1P2SA 1XFAA 3KKPA 3UMRA 1ZCAA 2OFWA 1Z6XA 2XNSA 2IBMA 4MKIA 4B33A 2VP2A 4DUGA 2WJJA 2OAP1 3O47A 1X6VA 4HSEA 4II7A 2GESA 2FFBA 4M1KA 3FOZA 4LPKA 2UZ3A 2G77B 1W36D 1KDPA 1RW4A 3WMEA 5C46F 1G8PA 2VHTA 4QFMA 3MJHA 3BWDD 2WSMA 4JLDA 2GCPA 2WM9B 3I8XA 4A15A 3QKTA 5KO2A 2GVDC 4KV9A 2B7BA 4GT1A 3J81k 2WWGA 2FSGA 5EXXA 1DTSA 1U8ZA 1CIPA 2YWFA 5J4HA 2XAUA 4PO1A 2JIZA 3U6BA 4Q1DA 2AHOA 4DHEA 4A2PA 2QROA 4MRVA 4KJZA 3QG5A 5JSZB 5CJ2A 4AYTA 2JA1A 2BHRA 4QNRA 1XEWX 2IYXA 2ORWA 4PQRA 1MO4A 4B44A 3EA0A 1KHTA 1N5JA 3HJNA 2GJKA 2ZRCA 1FP7A 4YMSA 4BLPA 1T8UA 5HZKA 4IFEA 1FQKA 1X1RA 2IHYA 2MSCB 2JAQA 2W00A 4HZUA 5IF9A 2F3TA 3ZQ6A 3GLIA 5FI0B 1YZNA 3CWZA 2FFHA 1Z2AA 2JLSA 4I1VA 1G18A 3T1TA 5GJWC 4DDVA 1E3MA 3R9XA 4AYXA 3GP8A 4P32A 3AKCA 2B7CA 3I3SR 4MKFA 4B3BA 3DMNA 4IDHA 4NCKA 3UG6A 1Z29A 3MWYW 4P4SA 1Q0UA 1VCOA 5L8VA 1ZM3A 1FMJA 4JSYA 3HWSA 5FTKA 2QMOA 1FQJA 1R0WA 3IEUA 1HYQA 2IYVA 4IDPA 4B6EA 4NDZA 1SVLA 4TYPA 5C1BA 4B48A 2G9NA 3TVTA 1X3SA 1KDOA 2OCAA 4RD2A 4BZPA 3PG5A 1R8SA 4D82A 2ZRBA 2CNWA 4A4DA 5LD2C 3Q3JB 1IN6A 1ESMA 4OYHA 2XZOA 3KX2A 2VTKA 1GNRA 2AWNA 3VMFA 4EPYA 1W5SA 2V1XA 4Q7MB 1OKKD 2Q3FA 1Z47A 4TMTA 1K6MA 4PHFA 1G7CA 4CYMA 1JR3D 2A78A 2ZE7A 4URWR 4NU0A 4DDTA 1CJUC 1Z0KA 4AURA 5KUTA 5AJXA 1KO5A 2W6ID 2Z43A 3X1WA 1XJ0A 1AM4D 2R6AA 3FYHA 1QRAA 1U8YA 3L0PA 1AN0A 4HLUC 1IN5A 2D62A 1X1SA 4I1OA 2EVWX 4QNMA 3SHFA 1F5NA 4CEJB 1XD9A 4LHVA 2EFDB 3NEYA 1E99A 2XXAA 1M6NA 2GKSA 4QL3A 4AY2A 4WXRA 1U0HC 4H1UA 4Q9LA 3WRYC 2QENA 4LBVA 2Z0MA 5FPTA 3FMFA 3EZ7A 1NMXA 3IUYA 4XSGA 1ZMXA 4IVPA 1YRAA 3TBKA 2BJWA 1C9KA 2IYYA 1XEWY 1QZXA 2CLSA 4YMVA 3SJAA 1JI0A 1OXXK 1CJKC 2CLCX 3PIRA 3ZS9A 2JLWA 1VIYA 1E1RA 2V55B 5L3RA 3BB1A 1YZLA 5DNYB 1JNYA 2X77A 3GEIA 4YMTA 4RY2A 4J0QA 4G5GA 3K0CA 4TSFD 2ZREA 1HUQA 1KDTA 2C78A 2FSHA 2NTYC 2ERYA 2CL6X 4QGFA 5J4YA 1OFIA 3U3MA 4EFNA 4JBXA 5E7IA 2G1JA 3A1SA 3KKNA 3L0IB 3UKDA 1XCMA 3EPHA 2CHVA 4Q03A 4F4JA 1RRCA 3TUJC 3P26A 3CUEF 2J3EA 1P9NA 2RMKA 2AX4A 3A1TA 4Q4JA 4KSCA 3QVUA 3W6PA 4KITB 3QXSA 2CCGA 2Z83A 1FFHA 3KJGA 3QBTA 2HLDA 4TLDA 1E0SA 2XEXA 3U7EB 4JLOA 2O8FA 4N3NA 1KI3A 1A7JA 2V54A 4F38A 4KFRA 5LB2A 4DSOA 2HCBA 1OT3A 1PUJA 1DBSA 1JBKA 2GZDA 3CNNA 3NBXX 3Q8XB 4JMPA 2ZIAA 4M1OA 4XTRA 3UXMA 3I61A 4B34A 4RCYA 2WWHA 3FFAA 2E1RA 1S3GA 2HXSA 3CB4A 3SR0A 1DE0A 3W3AA 1ZC3A 4TZ0A 2WJIA 4B76A 2GRJA 2QRNA 5K8LA 4LHXA 2HYIC 1FTNA 3IHLA 4GP6A 5FPSA 1YKSA 2IUSA 1NJFA 4PTLA 3TK1A 4BWYA 2QUZA 2WKPA 4OBEA 1LTQA 1NG9A 3SS8A 1NNEA 1D6JA 5KNCA 2NO1A 4JLJA 3OFNA 1CRPA 3GJ0A 1E2FA 3E2IA 1UKYA 4EAQA 3U4QB 1SZPA 3T15A 1ODFA 4TLCA 3AKDA 3LO5A 1NY6A 4KVAA 2CE7A 4OK5A 4NYIQ 1UBCA 3BGWA 3WY9A 2ZJYA 3ZH9B 3UIEA 3EX7C 5EJEA 1IM2A 2ZI7A 4PO8A 2RHDA 3DO6A 3CNLA 1RYHA 5FBWB 3KXLA 3MWLA 3I72A 3L0SA 4URXR 1VYVA 3ZIAD 4ASUA 1YHNA 3T5GA 1BYUA 3BERA 2ZQ5A 1GFIA 1U94A 4TTQA 4Z1MA 2G6BA 2IC5A 1E1QA 3RABA 3PENA 5FTNA 1AQUA 1Z83A 2ODBA 3CPJB 3GEHA 5SZIA 4LBYA 5FBVB 2ZAOA 1ELOA 5B2ZA 2Z4RA 4C0JA 4PC2A 4RD6A 1NVUQ 4IJMA 4LYJA 3A1VA 3EZFA 2VYFA 5KTYA 3OE7D 4LY6A 2OT3B 1GIAA 4DEXA 4V0KA 3PITA 2V9PA 2ZRKA 4ZKEA 3CF0A 2ZRPA 3P20A 2OBMA 4LX0A 3NXSA 1YZGA 4M53A 3I5XA 1P7CA 4FMCF 3K53A 4IHQA 4UNPA 5E95A 5JWHA 2NIPA 2QMHA 2FSFA 1YR9A 1ZCBA 2ZANA 2GK6A 4W5HA 5EE9A 1W4AA 2FEMA 3E1SA 1SXJD 1XMIA 1CEEA 1W36C 4FIDA 3CPEA 3CRRA 4HLDA 5JLJA 3H0KA 3ZQJA 3TGPA 3E5HA 1Z6YA 2QTHA 2PLFA 4Q48A 2EFEB 3EZ6A 1KAGA 3GEEA 1YZTA 2QM8A 4G0NA 4LWZA 3P4XA 3X1YA 3OIWA 4MGIR 4WZBE 1ESNA 421PA 5BN5A 4KFSA 2OFXA 5G3YA 2GEUA 4ZCIA 4TLBA 1KI4A 2ZSAA 4A8JC 4BPBA 1YQTA 4EFLA 1CRQA 4CT5A 1ZM2A 2MMGA 3SOPA 1BMFD 3BH6A 1UDXA 5CYPA 2CEAA 3OIYA 3W3ZB 2HUPA 2J0SA 2AL7A 1K8RA 4C9BA 4UNQA 2HDNB 4JZKA 1KY2A 3T12A 2RGXA 2CL0X 4M2LA 5F9HA 2ZRNA 2BM0A 1KIMA 2HT1A 2P6NA 1SHKA 2D4HA 2FA9A 4PZYA 2VHJA 1BMFA 3ETLA 2BMJA 2FN4A 4DCNA 2HV8A 1T3SA 1E79D 3I92A 3JVUA 1XXHA 3UG7A 1VG9B 1QF9A 4QC2A 4D25A 2HYDA 4ZO4A 1KJWA 2IYTA 2BMFA 2JJ2D 1UKVY 3HU3A 4A9AA 6Q21A 3L82B 3IILA 3A6PC 2YNMA 2V6JA 3AEZA 4JLNA 3VNVA 2DWOA 1OW3B 5BN4A 4QBFA 3NTUA 4FMDF 1F60A 2BKEA 1NRJB 2Z4SA 1AGRA 2OILA 1US8A 2NQ2C 1P73A 1JAHA 2FE4A 1WE2A 2QGZA 4MRRA 3EIEA 4V0OA 1RC8A 2AK2A 1ZNXA 4IRUB 3S1AB 4DEYA 3W5IA 3ZDQA 3ZVRA 4TMVA 2GCNA 5JMTA 5E4FA 3H1TA 4TMWA 1DADA 1DVRA 2IYUA 4ZCLA 5IT5A 4JYBA 3SI7A 2H1LA 1UM8A 4Q18A 1P72A 4ZDJA 4GZLA 3SJZA 5FOSA 4LV5B 5JBQA 1Q1BA 5CK4A 1E1QD 2XOKD 2OSBA 3QF4B 1KSFX 2VSOA 1E9RA 3DZDA 4ZI3A 3NC1C 3T61A 3QVVA 5JI2E 4BFWA 5E3HA 3BC1A 3T5DA 5L3SA 1JR3A 4PX9A 3ADBA 4WZ6A 5LBIA 2CK3D 4WOPA 4Z8YA 2XB2A 3EW9A 1L2TA 3C5HA 2TMKA 2EQBA 2CCJA 2KI5A 4RZUA 2PL3A 2RAPA 1DELA 1GKIA 2BMEA 3AUXA 3MAAC 5KOYA 3AB3A 2JLQA 4NONA 2AKAB 5C4GB 2J0UB 5BWMA 4HAYA 3ADCA 2RHMA 1YRBA 2ONKA 1P6XA 4TYWA 4NCIA 1G8HA 4W7SA 1XEFA 2NO9A 2V6IA 1DEKA 1A2BA 3LV8A 2CL7X 4KLNA 3PUVA 2BIFA 2WWXA 2Q21A 3TUZC 4Q5IA 4ZPXA 1GRRA 1MABA 4JVMA 2OAQ1 1E98A 5FFMA 5FBQB 3WYAA 2YV5A 3SFVA 2K5UA 5JJKA 1XTSA 1T0HB 2CVHA 2IUUA 3ZZTA 1E9AA 1Z22A 4ZIRB 4Q9HA 1GL9B 2VHUA 2P67A 1QBKC 2J59A 1T3HA 2ZXUA 1OH6A 1KO1A 3QE0A 5AJWA 3QXJA 1T0JB 3U61B 1RPZA 2H92A 2Q9AA 2YC4C 1MABB 2O8BA 2R2AA 4POAA 2QL6A 2QSYA 3L2OB 5IK2A 4TLEA 2JLRA 1EXMA 3PV0A 4OHWA 3W8NA 2VEDA 3Q7PA 4DRZA 1G5TA 2J7KA 4Q21A 2O52A 2OV2A 1IY1A 4QGAA 1Z6TA 5AJZA 4UKDA 2C9YA 3FE2A 4Q4JB 2OBLA 4KODA 2WMOB 4PHTA 3B60A 3AGQA 2J0VA 2ECKA 2H17A 4PFSA 1CR4A 1QVRA 2IYLD 1QDEA 5SZHB 3BB3A 1JEDA 3WP0A 3CR8A 4LC1A 3WMGA 1XTJA 3GJ4A 5GVSA 2PT5A 4HAVA 1JPNA 3NH6A 1ZJ6A 2RGBA 1WB9A 3THWB 3MLEA 1AK2A 4LYHA 1E9EA 3BE4A 1AKEA 1VCMA 3H4MA 4LPSA 2O8DB 2GJ8A 2CHQA 1YR8A 1WXQA 1XTRA 5DH9A 1QHHA 4XWOA 3N2EA 4R9UC 3QY0A 2ZI4A 3GJ7A 4OI1A 2Z6VA 1OXTA 1E2LA 3SC3A 4B3GA 3RHFA 1KMQA 1T91A 5EP3A 5EP2A 4EKDA 4DJTA 1W0JD 1ZP6A 1OV4A 2JASA 2QG6A 2B8TA 2R6GA 2RGGA 3AVPA 4LSGA 2YWGA 1LF0A 1LF5A 3U44B 1SVMA 4ZDIA 3GLFE 1FNMA 1IHUA 1QHIA 4I1SA 1UKEA 4RKEA 2VP5A 2QT1A 1SULA 3AKEA 4MA4A 1GKUB 2Z5FA 3GD7A 3NH9A 4OJQA 4B2LA 2EFCB 4Q1FA 2PLRA 4R2IA 5TY0A 4L15A 1EG7A 4KFTA 3SYKA 3CRVA 2R6DA 3T1VA 2J45A 3EPKA 1T5LA 2J46A 4XIGS 1KO7A 1SXJB 1R0ZA 3KUDA 3SYNA 4D4MA 1W4CA 2EFGA 1XMJA 4A0RA 3AP3A 2QA5A 5KDLA 5HKKD 3V00A 2VP6A 3REGA 2QQEA 1G3RA 4Q00A 1G5PA 621PA 2B8WA 4WAUA 4ARZA 2IWHA 2MSDB 2BEKA 3DEFA 3ND8A 2RB4A 3CRQA 2R6CA 3QEJA 1M7GA 2DR3A 5DHAA 3TVDA 4BFUA 1N6NA 1TEXA 1EWRA 1F2UA 1KI8A 1N6IA 1N6PA 1LS6A 221PA 1S2MA 2ZTSA 1XTQA 3BS4A 3CF2A 1S0UA 3R20A 4FMDB 4Q9JA 3T1QA 1T6NA 4CRWB 2ZE8A 3RS4A 1OB2A 3FWYA 1E2HA 1OSNA 2WSSD 3C5CA 3PEVA 2BDTA 5F2EA 1E96A 3BAFA 4X8HA 5JCZA 1NLYA 2O5VA 4RD4A 1IJEA 2GJAA 2RH5A 1P62B 1RIFA 2DPXA 4RD1A 1L4YA 3C16C 1PLJA 5A5GA 1HV8A 4EPRA 4NPHA 4ESHA 5DHFA 1ZIPA 1W7AA 4LBZA 2ZS8A 4B3XA 4OQLA 4PZLA 1JEEA 5GADl 2O8FB 1RVDA 3MGCA 4QGGA 521PA 2VF8A 3B1ZA 3NDBB 2H5EA 5M04A 3CRMA 5FPKA 3ZGXA 1OFTA 2P0EA 3TQCA 2O8EB 4GSYA 2XX3A 2ZR0A 4JL8A 2VLIA 2OHFA 2AD1A 2C77A 2J0UA 1CR1A 2I3BA 3EZ2A 4PC3A 5CYOA 4AKEA 3DMDA 4MUBA 3HR7A 1IXZA 3WYGA 3ICQB 2A5JA 2OXRA 1E2KA 2ORVA 4C0AC 1ZNZA 3IQWA 2ZS7A 3RRNA 4XH9B 1YZUA 4URYR 1DOAA 3LNCA 5IHPA 4MUAA 1AKYA 3ZVNA 1KYIA 1KMHA 1NIJA 5HE9A 2IX3A 2C03A 1VG0B 4GPTA 1XPUA 1ZC4A 1G3QA 1NI3A 5LPNA 1GM5A 1HURA 4B43A 2HF9A 3B9PA 3R9WA 4U5XA 2C99A 4FWIB 4C7OB 2ZRJA 2VO1A 1S3SA 5CK5A 5F98A 1NVXQ 4HAWA 1GNPA 2LKDA 5HZHA 3WHKA 4TL6A 5EE0A 3QIAA 2ZJ2A 4LJ5A 4Q1AA 1OYYA 1R7RA 1TF2A 4A1FA 4ACBA 2FGKA 1GSIA 3FHTA 3VQTA 3IGFA 1TQ2A 2AK3A 3B6EA 4V0LA 1RRPA 5JS7A 4V02A 3QUSA 4RFSA 1CKEA 4LJ4A 2WJHA 2ZYUX 1ZIOA 2J41A 5FTMA 2ZJZA 1NF3A 2QAJA 4CEHB 4R98A 5CIWA 2I1VB 2WAXA 4RSGA 2IXFA 5K8TA 3DHWC 4JKIA 2V7QA 3CM0A 2V8OA 1V5WA 2ZE5A 2NO0A 5FPHA 4B2IA 2R9VA 5AJYA 1M74A 3RDPA 4AC9A 1XP8A 4TL7A 3QXXA 1P9WA 5HCNA 1CULC 3KKQA 1VCIA 2BMDA 2BCGY 4QBGB 2AD5A 2W6IA 5CB8A 5KHOC 2XGJA 2FFQA 2ZJ8A 3C4JA 5JHHB 2WPDA 4M8NE 2ATVA 4ZI2A 1DAIA 4OI2A 1U0LA 2B92A 1ZUNB 1T5IA 1XJQA 4QM6A 4EUNA 3CH4B 2GDJA 4FCTA 3EIHA 2HCJB 3DM9B 2PEYA 3ASYA 3QF7A 4MGYR 3VR6A 3CF6R 2IUTA 1EX7A 4Z51A 1F48A 1D9XA 3GJ6A 2D3WA 1E79A 2ZI6A 5EE5B 3THYA 4WXPA 4NCNA 1TMKA 4C0QC 4I81A 2J87A 4S35A 2XITA 5EXPA 1XX6A 3ZVMA 2ZU0C 1KAOA 5CM9C 1QG2A 2XJ4A 2ZITA 4CGZA 2Q6TA 4DIEA 4I1UA 1PLKA 2XSZA 4GBMA 5DN6A 3EC2A 4AKIA 4XVQA 1RZ3A 3KQHA 1R4AA 1Z07A 1YR6A 2QU8A 4GMXA 1EESA 2IS6A 2QAGC 1M7BA 4PHHA 4MKGA 2CNWD 3P4YA 4FCVA 1VECA 1IXRC 5KDDA 4B47A 5AUOB 2R62A 4DT1A 3RWMB 4JVSB 2O8EA 2OLJA 1LNZA 2GBLA 4Y0VA 1Q57A 4M9ZA 5GJBA 3H2YA 3RS0A 4CW7A 3AF1A 2KB0A 4LBWA 4V0NA 3VR4A 3GFTA 5J40A 1G4UR 2EU8A 4DCVA 1I2DA 3KTAA 1ZNYA 1N6OA 1XEXA 2R8RA 4BLSA 5H8WA 3AF0A 1E1RD 4LJYA 3DL0A 2WJVA 4LJ6A 1MR3F 5B30A 2YYZA 1KOFA 1NIPA 1WBDA 1Z0AA 2G1KA 4EJSA 4TYQA 1GL6A 1W4RA 1EFUA 2ZRLA 1F2UB 4I4LA 4RJLA 4A2WA 4O0MA 2W0MA 3FHCB 4LJ8A 1JECA 2O0JA 3VR2A 4Q9KA 5ANRB 2WJGA 4PQYA 1BS1A 1H8EA 2H16A 3LAWA 2WJYA 5DI3B 1IQPA 3VAAA 3KQKA 2DFTA 2W6JA 4PXAA 4MYTA 1KNQA 3JVVA 5DLQC 3WYFA 3DOEA 2GZAA 4GZMA 3WRXC 2QP9X 5EE1A 1SXJC 3K09C 1R10A 4FWTA 5L3SB 1LB1B 4KAXA 2XB4A 1I2MA 2FOLA 4HLCA 4GOJA 2QPAA 3KQNA 2QAGA 3BK7A 4Q47A 1ZVQA 1ZNWA 1Z0FA 2GBLC 2QPOA 2ZEJA 1U90A 4FXPA 5SZJA 5JWRA 1QHXA 2F7SA 3FKSA 3I1FA 5A0FA 2GNOA 4FMCB 4US0R 3E70C 1KDRA 1D2NA 3B78A 2R44A 2W2XA 1TQDA 1QHNA 4S2EA 2BC9A 1IN4A 1VKJA 5FBRB 4AKHA 1GILA 2BJVA 1G5RA 1US8B 2FJUA 3OZXA 1BYIA 4P33A 5C2JB 2GXAA 1M7HA 2BBWA 2OFOA 2ZYVX 1R5NA 1UDWA 2A5GA 2ZU6A 5HCIA 3LA6A 4QJ5A 3THYB 3LVQE 4LCBA 1E2GA 3QPWA 3EA5A 3LX8A 3GJ3A 1EK0A 2F1RA 3RS7A 1P9RA 2IS4A 2ODWA 5CDFE 5ELXA 3PEWA 1BOFA 2GEVA 4PAMA 2QRZA 4LJ9A 3RC8A 4TMXA 3DOFA 2ZM5A 4Q4HB 2QSZA 5EZ6B 2DHRA 3BBPA 2G83A 2YHSA 2ZI9A 5LB4A 1NLFA 4D4KA 3A4MA 3EWAA 4XOIA 2F43B 1GRQA 3RANA 4OHVA 4KSBA 4HAZA 1CR2A 1KK3A 1OIXA 1SVWA 2ZE6A 5J5CA 3HYRA 4IDNA 4Z8XA 3LBIA 3ZVLA 1IONA 2P5SA 3RLFA 1H8HD 1Z0DA 3MG9A 1UBFA 2JCSA 1S9DA 3OEEA 1K5GA 2IYSA 3O8CA 4TQUS 2QP3A 4G3XA 3OEHA 2YOGA 3KFXA 1Z2CA 2QT0A 3LD9A 3SZRA 3QEOA 2IHBA 1GDDA 3PUWA 1XNJA 4PHGA 5HPYB 4URVR 2BWJA 5JHGB 1KI7A 1SXJE 2QP4A 2AXNA 4F92B 1G291 4JLVA 1KK2A 4KVGA 4DLTA 1H8HA 1GUAA 3C15C 4GMDA 3K9LA 5CIQA 1E2JA 2IF0A 2ZVPX 2F1IA 2BCJQ 2WMNB 2D2FA 4C2UA 2IF2A 2X2FA 2QNRA 4EJSB 5FOTA 4BLQA 1OYWA 2J7PD 3K9NA 1WA5A 4JBWA 5HR5A 1XD2B 2KJQA 4O2RA 4PQFA 2AXPA 4AD8A 4DLWA 1DS6A 4HLUA 3T34A 2FG5A 1VMAA 1XEXB 1JAIA 2DBYA 3KTAB 2C5LA 2YWHA 3D3QA 2OCBA 1WMSA 4RD3A 3VNUA 2IYRA 1S4QA 1TADA 2O8BB 3QQ5A 3I32A 2IXGA 3QI2A 4W9MC 1PLLA 1D9ZA 4LGMA 4F4CA 2PJRA 4TMKA 4JYCA 2F6RA 2PZFA 1QVAA 2ZROA 1W46A 3PCRB 4E22A 3QBVA 5CLQA 4C0LA 5DSZA 5G41A 3MD0A 3ZD7A 1E6CA 2A5DA 4ESVA 1XZPA 4M4SA 1G8FA 1FW6A 4EPTA 5GJVC 4CEJA 2HF8A 3Q85A 5DGXA 1OHHD 2C96A 1NSFA 5G53C 4GI7A 1J8MF 1XCPA 2PX3A 2ZRGA 3IPYA 1E9BA 3C14C 4UJ5A 3VR3A 2QE7D 4YLGA 2JLXA 4BFXA 2WKQA 4DLZA 5J4VA 1G3UA 1UJ2A 1E9CA 2OG2A 4HDQB 2BV3A 4R2HA 5J4LA 2PX0A 2W6JD 3MMPA 2NPFA 3LFUA 2VHCA 2W2TA 3HPQA 3PQCA 2FNAA 5DE3A 3KDSE 3ZD6A 3FMOB 2PZEA 3RRYA 4DIDA 5FTLA 4TYYA 5FTJA 3SFZA 1TUIA 4L8GA 1KJYA 3WHLA 3L8ZA 1OIWA 5BW8A 4TT3D 4Q02A 5BYJA 2HLDD 3C41J 3F3YA 3QF4A 5DO9A 5E7MA 1ZINA 4D0LB 1COWA 1NVVQ 1KNXA 1YR7A 4IOJA 4JLBA 4IDOA 1RFLA 4Q4AB 1FOEB 5FL7D 4Q66C 5TDHA 3VTKA 1II8A 1G3IA 2ODNA 3EG5A 3TMKA 2RGAA 4WZAE 1WBBA 1Q12A 1J2JA 2ASEA 4D4JA 4IFBA 3HPRA 1TL7C 1E9SA 3PEUA 3WNDA 1KSHA 1CF4A 4LZZA 4ZDWA 4FD2A 3AV0B 1SHZA 3KB2A 5AUQA 1OB5A 2JJ1A 2WVJA 2P65A 1N0UA 5C18A 1LW7A 4UJ3A 3O8RA 1T4GA 1XCGB 4PANA 1XMSA 3NWJA 3QKRB 3KB1A 1AQYA 4LHWA 4QG7A 3H84A 1Z8FA 4JVNA 3WNBA 3BXZA 4N0DA 2DYKA 1B0UA 1AGPA 2OBNA 2OM2A 3V4FA 1G41A 3ZYCA 2BOVA 1VDZA 3JZMA 4KI0A 3BFVA 1FX0B 3GFPA 1EFRA 4K81B 1W2GA 5UKDA 3LW7A 2GCOA 5EP1A 2MMCA 3AVOA 4QKQA 3NEJA 1CXZA 1G21E 1DAEA 2CBZA 1UPTA 4TZ6A 2QN6A 2WKRA 2D7CA 1FL9A 4MDFA 1O3YA 4XWKA 5KYKA 3GPLA 1KO4A 5JJIA 1JJ7A 5EZ5A 1MRNA 1A2KC 3OIUA 1IN8A 4NBSA 2QQ0A 4M1TA 4LYAA 2Q9CA 3B1VA 4DDUA 4TQ9A 1NJGA 2OESA 5CDFA 1KKLA 2H57A 3B9QA 1AS2A 3QSYA 3I4LA 4MGZR 1XB2A 4B73A 3HYTA 2P6RA 4DCUA 2ERXA 3X1DA 2YZ2A 3PUZA 4E07A 4QHTA 3A1WA 1KI9A 1KKMA 1PJRA 2FZ4A 5AR1A 2D06A 1QG4A 3IEVA 4XJXA 5LDDC 2YC2C 3GCGA 2JLZA 1G19A 4PPGA 2ZR7A 4LJAA 5B64A 2GAAA 2GXQA 4HB3A 2WPDD 4NCHA 2OUKA 1Q20A 1S9HA 2GHIA 4BEJA 3B2EA 4LK2A 3U60B 2X19A 1U9IC 5FR1A 4EPWA 4U7DA 3RYTC 3OAAA 2WSSA 2ZSDA 4B3DA 3X1ZA 1JB1A 1PZNA 2H7VA 4YXWD 4URUR 4XD7D 1II0A 4W5JA 2OCYC 2OXCA 1QHHB 3SYLA 5GJCA 1IXSB 1XPRA 2AWOA 5DIFA 1NP6A 2DFLA 4O3MA 1EFTA 1TQ4A 4UNSA 3TLXA 2ZRMA 2RGEA 4QJ3A 2ZRFA 1KJZA 1AIPA 2C9OA 2OLKA 1Q1ZA 1TAGA 3FKQA 1NVWQ 4M1SA 1GITA 2XNDD 1E69A 1DO2A 2G88A 4JSTA 4M21A 4A82A 1S1MA 4OI0A 2GJSA 3P27A 1KI6B 1RKBA 3TSWA 1AS3A 3H86A 3UWOA 1C4OA 4P4TA 1SXJA 3K09A 1LS1A 3OFND 4JLKA 4PR0A 1Y63A 3TJZA 1JXOA 4DT1B 3LRPA 2CMKA 3ONWA 4E09A 3UPUA 1LV7A 1P2VA 2FV8A 4DLYA 5DYIA 1KI1A 2JJ2A 4M1MA 1KY3A 3ZJYA 4Q4HA 2P3SA 2NGRA 2XZLA 4AKGA 3OIVA 1R6BX 1VG1A 3RC3A 4DB4A 4HI0E 4C2TA 3LBNA 1G17A 1FX0A 2XTZA 3TH5A 3NBFA 4GRAA 3B5JA 3EPJA 2UZIR 3LDAA 2DFNA 1E0AA 3M4YA 2EYUA 5FUWA 2A3RA 5E7JA 1N6KA 1CTQA 1N6HA 1QHGA 2L0XA 1UKZA 2Q3HA 1XDBA 4NL4H 5JEEA 3QXCA 2Q9BA 4IXNA 1B23P 1G7SA 2F1HA 2FH5B 2ZSFA 4QXAA 2O8DA 1G1MA 3LVRE 3D31A 4AIIA 5JECA 1AZTA 2IEZA 1GL7A 2FFAA 4UNNA 4QM7A 2J1LA 4PPNA 2ZUDA 4DC9A 3QG1A 3RRZA 2DFKB 2FPMA 2ZPTX 1AS0A 3X1XA 1GNQA 1UF9A 1GKYA 2NO6A 4MITA 4NYJR 2A30A 3IDQA 5A4JA 4AYWA 1UEJA 3VKWA 3AVWA 2CHGA 4A0FA 5F9FA 1XBTA 3K1JA 4RVCA 4ARZB 1E2DA 3BH0A 4URZR 3FDIA 4X8MA 2NZJA 2I4IA 2PEZA 4TTRA 3SBDA 2N46A 2IS1A 4ERNA 4WBSA 1UEIA 3BH7A 4QHYA 1VYUA 1E4YA 2AKYA 3CX6A 4KCGA 3UMFA 1NN0A 1R2QA 1TQ6A 1A4RA 1NL3A 1FUUA 4UXJA 5FR2A 1E2PA 2JATA 3KJHA 4C0KA 2F9LA 4BZQA 2GTPA 1P2UA 3EWSA 1ZW6A 3QKSB 3QPUA 1NLZA 5CB6A 2FPKA 1GAJA 2XOKA 2Y8EA 1OH8A 1P60A 2GAOA 2UKDA 3M6AA 2H8KA 1H8ED 3AF3A 2VF7A 4Q7LA 4RFVA 1KSJA 1OH5A 2WTUA 3QKRA 1CU1A 1G20E 3N2IA 1TF5A 1SKYE 3AP2A 4JT2A 1X8LA 3Q7QA 1JXMA 4H1VA 5EUQB 1FTSA 1OXSC 4TQAA 3O8DA 1YJ5A 2ZJOA 4YXWA 4KBGA 2GXSA 3CZPA 4JT4A 1P5ZB 4JL6A 2GWHA 3MWJA 4C4PA 3B1XA 4P0TA 4C0HA 4EFMA 1UAAA 2WWYA 1NN3A 4JVLA 3LLUA 1NN5A 3FTQA 5EQTA 2DWQA 1MKYA 5KDOA 4CEIB 1Q22A 3NHAA 3P1JA 1ZM9A 3LWNA 1FNNA 2YVUA 2V1UA 1G8GA 4EJSC 1Q21A 2QZ4A 3BJIC 3TSOA 2F43A 2G0TA 3NBYC 3PFIA 5BN3A 1J99A 5D3MB 1F6BA 1ZM4A 4LI0A 3WXMA 3K70C 4AI6A 5FL3A 4JLMA 1HT2E 2GF9A 4Q1CA 4TMZA 2A5FA 3B85A 1ZRHA 3CLVA 4OQFA 5JRJA 2W2VA 3A4NA 5FUVA 1R8QA 4MGKR 4D6PA 1S96A 5H1YA 2JLVA 4EPXA 4RZ2A 4OJKA 4IW3B 2LKCA 3Q72A 1EFHA 1WDTA 4OL0A 1F3OA 3QOFA 1DAGA 4P3YA 4L9SA 1U99A 4LHYA 3LH5A 4GL2A 2ZUCA 1BIFA 1E2QA 4IDQA 2ZI5A 5AUPB 1X86B 2IYZA 1DG3A 4B3FX 2C2HA 3HR8A 2C04A 2ZYWX 5TB5A 5KSZA 1I4LD 1DAMA 4G1UC 3GLHE 4IOKA 1IY0A 2CXXA 3M0EA 5G3ZA 1CS4C 4A92A 1YU9A 3W90A 1W49A 3CNOA 2FZLA 2VL7A 3KFVA 4FMBB 1OH7A 4A0HA 1HTWA 3EPLA 1GP2A 2PMKA 3EZ9A 3PVSA 4RD0A 5JS8A 4YMWA 4LRWA 4QOSA 3AVUA 2VHQA 1G7RA 1L7VC 3W6OA 4ASUD 2IT1A 3W6NA 5KU1A 1N6LA 2R6FA 3CRW1 2RGNC 3FMIA 3KQLA 1NBME 3BIFA 1DARA 4OKSA 4H9GA 2NZ8A 3TQFA 1UFQA 3K70D 1MO6A 3B13B 2Q0HA 3T1OA 4BE7B 3U3JA 1S8FA 1RJ9B 2WHXA 4KLZA 4BFYA 5KSYA 5EE3A 3U2QA 3CPHA 2E87A 5FUYA 2O8CA 1NBMA 4A36A 3MFYA 3VU9B 2IEYA 4MYUA 4XTCS 2VIIA 1ZBDA 2XTNA 2G3YA 4B75A 1V43A 4MH0R 3IO5A 1GTVA 1YZKA 2CDNA 3CW2A 2CLDX 3L8YA 2GF0A 2VPPA 1VHTA 4Y0AA 4P4SB 3RAPR 4F93B 1R5BA 1YE8A 1CP2A 2CE2X 2FWRA 3SBEA 3GQBA 2WICA 1HE8B 4GOXA 4MRNA 2EWVA 1OKKA 2H18A 2FU5C 4F91B 3GLGA 4BQSA 3G0HA 2PT7A 2D74A 3ZIAA 4AWXA 4Q4LA 3K0FB 4NH0A 2ANCA 4C0BA 1HT1E 3U4QA 2ODEA 1BH2A 3HU2A 3ZZUA 1FPMA 3R7WB 3EXAA 1XD8A 1DAFA 3TE6A 2O8CB 3L43A 4TLAA 3ADDA 1OXVA 3A36A 5BXQC 2PH1A 2ZSBA 4TL8A 2PJZA 3GLHB 4DWJA 3U7FB 3BFKA 1U81A 4MKHA 4Q1EA 4B32A 1GZSA 2BM1A 4CIDA 4DLRA 1D2MA 1IN7A 4Q7KA 4Z54A 3W5JA 4ZV4A 1W0KA 3EASA 1N25A 4TT3A 2J9RA 4V03A 5SZKB 1W44A 1G8YA 3TNFA 3AH8A 1G6HA 4AK9A 3THOA 3U44A 1XTKA 2QEQA 4D0GA 1C1YA 3CX8A 1M8PA 3NC0C 3R9IA 3NG1A 4HDOB 1MH1A 1W0KD 3A8TA 4XVRA 4ZCMA 2WZQA 4HAXA 4HB4A 3RSOA 1KGDA 5DI9A 3TKLA 3U3OA 2ZJBA 5TARA 2MSEB 4ACAA 1G4AE 1AJEA 1MV5A 1UBEA 3ADKA 4HDCA 4DZZA 3V4RA 3U7HB 3QNUA 3MWKA 1GVNB 1QHSA 1SKQA 3DM5A 1E0KA 3WBKA 3KQUA 2WWFA 3KL4A 4BLOA 1D8TA 3WNCA 2V3CC 4JJKA 2PZGA 1DPFA 1CR0A 2RCNA 3MCAA 5KNDA 5KSOA 1RYFA 3KJEA 4F4IA 4B6FA 2KE5A 1XWIA 1KZ7B 3ZZ0A 1BO6A 3GJ5A 3VHXA 4Q19A 2V4ZA 1W47A 5EXSA 1T3LA 5IRCD 4MRPA 4WIAA 4EQ6A 4C7OA 5G40A 1SKYB 1N2CE 5L3VA 2E9SA 4A6PA 2KBFA 1FP6A 4JLAA 1JPJA 2IYQA 5P21A 5AWFC 2VSFA 3AVVA 2ZJAA 2GVZC 3TR0A 1OF1A 3BFXA 3UATA 821PA 1EFCA 2LWIA 1W0JA 1TF7A 4DSUA 4KYIB 1N3BA 5DISB 3SQXA 1FZQA 4Q7JB 3IHWA 2RGDA 4D4LA 4I99A 2CK3A 5CITA 1X8JA 3AF4A 3TW4A 2JLYA 2NO7A 3AQ4A 2GEDA 5KPJA 4NKRA 4F7WA 3UK6A 2GK7A 4X8LA 3FPAA 3RRMA 3CBQA 4OHYA 3DPUA 2VA8A 3PUXA 1XTIA 1EFRD 1CLUA 4HYYA 1KMHB 3R8FA 1W1WA 2X8AA 3AKYA 3F5FA 3VKGA 3QKSA 1W2HA 3LW8A 4HUTA 3B8HA 4UNRA 2UVQA 5JWOA 2I1QA 3OHMA 3OAAD 4A8JB 2DB3A 3AVXA 1X8KA 1NMYA 3MRSA 1XZQA 1JR6A 1GWNA 4NCJA 5FH9A 2P2LA 3Q5EA 3SDZA 2Q3MA 4PO9A 3TAHA 3THWA 1QHYA 2FSIA 1HQCA 2QMEA 1OFUX 2XTMA 2WWWA 3I73A 3VR1A 3W9YA 5F3WB 5IK2D 5IDVA 4DCSA 2BEJA 1E32A 1WCV1 3C7KA 4EIWA 1NKSA 1W48A 2JEOA 2W83A 1L4UA 4MYHA 4R7ZA 4BASA 3ASZA 1O87A 5TMPA 1ZD1A 1TTTA 1T9HA 3AP1A 4FI3C 3OESA 1VTKA 4L5BA 1DAHA 5B57C 4HAUA 1TEVA 2OO7A 4OHZA 2AN9A 2BBOA 2D2EA 3AVQA 4DLVA 2DWPA 3GLFA 4HB2A 4BRWA 3SQWA 3LY5A 3SHWA 3TIFA 2C95A 2WWIA 2ZRAA 4YMUA 1I4TD 3IIJA 3ECCA 2VSXA 1U2RA 3QKUA 1N0VC 4RCZA 3T06B 1N6RA 1KI6A 1HY3A 3K0AA 4K8OA 4XVUA 5AK0A 3U5ZB 2YOHA 1Z06A 1U9IA 1VHLA 2QTVB 1E2IA 2QGNA 4B2PA 4R71A 4Q4AA 3D7MA 1AZSC 1TU4A 2WOOA 2WV9A 1J7KA 2QY9A 3LX5A 2RKOA 4IKEA 1H65A 4TL9A 5BQ5A 1HE1C
chains in the Genus database with same CATH superfamily
3LDFA 4DADA 1Y6GA 3I8SA 4HWRA 2REBA 4G5XA 4BNTA 3U09A 4FPXA 3R3WA 3NHLA 4IHJB 1LVGA 4M98A 3S2EA 3VGJA 1PR5A 4F11A 3Q0IA 5KQLA 4RMHA 2G76A 1Z8NA 2QTFA 5I7WA 1HL3A 2RI6A 3SS7X 3F5DA 3Q7TA 3O2JA 4GVXA 3VVMA 2OO3A 3MWEA 2QK4A 3ZE8A 5D3ZA 1DBPA 1L8QA 3RBZA 2VNIA 3HVRA 3LKBA 3ZDFA 4F8JA 4OHBA 1H4SA 3AHHA 3GJZA 3AIMA 1PTJA 4WKPA 5JSZA 5BW5A 2GERA 5JXIA 5I7OA 5J4KA 4QBIA 4IHJA 2B3DA 2X0JA 5SYAA 1JYSA 4V1CB 3EOBI 1WP9A 3ZHRA 4KQWA 4CCAA 1ZDMA 4IJ6A 1Q0LA 2PUDA 4E5UA 4B6RA 4JKYA 3DLPX 4LI3X 5K0NA 3OMWA 5C34B 4PLTA 2DOKA 4X7BA 3BD6A 5KVVA 1SVNA 3DGEC 4HUQB 5IC6A 5DGDA 1E3LA 1VOTA 2FWAA 4TSKA 4J0GA 3R9KA 3L7KA 1X0XA 2OLEA 4N82A 2YS7A 2XBLA 2IZOA 4M6WA 1PK7A 2AEEA 2VSYA 2ZUUA 3Q8KA 4GP9A 4G1FA 1HNZB 1JQBA 3R4VA 4KFUA 4NHOA 1E1LA 2JDID 1M1YE 3BGIA 4RK1A 4A0GA 3UMSA 3PGA1 4KXMA 4BNDB 3A4LA 4GNKA 4AIRA 3TSCA 3PK0A 2QW1A 3WICA 1THTA 4GDFA 3PVCA 4RVFA 2IWRA 3SN6A 1VKHA 2HHCA 4B3JA 1XC7A 2JI6A 3F1LA 3MGGA 5I5EA 5JASA 1RD4A 2GHQA 1T9BA 4PYLA 3W34A 5B36A 5FEUA 2YHBA 1PR3A 1ONBA 4PVCA 1AT1A 5FWXB 5LOVB 3WYEA 2UZAA 2GPYA 2QORA 3UANA 5DTRA 1F4LA 4BDSA 4GPBA 1FLVA 1NBMD 2FX5A 3D1LA 2YNMC 2R6ZA 4M8KA 3ZJUA 1PO7A 3AESA 4PC1A 5H68A 4DVGA 5CLLA 3RC2A 3WG9A 3QJGA 4IR7A 5EP4A 2OHOA 2M6LA 1N5LA 1L1QA 2XVZA 5ICCA 5CM2Z 5JS1A 2VTVA 1MO5A 1R5OA 2X2PA 4JB2A 2XHEA 3HKCA 1C2YA 3P9PA 4JFAA 1JH9A 2A7QA 4AO6A 2G25A 2VPTA 1HH4A 1EWKA 3IIEA 4YC7A 2I8AA 2FTKE 1QHFA 1LQ2A 2X22A 1X7WB 3B3JA 4IOMA 4PGHA 1JIJA 1CPYA 3CEMA 4GMFA 3R23A 3GEDA 5IBRA 4YJFA 3B3AA 4UHJA 1XVUA 2C0CA 5AK6A 3GB9A 4DQ0A 2OK8A 2EWWA 3DR3A 1RBQA 4IEEA 3N2YA 5TVKA 2C4MA 3LQRA 1JDPA 2FR0A 3EH2A 3ETGA 1M66A 1N5KA 2REOA 4M9QA 2REXB 4EY7A 3LQ1A 3QE9Y 2H06A 2VC2B 4UUBA 1J5XA 1ISGA 4OQXA 4Z86A 5H59A 5HFJA 3L7IA 1N1EA 4P3PA 1DEOA 1SWVA 2W0SA 3VZQA 1R9MA 1W29A 4R0VA 4H27A 2CBGA 2WHQA 5TPZA 3WK5A 3AWIA 4ZVLA 1MT0A 3INTA 5A6SB 5K0ZA 4PC6A 1A9ZA 1COWD 1UJNA 1ZESA 4HCJA 5J9FA 1Q3TA 3GFOA 3HABA 2IQ5A 1U8XX 3THWA 3T4EA 2DQKA 5EVJA 4JJZA 4KZKA 3UWPA 4L4UA 2H29A 3HDTA 4JIMA 4DNFA 3PE4A 1T13A 3QPCA 1N32B 2PRZA 3H6KA 3L6UA 3QX9A 2Q0SA 3D4IA 5IM4A 3KEMA 3D8UA 1LVHA 1QIIA 2C9ZA 3K1AA 1KXZA 2O0KA 3DBLA 3KQYA 3PR1A 4DLUA 2O5CA 2NMVA 3LLMA 3ZBTA 1FJ2A 3SHVA 4YJ3B 2J3QA 2R4QA 1VCNA 4C7JA 3FZEA 3GROA 1FUKA 1OTHA 4FNOA 4W8GA 2XDWA 2QXYA 4G5QA 1AGNA 5ICFA 5CAEB 1CY7A 4IUBS 3FJYA 3HU1A 1J9EA 3OOJA 2CYAA 5EY5B 4IZIA 4F84A 1B1AA 1VI6A 4FK8A 4CDGA 3HBLA 3WRVA 2FX3A 3NBAA 5BRAA 3AUYA 3HP1A 4J7CA 4RKFA 1IZ0A 1SKUA 3GRAA 2V7QD 1Y3AA 2HNBA 3G2OA 2GA8A 1EJ6A 2QE7A 5TXGA 3KSZO 4M22A 2PYDA 4DSTA 2K7ZA 3AVTA 1G64A 2QLNA 1RQNA 4G0MA 2J9XB 2ID9A 3RO7A 3AZQA 4DJ5X 1E58A 2PD3A 1GN8A 2H2IA 1BDHA 1RE0A 2V6MA 4B8YA 4PZZA 5B3LA 1JQLB 1X38A 3R40A 4OMFG 4U7JA 5FOVA 1F7VA 5TLSA 3PD1A 2HQOA 2Q28A 1ZN7A 3OQVA 2YMMA 3CR3C 4L9RA 4OQQA 1QTNA 2Q1SA 2NVUB 4BGDA 1DKRA 3ZDCA 2FQWA 3OZWA 1II9A 3VX3A 1Y5IA 3I1YA 5ALHA 1X14A 2GS9A 3NJ8A 4AF8A 4D9JA 3VSDA 4E4YA 4RTKA 3SEFA 1FSSA 2QL5A 3AG6A 3AFGA 4ZKDA 3JU3A 1N5IA 4TWZA 3FNBA 2SBTA 2HM7A 4AVYA 1NN1A 1DP4A 1ULHA 2J30A 2ORED 3SJCA 1APBA 1T34A 4CMIB 3CO5A 2H2DA 2WZCA 1VG8A 4HMQA 4OEHA 3EPRA 1TEHA 2Y1CA 4V0MA 2NPIA 3OZIA 3IOMA 4IXMA 4YQFA 2H7CA 3RKUA 3I12A 2PUFA 1UOPA 5DWQA 3FGPA 4L2IA 3ND9A 2B1IA 5D3QA 2DY1A 3TOXA 2ZSEA 5KNLA 4DQXA 2HQSA 3DW1X 5HKOA 4EQ6B 2ZDGA 4Q3EA 1J4AA 4HATA 4M60A 4M49A 1ZGGA 4M0LA 1BDJA 4FE3A 3OU6A 1EX1A 1OFHA 4UMEA 3UCEA 3FHOA 3U9LA 5I45A 4HWGA 2GN9A 4EWLA 3GJXC 2IGBA 2SKEA 1JJVA 1GKLA 2PD4A 2ZB2A 3DQQA 3K6KA 2PFKA 3H6GA 4TXNA 2Z8XA 1CZRA 2OGWA 5HBRA 3TR6A 3R8CA 1J90A 1IAQA 4QODA 5CTJA 3IP9A 3DAYA 3VFDA 3ORHA 2A57A 2ZI3A 5ABPA 1G3MA 1PNQA 4NFHA 4A8PA 1IBMB 3O31A 4N41A 2W93A 3QXHA 2OGTA 2V97A 5HYVA 1YVDA 4X1IA 4YHHB 1W8DA 3C3AA 4Z99A 4Q1BA 4RPKA 5KNBA 3PTAA 3E23A 5LZ5A 4EP1A 2GETA 2WJAA 1P9OA 1BJKA 4ZT5A 3OPNA 5FO0A 3ZN2A 5BR7A 4UBLA 1GGHA 2HU5A 4DC1A 4E21A 4P2BA 3RUHA 3RV3A 2ZS9A 2Q5EA 4M55A 1E2NA 2Q62A 5CW1A 3UAYA 2JH3A 4J0FA 4LJSA 1K2VN 5DBHX 4FUTA 3QI7A 5LP6F 5ICGA 2C8VA 3R6GA 5KU7A 4UVGA 1Z6GA 4G01B 1Z5OA 1FYEA 4LUCA 4XYBA 2D5AA 5TMDA 1OPXA 4DLAA 4RORA 1OH8A 1CUZA 3Q5DA 2C5AA 3O38A 4M1YA 4M9UA 1RQ2A 4CVNA 1GXSB 2P4HX 3GGJA 3OM8A 1NKVA 3BMOA 4NP6A 3SNHA 1PVOA 1HLPA 1Z4OA 3KLBA 3VPSA 3THXB 3HP4A 5E6RA 1HTTA 5IZCC 4LSZA 3G5UA 3FI0A 1CDOA 4D1YA 3BORA 4DMKA 3WGOA 3F6BX 1FW8A 1E2EA 1F14A 1KEPA 1DQPA 2C9CA 2XLBA 3ETDA 3KPWA 4FHGA 2Y1LA 5IVIA 4B46A 4BCBA 3CX3A 4QBHA 4WOKA 1RKQA 3SIWA 3SU8A 2YHUA 3CZ9A 1G6Q1 5CT5A 4BLTA 1YZQA 1DIOB 4LISA 2RCYA 5HQTA 6CHYA 1P75A 1RHJA 2ILVA 3CZQA 1E7YA 3PP8A 5HUQA 5JCOC 1LY1A 5AP9A 4ID9A 4RGBA 4L5JA 1U98A 4PNPA 2ROQA 4RENA 3Q9SA 1Z36A 2AFIE 4X6XA 1SBNE 1WUKS 1LPSA 3VDRA 3V9PA 4ARIA 3AG5A 5T3UA 1ZLYA 5FQNA 5EA2A 4D4GA 3SJBA 5FAKA 1JR3E 5GONF 1ICIA 2DHEA 2JIZD 4JBNA 1BKSB 1XMPA 5IJ9A 2XCIA 1EWQA 3AMVA 1QRRA 1SQ5A 5K3BA 3ZNPA 3UT6A 3T5PA 1DDIA 3DPSA 1RT9A 1Z5GA 2BGJA 3FFBA 3Q9LA 2D54A 4KN9S 3RH0A 3STTA 1CUSA 2VH5R 1Y7TA 1NZFA 2YQ5A 3A1UA 3NIBA 3VR6D 2Q5QA 3MINA 3M1LA 1DINA 5B58C 3K6RA 3TLGA 2A2ZA 3T7JA 4BVKA 4BRUA 3NPMA 1ISIA 1L6RA 1YBVA 5I7AA 1PEKE 3T1NA 5JSFA 2ZZMA 3PUYA 2A5YB 2KMLA 3DOOA 5AKGA 1RRMA 5FFFA 4DUGD 3GGSA 3NHUA 1L7PA 4YQEA 2HEIA 4IEIA 4FDLA 4RTRA 3B51X 1U3WA 1W9MA 4PM4A 2FVYA 4TLLB 3AM4A 3FKSD 1BN7A 3SXPA 1QH1B 2ZBPA 3I9OA 3KC2A 3KR9A 1JQJC 4PYOA 4TM7A 4O25A 2VJMB 1HPLA 1SC3A 2NSYA 1U02A 2WJPA 3QE3A 2PBZA 1D1SA 4FOSA 1ONSA 1ZVKA 4Q9NA 4NYMR 2B69A 4E2WA 3CR7A 1HSZA 2HJGA 5EWLA 3WMFA 4FN5A 3K70B 5BMVA 4OK6A 4EYQA 5KNBH 1UKBA 1VJTA 3DMGA 5EJAA 2OCKA 2G0NA 4D9KA 4E1AA 4ZQCB 8ATCA 4UREA 4GYKA 1J20A 2HMTA 2EF1A 3OJ0A 3ZS8A 3FRIA 2VPXA 3N3BC 4CKZA 5DHTA 4F5DA 3T3EA 3LUHA 4PSKA 3KKMA 3V7UA 1GDHA 1UEXC 1WUYA 3OU7A 1WQ1R 4MMZB 5F21A 3FSRA 1Y8RA 4BFZA 1B14A 1PK8A 1HYBA 1ZYUA 3B7PA 4O6VA 4AMVA 1DU4A 1PFKA 4CM5A 4DXAA 1ZU4A 2AN1A 1SCKA 4P2GA 1W36B 1QQ6A 2QTCA 2ZRHA 3PUIA 1W96A 5IYZF 3T5BA 1GG9A 8ADHA 1V39A 1J56A 5DM60 2HR1A 1A5ZA 4FFBB 1WF3A 2HTFA 2AIRA 3FYUC 2PMBA 4KU4A 2GZ1A 1E2MA 3MWDB 1TPZA 2GBGA 4P22A 1ACLA 1QIFA 2D5LA 4RETA 3U9TA 4XYLA 2VQ3A 4I1IA 4ZEXA 3OQHA 3ZHQA 1RLIA 4C01A 3WYBA 4AMBA 5AHWA 1NPDA 3QM1A 4KYUA 4XZ3A 3ETHA 4MS4B 4Z7JA 5JARA 4LG1A 2V4UA 3FPFA 4MW4A 1CLEA 4RIFA 4L75A 3LCVB 4WL0A 5KPDA 3U3KA 5FBLB 1LSJA 4LXTA 3REQA 2BDUA 1KBZA 2XE4A 3E5MA 2WV7A 8OHMA 3BE6A 2QBYA 3C8DA 3KSDO 5G4KA 4MXDA 5I5GA 5JNRA 3HCEA 2OGZA 3DKPA 2YV2A 1OHHA 1S1CA 1KK0A 1WHTA 3OETA 4I0WB 5LD2B 2XBMA 3VYVA 1W5AA 3I9FA 5GV8A 5REQA 1K7SN 3HA3A 3UMRA 2P11A 3FHLA 5JAMA 2NVBA 1Z6XA 2OFWA 1U7ZA 4M8SA 4ZRDA 4BBAA 4XLZA 2VP2A 2OAP1 1X6VA 2RDMA 1FXUA 3FN4A 1M0SA 1G66A 2ECFA 4II7A 4M1KA 3KQPA 4LPKA 4S3MA 1ZR2A 3QU5A 2G77B 1KDPA 1C7EA 1RW4A 3WMEA 4J16A 2CHEA 3V4OA 1N7GA 4B3HA 2V7VA 4KH0A 4QFMA 4BJ3A 3RG8A 1MFPA 4ZCRA 1AE1A 1F4PA 1Q11A 4X3OA 3RYIA 1MW9X 3K6SA 5KO2A 4CG3A 1TO1E 3CH6A 4KV9A 1JQAA 5K4GA 4AROA 4TRMA 4IDGA 1EWTA 2HRQA 2VZEA 3ELYA 3EXG1 3J81k 3URKA 1C30B 1QVZA 1BHJA 3N8GA 4Q37A 4DJDC 2YWFA 3MJEA 3HSKA 4QDTA 5LXTA 3RIXA 4Q1DA 1ZOIA 3BK1A 1J2UA 5BT9A 4EF4A 4NG4A 4MRVA 4KJZA 1P0IA 3S4YA 5JSZB 2BHRA 4QNRA 4YO7A 1XEWX 4LXYA 3DEHA 2OQVA 4AMYA 5GV7A 2GJKA 3RVOA 1FP7A 3GCDA 2C5HA 2PGDA 1FQKA 1BZYA 2W00A 4H6VA 5IF9A 3ZQ6A 4PZPA 3QPBA 3GLIA 3DAFA 4LMPA 2XDAA 1YF3A 1SM4A 1YZNA 2FFHA 4RZHA 5T64A 1V2GA 5JDIA 2IRWA 4KWHA 2P3OA 1G18A 1FFGA 3MS4A 3ET5A 5KYTA 3T5TA 4C5AA 4DDVA 1OQAA 1XZJA 2X13A 2P77A 3DP9A 3AKCA 3MGKA 4HX5A 4XWTA 1X80B 2B7CA 2FETA 2RARA 3SD7A 3UG6A 1HKHA 2Y68A 3AW8A 3UB4A 1HXHA 1Q0UA 1VCOA 4ZVUA 4DBLE 2Z2XA 1O7JA 3HKEA 1FQJA 4WESB 3WGGA 1GAWA 4KV7A 1FFXB 2E85A 2IYVA 3BGVA 3D2BA 3OO0A 3O8OB 1LDGA 1GRCA 1NLMA 1L7XA 1BRTA 4NDZA 5C1BA 13PKA 1LV8A 2ZKIA 3PUHA 4RD2A 2OCAA 3TVTA 2AMFA 3B3FA 1TZCA 5KHLB 5LD2C 1JDZA 3WC4A 3FUVA 1L7NA 1F0YA 3Q88A 1T8SA 3IMCA 1J9ZA 4OYHA 1DRUA 4R8VA 1TMYA 3KX2A 2VTKA 3LHIA 4F1JA 2HHHB 4C6TA 4G2NA 4XW2A 4EG1A 3H2BA 1CEYA 4Q7MB 3IUPA 1U7DA 1RMQA 3ZV4A 1G5FA 2D1FA 1OT5A 2GNPA 4R69A 6PFKA 1Z8HA 5L51A 4PHFA 1OROA 1JR3D 1PL0A 1I14A 4URWR 4MOWA 3H2JA 5E1MA 1T5TA 2B3TA 1H5UA 1CJUC 3M5DA 4AURA 3U1BA 4H4EA 4HGNA 5E0OA 5AJXA 4MQEA 1I3KA 4H59A 3D0OA 3QU7A 3LT2A 3AUFA 2JZOA 3X1WA 4CQLA 1WM1A 4OH7A 1Z4IA 2QM3A 1AM4D 2QIOA 2H1OA 2AN5A 2HO4A 4HLUC 1PT5A 4YP7A 1IN5A 4KVZA 2D62A 3LT5A 4K7JA 4PLYA 5DCUA 3WKCA 4QEKA 2EVWX 2RHLA 2PD6A 3SHFA 1ZVMA 4J16C 3MYRA 5JRDS 1UMKA 2Z98A 1J09A 3DLAA 1XD9A 1JSCA 2BGKA 4LHVA 4F9FA 1DTEA 4AF7A 2IYAA 3TG2A 2WHRA 3EDMA 4DJJA 2P2SA 5EXDA 4ENPA 2Q1XA 4FN4A 4IJ5A 2LDBA 4L4YA 3CCBA 4H1UA 5JT1A 2O54A 5IAAA 1CUWA 3RE1A 2QENA 4LBVA 4H7JA 3MAGA 4UAVA 2Z0MA 3A1FA 3REOA 4U4AA 5CAEA 5FBKA 4Z3DA 3V48A 1ZMXA 1M34A 1YRAA 3JQ6A 3PC3A 3KOOA 3AI2A 3WB2A 5DP2A 1YB7A 4M0EA 4WINA 4O08A 1X42A 1MRZA 3ER6A 3G5AA 3LLCA 3JQBC 3UT5B 2CV1A 1Y3BE 2XNKA 4PLZA 3SJAA 3ZH2A 3F78A 4OFBA 2CFRA 4FFMA 3AB8A 3I2JA 2CLCX 4GXNA 4J1NA 3G17A 3PIRA 3ZS9A 3L1JA 2H07A 1HDYA 2IXDA 4Y2PA 4L5YA 1IFXA 2YXNA 5L3RA 3BB1A 3TMYA 3WLIA 4MWTA 4KR2A 1QOZA 1JNYA 2I62A 3LU1A 4JJGA 4II2A 4UDNA 1BGWA 3SBXA 4BE4A 1ULAA 3P0FA 4KUHA 2YFHA 1L5SA 2IPMA 3EJ6A 1QMGA 3B89A 3HE3A 1DIAA 2HHJA 1HUQA 2JIDA 4NEQA 2XMSA 4PHCA 2C78A 2NQ8A 2FSHA 4S1NA 3VSCA 1M6HA 3BL8A 5J4YA 1OFIA 4HAOA 2OV8A 3KBOA 4TKUB 3V7NA 4EFNA 1UCFA 4R7GA 5A71A 3KKNA 1TMOA 3L0IB 3DC2A 5FWDA 4DR1B 1XCMA 4NPCA 4BVHA 2CHVA 4RNCA 4F4JA 1I7LA 4JEUA 1UPCA 2A9FA 3IEIA 4QFBA 3VV2A 4XPIB 2PUAA 1M1XB 3NDIA 3O2NA 4DLNA 1UM9A 1P9NA 2J3EA 4Q4JA 3ED1A 3QVUA 4EECA 2BFAA 2CJYA 4TV8B 3LRTA 4MVXA 1FFHA 1SELA 3KJGA 4NE7A 4MJ3A 1NVAA 3ZHSA 4ZI5A 3L07A 4UEWA 3U7EB 1P44A 1FLDA 3QUTA 2WINI 1SPBS 4N3NA 3Q3HA 1YFKA 5HS6A 2V54A 4P8RA 5C5IA 2BMAA 5DM4A 2IHTA 3KELA 3EX7C 1G8JA 1DBSA 1JBKA 3LIPA 3NBXX 2WNSA 2YV4A 3K5PA 1GJRA 4QU0A 3UXMA 4EW2A 1KA9H 4B34A 1J8FA 1Q3KA 2WWHA 5IJZA 3X0DA 1S3GA 1DKUA 3CB4A 4TWBA 1I6WA 3WNQA 2POQX 3H0EA 1CZOA 3O73A 1EAYA 4TTVA 2Z2JA 1JKMA 4GECA 5AI8A 4KXXA 1FTNA 5FPSA 1U3TA 2BEUB 2WKWA 3AR5A 4NBKA 2X7HA 1VL5A 4PTLA 3IULA 4YRRA 4TOIA 3N39C 3I2KA 1M2HA 1T36B 4JIGA 4DLLA 3C1OA 4OBEA 2P2YA 4F6RA 1F9AA 1PTKA 1JR2A 1NNEA 1D6JA 1NNSA 2NO1A 1GPNA 3OFNA 3OLCX 4RJTA 3GJ0A 1GUDA 3IDSA 3KD3A 2CXHA 1E2FA 3UMBA 1QZTA 1UKYA 1GGNA 3JQ9C 3U4QB 5LFAA 5DXFA 2YASA 4B83A 1RPTA 1FYWA 2O2IA 4Q34A 5HIAA 1NY6A 1Z25A 2WTXA 4FYPA 3RM3A 4JJEA 4OK5A 3V2HA 4RH1A 4NYIQ 1FE8A 4M0DA 3HKDB 2ZJYA 5CA1F 2XUZA 2C59A 5J2TF 4BC0A 1IM2A 3PNSA 2K6GA 3DO6A 1AKRA 2GI4A 3CNLA 1U2QA 4WMLA 1V7QA 2VDOB 3CXUA 3JRWA 5FBWB 3WIUA 3KXLA 1YDEA 3MWLA 4CKEB 3K9FC 1E7QA 3HY4A 3ABIA 1FRVA 1YHNA 4MCAA 1MW8X 4S1WA 4PRYA 5AVKA 4ND8A 2F3UA 1U94A 3OBBA 1R0SA 1TVKA 1RWOA 2GR9A 2QGFA 5ALMA 1TO2E 5A6VA 1EK6A 4I55A 3N7TA 1JTFA 2ODBA 1E5TA 5SZIA 4CHGA 4S04A 3ONDA 3H2ZA 1JEYA 3V3KA 6REQA 3IOYA 1ELOA 3DUFA 4I8DA 4B3IA 2Z4RA 3V2UA 2WAAA 4ZOQI 1EBFA 4E12A 4RTPA 4PC2A 1MJGM 2ZK7A 4F5YA 4OGGA 4QRDA 3HO1A 1RZRD 3QUQA 4LYJA 3A1VA 3EZFA 3HBNA 3D2CA 4ITUA 4KN8A 1PSWA 4JH0A 4TV9F 3IKVA 2OT3B 1GIAA 2GHTA 4NZZA 4UEOA 3PITA 3EIUA 4KPUB 2AG6A 2DPGA 1JA0A 2IPXA 2PRIA 1M72A 1YR3A 4OBXA 1C7JA 3OOHA 4ZKEA 2Q2NA 2NU9B 2FW0A 3OCVA 1DIBA 1JG3A 3P20A 1NW9B 2OBMA 4ND2A 1YZGA 3I5XA 1P7CA 1SBTA 3K53A 4MB2A 4CIVA 1P2DA 5KOHB 1NHWA 4H6PA 5E95A 4C2BA 2NIPA 1UBJS 2FSFA 2PY6A 3MT8A 3SM9A 3QLVA 3G7NA 1R6DA 1XCOA 2GK6A 1QQAA 3N0TA 3RUFA 1JG1A 4GHWA 4K9PA 3Q6MA 1WPGA 1U2EA 1XMIA 3T3NA 5EIWA 3W5UA 4HVLA 1W36C 1CEEA 3CPEA 1Q15A 3CRRA 4P93A 2BAGA 1DUSA 5DCWA 1PX2A 3QA9A 3FAKA 3GEEA 1YZTA 2FEXA 4ZVOA 3X1YA 4RTMA 1UOQA 2I80A 3JYOA 3QWHA 4MGIR 2H31A 2YUTA 1EA5A 4KTVE 3NHSA 3MTDA 4XIIA 4NMWA 1MTZA 2CNBA 4KG7A 4FW8A 4LRUA 1KI4A 1MBZA 2C2ZA 4ZCQA 2G06A 1YQTA 3H1AA 1CRQA 3BKWA 1MX3A 1M6VA 1UDXA 3ZCXA 4D3XA 1K75A 1TA0A 1FNCA 1M6YA 2VDLB 4Y2XA 5A5FA 5K0EA 4FR0A 1I0ZA 2HUPA 2ADFA 1YBHA 1Q0HA 2AFRA 2BFFA 3F5QA 4RV4A 2Z8YM 3VR3D 1GNTA 2HDNB 4C9BA 5F9HA 3JQGB 2ISSD 1Z2PX 2PIDA 2D1YA 2IH2A 2XWJI 4G1MB 3R9XB 1DC8A 2P6NA 2AW3A 1BMFA 1K89A 4M99A 1CR6A 1WBJB 3FAZA 4LWPA 3O8QB 2HPAA 1M8KA 1PDOA 4WLUA 3JVUA 3MWEB 3W1EA 5C8YB 2PZLA 1Y7HA 2HYDA 5DHRA 2O8VA 5ALFA 4D8XA 4ZO4A 1KJWA 1XVAA 3JVIA 2D3TA 1LK5A 4BTEA 5H83A 2O4CA 1HZJA 4IXDA 2YNMA 5BV2P 3VDNB 2MIIA 1KVQA 2WUGA 3CT4A 9LDTA 3VNVA 2DWOA 1EP3B 2BISA 2PZKA 4PV7A 4BVFA 4QBFA 1YS1X 4BS9A 4UTXA 2BFCB 3NTUA 4JJAA 3NKFA 2D8AA 3CGWA 4QYMA 5H4HA 3JTEA 1NRJB 4REQA 5E2AA 4UTZA 2WTBA 5IS2A 1USGA 1P73A 1JAHA 1WE2A 4FU0A 1ORDA 1NQOA 1K98A 1FFEA 2G8NA 1K3UB 3KPJA 4QDZA 1RC8A 3FUWA 3OJLA 1C1XB 4DEYA 4NCXA 3AR4A 5JXGA 5CLIA 2DSNA 1AO3A 3H1TA 3LFHA 4HN9A 4KQCA 5IT5A 1NI5A 4JZYA 2VAVA 3NHMA 2A9PA 5CHYA 2AFIB 5IEBA 3I6MA 3MZ0A 3SFTA 3F4KA 3SJZA 4LV5B 5JO0A 1DMRA 5T4HA 1VRWA 3AR9A 5LM3A 1TZJA 2V9ZA 2N47A 3CG0A 3QF4B 1OU4A 5CW2A 2AUMA 3U7JA 5LYJB 5C35A 4ZI3A 3NC1C 4E5YA 1EWYA 1Q91A 4CMAA 1DV1A 2HTEA 5AYVA 4MWBA 4EKIA 5E3HA 5FUQA 3BC1A 2HHAA 2V0GA 1JR3A 2NNLD 4PX9A 2C61A 2BGRA 2QVYX 1PGQA 3H5WA 4I9NA 2VJOA 4JUBA 4WZ6A 3EW9A 3C5HA 4TVOA 4Z8YA 3WL6A 5AOBA 3I39X 3NI2A 2KI5A 3D4PA 3KZOA 4RZUA 2JAPA 2X1LA 1SIBE 3HXKA 1KYYA 2RAPA 4X20B 3WQSB 4I50A 5GINE 3NKLA 4UM7A 2HSWA 1N7HA 3KJFA 1W1UA 2BP7B 3MAAC 5KOYA 1HNNA 4NONA 2QX7A 4FDAA 5EUBA 5DYNA 4B7UA 4HAYA 1TO6A 2VAXA 3U7QA 4RWZA 1S8OA 4UHBA 4KWTA 2O2CA 4MGEA 4NBRA 1XEFA 2PH7A 2Q4TA 3NALA 3CVUA 4D98A 3O4VA 3G0CA 4NOJA 1IULA 4GWGA 3UYKA 4KLNA 3KSUA 1OGIA 5CPBA 3OQ1A 3PUVA 1PG5A 2K4MA 2VDNB 3DLHA 5LMZA 5JH7B 3FVWA 3J81A 1MABA 4A15A 1J25A 1V48A 2OAQ1 2GFIA 4BQPA 3KOYA 1RQ7A 5EKSA 5FBQB 5F9MA 5DJ5A 4W7HA 4UHKA 3SFVA 1VMIA 2IXTA 2YL2A 3PA6A 4IHAA 2VSQA 2CVHA 3OZAA 3WISA 3LCMA 1E9AA 4HDRA 4FC7A 3WGUA 3H3FA 4Q9HA 3ZTYA 4W7IA 2P67A 1LDNA 4EGCB 3AHJA 3PIIA 1T3HA 2ZXUA 2OKCA 3K6SB 3F8WA 3QE0A 3U61B 1NFRA 2A9QA 2JGIA 1COZA 2R2AA 2B25A 3SEZA 4IJUA 1XQ9A 4CN9A 2PANA 3SLGA 3BMXA 1EXMA 5DOVA 3VNQA 1JLSA 1L7DA 1IXKA 1WCYA 4OHWA 3R0IA 5EIAA 1G5TA 4YPOA 4ZARA 3TZLA 4B0OA 1PR6A 4IYRA 2OV2A 5DLDA 2EZUA 4ZHQF 4K1LA 2I3ZA 4G23A 2WY2D 3G5LA 1A88A 5AJZA 6AT1A 5MN6A 1JSRA 2V59A 2YZNA 3PRKE 1BFKA 2OBLA 1I4OA 4PHTA 3B60A 4CGYA 1LI4A 2J6IA 2EV9A 1L5YA 2J0VA 1CR4A 3EGWA 1VGQA 4DCGA 4RK7A 2IYLD 5CLFA 2JGAA 5SZHB 3TGWA 3UPTA 4HF7A 2BM9A 1KWKA 3CR8A 3WVNA 2Q6LA 1C4WA 1L4NA 2OL4A 3A6GA 4GBJA 5BN1A 3GJ4A 4HAVA 4Y9UA 3CINA 4EITA 3VA7A 4YRJA 3RSQA 1C4KA 4Z0HO 3THWB 3F3MA 4BRSA 3OPMA 1MT3A 3HDVA 3P7MA 3TZHA 2YBDA 4KPFC 1S02A 4AKTA 3RYFA 2GJ8A 4N5IX 2CHQA 1TCVA 1KAEA 3L4KA 1WXQA 3LPCA 3G2NA 1WVGA 4DZRA 4JYMA 2BFDB 2NSHA 3RLIA 1FQWA 5MN5A 2WF6A 5DH9A 5JO9A 5J2TB 2R1VB 3PWTA 1JHPA 3Q2KA 3RUCA 4XWOA 1GEEA 3I8OA 3IUBA 3N2EA 2P41A 3E9DA 2X0IA 4AZ0B 2ZI4A 3DXYA 3GJ7A 3RROA 5JIBA 1OXTA 1UXOA 5L3ZA 4J43A 1O94C 1TJNA 1QANA 2VHXA 2RFLA 3EN0A 1YQWA 2X8JA 4NBTA 5T4EA 3WO0A 1I10A 2NZVG 3FB1A 1AXGA 2GPWA 3HLKA 4HJXA 2A94A 2QG6A 2QLJA 3W06A 3AVPA 5CUQA 3I5YA 1AKMA 1BCSB 1P1JA 2J5BA 2IUYA 3U44B 1SVMA 5KNCD 4DA9A 1QHIA 4PFJA 1UKEA 1ONPA 4PVDA 3A7EA 4BO1A 5BVHA 1AB6A 5KMGB 4B2LA 5HMMA 2JA2A 3WGZA 5T41A 2EFCB 3EZLA 4R2IA 4LC9A 4V3CA 4HTFA 4KFTA 3RSFA 4WK4B 3SAJA 4HN4B 1MAUA 1RAAA 3CRVA 1Q6ZA 1T5LA 3VDQA 1AK1A 4XIGS 4EHAA 4FI3F 5AH0A 1KO7A 4D4MA 3KUDA 5GZ3A 2WVAA 4I1YA 1YHZA 4KR7A 2QA5A 4MB6A 2BSAA 2ZYGA 1SCDA 1F38A 2PAAA 2M98A 1S3FA 4R3WA 4WAUA 2ZB3A 4LQDA 4B17A 1VI5A 1PZMA 2MSDB 3GNSA 3AK4A 4HDMB 2BEKA 1MJNA 1CVIA 2EX1A 2Q50A 3NM4A 3OJFA 2FMKA 3ND8A 5ISMA 2G9ZA 3PQFA 5KYYA 1ORTA 3QEJA 3CJTA 1E9VA 2VJNA 2G08A 2Y2VA 3R5KA 4PGAA 5E4JA 3E22B 5JZBA 3ZJVA 3IUSA 1ODIA 3BMCB 8AT1A 5F98A 4EX6A 221PA 1B16A 1S2MA 2ZTSA 1XTQA 3BS4A 1N3YA 3T1QA 1L4BA 2WFLA 1BGXT 3RS4A 5BNFA 1OB2A 5JPIA 3ZV5A 2VT3A 1OSNA 1XLTC 3C5CA 3BDAA 5JCZA 5TS2A 5HKAA 1IJEA 1XA3A 5BSTA 5LSAA 4JGGA 2DPXA 3DE3X 5EKTA 3DOJA 4MUHA 4G2TA 5DX1A 1RXCA 2JGFA 3DDUA 5DHFA 2PMCA 5HMLA 1W7AA 3HVJA 4QE3A 5FLYA 2ZS8A 1QYWA 3I9LA 4B3XA 4D02A 3RIEA 5BR8B 1JEEA 3ZNOA 2IIVA 1KEWA 3MGCA 4QGGA 3BULA 2VF8A 5IN4A 3GAZA 2FUKA 4R0MA 2BHLA 4JUFA 1ZBQA 3TQCA 2P0EA 4FUQA 1WB4A 1KC3A 1D09A 1W88B 2XX3A 3HJHA 4OL9A 2Y3IA 2R7AA 2JKVA 4V0SA 3UFXA 4YJ2F 1USKA 2AD1A 2Z09A 1CR1A 2A0WA 4TXJA 3A4YA 3OWXA 1Q77A 4PC3A 5DT2A 1N78A 1MCZA 3CN7A 2GVNA 4M0UA 5HGXA 4P83A 2CNKA 3ICQB 3V4LA 2QUIA 3KSMA 1JU4A 2JKZA 4HNTA 4UMFA 1POWA 3H42B 4GMGA 1YZUA 4URYR 5KINB 2WIJA 5EIOA 3ZBUA 3AETB 4ZK6A 4HGRA 1KMHA 1H4TA 3EGEA 4P5DA 4BE9A 2NNWB 5HE9A 5IAJA 2IX3A 2XMZA 2C3UA 3DKKA 4BMPB 4EHIA 3EGVA 5CYFA 4ZQEA 5HBGA 4HH4A 3O5AA 4X63A 3CUKA 1PWXA 4C4TA 1G3QA 4ZYYA 5LPNA 3KR0A 2YRFA 1KOLA 1UZLA 3R9WA 5B1SA 1CEQA 2JVIA 3EMDA 5FORA 1C81A 5THXA 1B6RA 1ND5A 4S12A 1UK6A 2WUDA 3VNSA 1D2RA 1NVXQ 2YR0A 3GHHA 2A4KA 1IUKA 2PGJA 5HRCA 3WHKA 3WMRA 5EE0A 2AQKA 5I9MA 1Y5NA 4R84A 3BWMA 4CIYA 3N2GB 4LJ5A 1OYYA 1H1LA 5AKZA 2EJVA 1G2QA 1TM4E 1Z38A 3RVKA 2FGKA 1GSIA 2WTNA 4HXFB 4P7BA 4XDGA 5ALVA 3FHTA 3NNSA 4YMLA 3LPDA 2WF9A 4QLOA 2QZPA 5KWVA 3FR8A 4V02A 3AIKA 5AK4A 2DXIA 2OOKA 2FEAA 2Y66A 2Y0CA 2ZWPA 1NV9A 1YJCA 4S24A 1ZIOA 1J5PA 1C9JA 2J41A 3NP9A 4PBRA 1NF3A 5A2GA 1ZH2A 3K31A 1ZUWA 2XXJA 1S6YA 4CEHB 1U3DA 2TECE 3GFFA 4C7BA 3LX6A 5K8TA 1UZAA 4JKIA 3WK4A 2VP3A 1H5QA 2F3QA 2NO0A 1U0RA 3ESAA 1V8DA 1IY9A 2Q6VA 5A04A 4BZZA 3DEAA 4BX9A 3FIUA 1EGQA 1NC1A 1WX1A 5JV5A 4F5WA 4TL7A 1P9WA 3B20A 2CXQA 3LPAA 4HT3B 4ZGGA 3G0IA 1N36B 3KKQA 1D1QA 1KP2A 2BMDA 2AJCA 5E1DA 3G9TA 5CB8A 3KTDA 4R3UC 4P54A 1IPEA 1H2YA 2NTJA 1SUPA 3DONA 2X2OA 4F71A 1TJ3A 5JHHB 3KQQA 1UIMA 4OI2A 5K8JB 2H0RA 1CIVA 2PX4A 1F4VA 3MIIA 3RT7A 1SVUA 4EUNA 3CH4B 1JFSA 3MS2A 1Z37A 1KPIA 4LWOA 2HCJB 2VRBA 4F8EA 4ZHQA 8ABPA 1A8HA 1Q1GA 3O4JA 3QF7A 1DSSG 2IUTA 2FSUA 4IY1A 4MGYR 4MZDA 5CT9A 5CU7A 5JJCA 3F47A 3QHQA 3GJ6A 1Q7EA 1XAIA 4U2FA 3MILA 4U5QA 5EE5B 3G2QA 3T9BA 1TMKA 1F6WA 3TN7A 5BSEA 2J87A 3K8OE 5EJ8A 1UK8A 4GH5A 2FQXA 2ZU0C 3UC5A 5CM9C 2BSXA 1X1AA 2XJ4A 3S7TA 4YRZA 4DIEA 4E1BA 4EJMA 1X1EA 1PLKA 4GBMA 3DE4X 1KVSA 4H0FA 4CQMD 1RZ3A 1UP7A 4WCFC 1FSPA 1EESA 1AZWA 2PT6A 3EWIA 2IS6A 3PI6A 1JVNA 2YCBA 1U2DC