2OKCA

Crystal structure of type i restriction enzyme stysji m protein (np_813429.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
424
Chain Sequence
QSLTKKVWNLATTLAGQGIGFTDYITQLTYLLFLKMDAENVEMFGEESAIPTGYQWADLIAFDGLDLVKQYEETLKLLSELDNLIGTIYTKAQNKIDKPVYLKKVITMIDEEQWLIMDGDVKGAIYESILEKNGQDKKSGAGQYFTPRPLIQAMVDCINPQMGETVCDPACGTGGFLLTAYDYMKGQSSKEKRDFLRDKALHGVDNTPLVVTLASMNLYLHGIGTDRSPIVCEDSLEKEPSTLVDVILANPPFGTRPAGSVDINRPDFYVETKNNQLNFLQHMMLMLKTGGRAAVVLPDNVLFEAGAGETIRKRLLQDFNLHTILRLPTGIFYAQGVKANVLFFSKGQPTKEIWFYDYRTDIKHTLATNKLERHHLDDFVSCYNNRVEIYDAENNPQGRWRKYPVDEIIARDKTSLDITWIKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type I restriction enzyme StySJI M protein
publication title Crystal structure of Type I restriction enzyme StySJI M protein (NP_813429.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Transferase
total genus 133
structure length 424
sequence length 425
chains with identical sequence B
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02384 N6_Mtase N-6 DNA Methylase
A PF12161 HsdM_N HsdM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.30 Mainly Alpha Up-down Bundle Ferritin Ferritin 2okcA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2okcA02
1ZGAA 3FUWA 3LBYA 1ZGJA 2OZVA 3HCAA 4RVGA 4YUXA 3IYLW 3ELYA 4HG2A 3SX0A 5LQKA 3G2QA 3HCFA 4OA8A 5HOQA 5CD1A 4RTPA 4PYIA 2IPXA 4EKGA 3TQSA 4MHTA 2KW5A 2I62A 1P39A 4IV0A 3G5TA 3EEYA 2PSSA 3LKZA 3HVIA 4HGZA 2NP7A 5ICGA 1RI4A 3UJBA 2UYHA 2Z6UA 3FTFA 1SKMA 2PJDA 2PGXA 2ZCJA 3RODA 1XTPA 2IGTA 3EMBA 4CKCA 3SSNA 3D2LA 2AOVA 4GEKA 4P7GA 5DTRA 4EVIA 5DSXA 1QZZA 5FA8A 5FQOA 3GRZA 1YUBA 4U7TB 4RTKA 3R24A 5E9QA 1TW2A 2BR4A 2HTEA 4IWNA 4QVGA 4OA5A 3LDUA 5E1OA 1L3CA 1G55A 3HA3A 4KWCA 2IIPA 2OBFA 3B3JA 4LECA 4U7PB 3REOA 4QDJA 5JUWA 1OR8A 1BKYA 1YZ3A 5EC8A 3FRIA 1KPHA 3OZRA 1RJDA 3OZTA 5E9WA 5T6BA 3HVHA 3V8VA 3PS9A 3BGDA 3PTAA 3JWHA 1AV6A 3GDHA 5ERGB 1SUIA 3UJ7A 3GXOA 1V39A 3G88A 3I5UA 3RW9A 2B25A 3LX6A 4KVZA 3P9NA 2HMYB 2IH2A 4E2YA 4F86A 3UWPA 3P9KA 3RIEA 3THSA 4DMGA 2JH9A 4MWZA 3PX3A 5EPEA 3M6UA 4RTMA 1ZG3A 3DTNA 2P3QA 2ONZA 3MGGA 3VC2A 5CCBA 3EGVA 5K8VA 5DPMA 2NXEA 4YUWA 3BGVA 3LCUA 5DM4A 4BLUA 1U2ZA 4E33A 3B3FA 3O31A 4RVFA 3BT7A 3FZGA 5C0OE 5K0JA 2PX4A 3G2PA 3UBTA 4AZWA 3THRA 3B7PA 2HR1A 3SSMA 5FADA 5HIMA 2AOXA 3C0KA 1M6YA 2EJUA 2I7CA 2ZIGA 5DSTA 4RTLA 1L3BA 3NDIA 3KHKA 3P71T 3OPNA 3ORHA 4DA4A 1EJ6A 1WXWA 2CMHA 3R0QA 2UZ4A 1KYZA 3E8SA 3NVKI 5GP1A 5E2AA 3NW9A 3E05A 5DM1A 5LQJA 3UA4A 3EEOA 1XDUA 3CBGA 1UWVA 4FT2A 1NW6A 4C4AA 4DF3A 4PCLA 2OB2A 3K6RA 1QAOA 3KPWA 4PGHA 5E1BA 1JQEA 3ELUA 3DXYA 2G70A 2IFTA 4E2ZA 1HNNA 3S68A 2JHCA 3EVFA 2GH1A 2OKCA 2ZBQA 3EVCA 3OE5A 1RJFA 2ZW9A 3ELWA 4KIFA 1WZNA 4E31A 3DLIA 1HMYA 5E1MA 3IEIA 2Y1WA 4EQZA 1NW3A 4AZTA 5DM2A 3A27A 1PJZA 1G6Q1 5DRTA 2NYUA 1NKVA 7MHTA 2IBSA 3HCBA 2FPOA 3HVJA 5K03A 4IKPA 2ZWVA 3BUSA 4HTFB 1O9GA 5D1HA 3LGAA 1AF7A 5CVUA 3HVKA 4DCMA 3A25A 4HTFA 4RTJA 4QDKA 1NW5A 3G7UA 1T43A 1ORIA 1XCJA 4PYLA 3SMQA 1I9GA 2C7PA 2FK7A 4YMGA 3SXJA 4V0QA 2GAFA 5EIFA 3OU7A 3B89A 2C7RA 3OU2A 2ZZMA 2ESRA 3P8ZA 4K6MA 3TR6A 4GQBA 2ZULA 2V74B 2PY6A 3T7RA 3OFKA 2HNKA 3PFHA 4PGGA 2EFJA 2QM3A 5EKUA 2NXCA 3NTVA 4FR0A 1D2HA 2CL5A 2EX4A 3MTIA 1FPQA 4OQDA 1RI1A 1Z3CA 1P1CA 1G8SA 2PXAA 1KPIA 3PB3A 4PNEA 2YVLA 3FUTA 5EG5A 3O7WA 5DTQA 1ORHA 5FWDA 5C1IA 1XXLA 5IKMA 4FGZA 1BC5A 2PX8A 3FPHA 4BP1A 4CKBA 1IY9A 2AN3A 2QY6A 2O07A 2YX1A 2BM9A 4Y2HA 3AY0A 2OPBA 1ZKDA 3KU1A 2P41A 3FTDA 1F38A 1MJFA 3R3HA 1X1BA 3TPZA 4E32A 3BWMA 5LQAA 3BKWA 3OFJA 1I4WA 1R6AA 3P2IA 3P9CA 4RWZA 3KQOA 4WVLA 4RTQA 3KQTA 1FP1D 2GS9A 4YUZA 3FUXA 1G8AA 3GJYA 4A6EA 1X19A 1L3IA 2XVMA 3EVGA 1Y8CA 1AQIA 1EAMA 3P2EA 1RI3A 3OZSA 3FPGA 5HILA 3M70A 2P7IA 2ZVJA 3K0BA 2XYRA 2GPYA 2YTZA 4M37A 5KQSA 4RTOA 3GU3A 2VDWA 5FHQA 3IV6A 3UJDA 1SG9A 3DOUA 1O9HA 3FRHA 1X1AA 3QV2A 3NJRA 4YUYA 3LKDA 3ID6C 3TM4A 4A6DA 2VZ9A 3LSTA 1EG2A 4BLWA 2BR5A 1JG3A 4EMSA 5GINE 2ZWAA 3O4FA 2ZBPA 2Y1XA 5KQRA 5EHIA 4RV9A 4YV2A 2CWWA 4YV0A 3CVOA 1BHJA 3VYWA 1NV8A 1G38A 3T7SA 3NVMB 4PIPA 1FP2A 1N7IA 3SSOA 5KVAA 4UOEA 4QVKA 4C07A 3IHTA 3KQWA 1EJ0A 5LQCA 2UYOA 3LDFA 2I6GA 4PYKA 2VDVE 3GRRA 3H2BA 2ZZKA 3SR4A 2PWPA 1INLA 4HH4A 1JQDA 2PV0A 2WK1A 1R8XA 3M33A 5E1DA 2IDKA 2PT6A 5CVVA 3LDGA 4RTRA 4M36A 5BXYA 4QQKA 5DT2A 1SUSA 2VDUE 2WA1A 5LR6A 4ER6A 2B3TA 2F8LA 5EEHA 3SGLA 3JWGA 5DM0A 5GIPE 4BY9E 2Q41A 1NBIA 3TFWA 5K05A 4FP9A 4GBED 5BP7A 3M6XA 3EVZA 3I9FA 2PX5A 2AN4A 2XYQA 5ICCA 1EQAA 5M5BA 1DL5A 10MHA 1G60A 2VP3A 2N47A 4CTJA 2OYRA 5HIIA 4GC9A 5K0LA 1R00A 4MQ4A 3M6WA 2E5WA 2CMGA 3LHDA 2DPMA 4X1OA 3R6TA 4C04A 2V7EA 1UIRA 5D1NA 4P58A 4OX9Y 5HIJA 5FHRA 4FZVA 3DMFA 3UJCA 4YV1A 1TW3A 3DXZA 5EMKA 1B42A 1X1CA 3A7EA 3FTCA 2QYOA 5GM1A 3DMGA 4QPPA 4P7JA 3FUUA 5DLYA 3M4XA 4QTTB 3NDJA 5CVEA 5EKXA 4KDRA 2GLUA 5K0BA 1P1BA 3MTEA 1BOOA 2BM8A 5DX8A 4X41A 1I1NA 2YXLA 2HV9A 3NWBA 4GOND 2UYQA 3HCCA 4F84A 1JG1A 1XDZA 3F4KA 3UJAA 5BW5A 3BGIA 1M6EX 5EZSA 1AQJA 2I9KA 3HTXA 4RTNA 4DKJA 1WS6A 3DR5A 1EIZA 4F85A 1YF3A 2PWYA 4E30A 2P35A 5P8WA 5EHGA 3T7TA 2P3OA 2OO3A 2ORED 3PFGA 4ER3A 2IP2A 3G2OA 2K4MA 4P7KA 1IXKA 4GOOD 1O54A 3GRYA 2PBFA 3AXSA 3MCZA 2R6ZA 5K0GA 3A26A 3LCCA 4OBXA 4PYNA 1KIAA 4RSRA 4YMHA 5EOVA 4QTUB 3C6KA 4DQ0A 2O0LA 3HM2A 2AOWA 3GCZA 1VIDA 4RVDA 5K01A 5CVJA 1D2CA 3CC8A 3I64A 4JXJA 3ER8A 3KR9A 2NP6A 4XUDA 3NWEA 5FWAA 2XBMA 5GWXA 1DCTA 2EJTA 2O57A 3KR0A 4QQNA 3AXTA 4QPNA 3TRKA 5T67A 3WSTA 4XUCA 3FPJA 3EGEA 2ZIFA 2AR0A 1RJGA 2ZTHA 2FHPA 3TKYA 3HA7A 5GM2A 1YFLA 2WA2A 3GWZA 3PLAE 5EQJB 3FYDA 4PYQA 3EMDA 4R6WA 5U4XA 4CKEA 1L1EA 2ERCA 5ICEA 1R74A 2NXNA 1XVAA 2YXDA 4NECA 4CTKA 3TM5A 2AVDA 3FTEA 2B78A 5KS2A 3BXOA 1IM8A 2QRVA 5BW4A 2NNWB 3HCDA 3ME5A 2AVNA 1SVUA 3Q87B 3MB5A 2IH4A 3KQVA 1KPGA 1RI2A 2P40A 4H0NA 5FULA 3PT9A 3P9IA 3KQMA 4Z2YA 5HIKA 3CJQA 3DH0A 3PX2A 4XUEA 5DRYA 1WXXA 5F2KA 3UJ9A 4YUVA 1YFJA 1M0EA 2PXCA 3LECA 2P8JA 1VP9A 2ZLBA 3KPUA 2O05A 1KYWA 1N7JA 4CXMA 1VBFA 3T0IA 3GO4A 3TLJA 4KRGA 5DXJA 2H00A 5CIYA 4M38A 5DXAA 1JQ3A 3MHTA 3SM3A 4GF5A 3KPJA 4RTSA 4E2XA 1JTEA 3QOWA 3CJTA 3HNRA 4FSXA 3GNLA 5LQNA 2Z6QA 1WY7A 4BLVA 2C7OA 1TPYA 4FT4A 3P2KA 1QYRA 2ZSUA 4E70A 2P7HA 3JWJA 1XJ5A 4PCAA 3AWIA 2Z6AA 3MAGA 1DUSA 4AZVA 2ONYA 2FK8A 3KPVA 4IV8A 4LWOA 4P7FA 1VP3A 2JHPA 4R05A 2PT9A 1N2XA 4Y30A 3GGDA 8MHTA 4OQEA 1QANA 3HA5A 2G72A 1VQ1A 4EKIA 5LQUA 3BKXA 3MCTA 1PRYA 2QRVB 3KQYA 3DP7A 4G56A 1FBNA 4MTLA 3KKZA 5E8RA 5E2BA 5F2NA 2LD4A 2ZBRA 4DM3A 4XCXA 4BP3A 4EK9A 3E7PA 4ZTBA 3MERA 5MHTA 2ZIEA 2NXJA 4RX1A 2PKWA 5HFJA 3KQPA 4OBWA 2R3SA 3DULA 2OB1A 2PX2A 5K09A 5G02A 1JSZA 1JSXA 3A4TA 1YB2A 1MHTA 3G8AA 3A7DA 5CUQA 2A14A 1Q0SA 2AZTA 4WXHA 1R8YA 2G71A 3C3YA 3VC1A 4C08A 2AOTB 2P3LA 2XYVA 3ER9A 5KYGA 1KR5A 5C9ZA 2GA9A 1JG2A 2BH2A 4LG1A 5CVDA 3EVAA 4RVHA 1WG8A 3AJDA 3QOXA 4GOMD 3R9XB 2CKDA 3V97A 3OU6A 3BWBA 3CJRA 1VE3A 5EIWA 5EMMA 5HZMA 5K0EA 4PINA 3DXXA 4B17A 4C06A 3NMUF 3GRVA 2FRXA 3EPPA 4FS8A 4LWPA 3CCFA 4KDCA 1ZQ9A 9MHTA 1P91A 2AS0A 3ANXA 1KP9A 1JTFA 5EMJA 4C03A 2OXTA 2UYCA 2IBTA 3UA3A 3EVEA 4POOA 2JJQA 5E8JA 3ERCA 3OCJA 1NV9A 4PYOA 1H1DA 2YQZA 2ZFUA 3ELDA 4X63A 2EG5A 3KR2A 5T64A 4DZRA 5EZQA 2P1DA 1XDSA 3P97A 1JG4A 2B2CA 1Q0TA 4V0RA 2PXXA 2IH5A 3MQ2A 3GIWA 3L8DA 2DULA 3BWYA 5K0CA 1JR4A 1YZHA 3DLCA 5EMLA 4M7RA 3LBFA 5LQRA 5EGSA 3TMAA 3E23A 1FJXA 2C7QA 5B1SA 2AOTA 3I58A 4HSGA 4RYLA 4X61A 5FA5A 3OE4A 2B9EA 4PYMA 1RJEA 3DUWA 5HEKA 4HC4A 3EVDA 2YXEA 2FCAA 3BZBA 2JG3A 2QE6A 5DX1A 3FPFA 3G5LA 1X1DA 4AX8A 3FPEA 2YUIA 4AZSA 3EGIA 4FSDA 4L7VA 4R8SA 2HWKA 4PYJA 4PWYA 3DMHA 2IDJA 2AOUB 4KIGA 4DCGA 4O29A 3LPMA 2JHAA 1NW7A 4R6XA 3UJ6A 4KW7A 3U81A 5DX0A 3CKKA 3FUVA 3G8BA 4HRAA 4ATNA 4PIMA 5CM2Z 3B5IA 5DTMA 4ISCA 1KXZA 3JWIA 5ICFA 4AUKA 3KQSA 5FTWA 2ADMA 5K0NA 4ER0A 2JH8A 3B3GA 2BR3A 3C3PA 1QAMA 3GRUA 3HCEA 4GC5A 1NW8A 2AN5A 3M6VA 2YR0A 4R8RA 4MIKA 1SQFA 2VS1A 1ZHFA 5GOZA 3G89A 3KQQA 4ER7A 1VPTA 1SQGA 3HEMA 3TKAA 5CCXA 2G8NA 1VL5A 3EVBA 4GUAA 5F2OA 1KHHA 2XVAA 2OY0A 1RI5A 3HP7A 1UFKA 4E2WA 2H1RA 3KR1A 1NBHA 2AOUA 5DWQA 5IH3A 3VSEA 5GIOE 5LSAA 4C05A 2H11A 3Q7EA 5FCDA 3BWCA 2PVCA 3CGGA 5FUBA 3SVZA 2BZGA 3UZUA 5JR3A 3KPYA 3UFBA 2GB4A 3PVCA 3TOSA 3LL7A 3X0DA 3I53A 5H02A 2PLWA 1D2GA 3G2MA 5EVJA 5FQNA 1L9KA 5K0FA 4ER5A 3LCVB 4X60A 3UJ8A 2G1PA 1QAQA 5EEGA 3C6MA 4CWAA 1F3LA 1VLMA 3FYCA 2FYTA 2O06A 4PONA 4GOLD 1NT2A 1NE2A 4HGYA 1R18A 5E9JA 1XCLA 2ZZNA
chains in the Genus database with same CATH superfamily
1RZUA 1T5DX 3I6MA 3CN9A 1IBKB 4JUAA 4KUEA 4S0XA 3UQYS 1VA4A 5CCDA 3VPXA 5FNZA 3FPCA 2H4YA 2RC6A 3B1FA 4Q4AB 2VHYA 5FD8A 3PHGA 2CCGA 1Q84A 3IMCA 4B09A 4F46A 5B5SA 5HBRA 3ZY5A 3A3NA 3MJ4A 3UJBA 4ZYYA 1RIFA 1MIOA 3OZUA 2FWAA 1H2ZA 3K9LA 1NULA 4NEQA 1U31A 4DG8A 5J58A 1SKMA 1MNAA 1U7ZA 2AOVA 2Q2QA 3BM5A 3D7SA 4GPAA 1RYMA 2G1AA 5CXUA 2QMYA 4OK5A 3UWDA 1Z63A 4N48A 3ROEA 4PG4A 2NN3C 5CJPA 2LZ0A 3L6BA 1A71A 2XZTA 3RI3A 2X2FA 4R9VA 4BLOA 3A8TA 3DFZA 1LB1B 3VPFA 3G5MA 4AZ3B 1FLNA 1MA3A 2AK3A 4OXRA 4PC3A 4QDJA 1E1CA 2DOKA 4KX5A 1ECCA 3T3IA 2FMFA 3OT1B 4QUEA 2GA8A 3W54A 2QR5A 1JFSA 1FC0A 4X45A 4EHKA 2YJGA 4DYXA 3L46A 4ZQGA 2J9YB 5TX7A 4EBFA 2QRUA 4EUNA 1PZGA 1SUIA 3G88A 1E2LA 1U3VA 4NJMA 4DL9A 1P4AA 5BUCA 1PQYA 3GD7A 2UZAA 4AS2A 4BIMA 5IFKA 4LY9A 2P9CA 4C3OB 5IVPA 3N76A 2W4IA 4E88A 5H68A 1V5GA 4DMGA 1WDLA 1O0CA 1MVLA 2QX8A 3D8TA 3D3WB 1IZ9A 5KYKA 2BFEB 7REQB 4BLRA 4IIJF 2X42A 2Q2OA 3UMVA 1U7UA 4BLUA 2OWEA 3ISTA 4Y2TA 2YWEA 4G9BA 1JMKC 3HP1A 2HN9A 1SZPA 2KI5A 1Q50A 2CDCA 4HO1X 1F33A 2ZR9A 5AM2A 5KOHA 1OTHA 2AOXA 1KZYC 1ZUD1 2WFLA 2I7CA 4LCJA 4RK0A 4BO7A 4BVKA 1MW8X 2XQFA 3SX2A 3WMGA 3RSZA 1IY0A 4TS1A 2UZ4A 5I7WA 3KB2A 1E3DA 3ORSA 1QH1B 3NOXA 4FGJA 4I5FA 4YJ3A 5KAMA 1PEDA 2J4CA 3WE7A 4F91B 1J2EA 3SR3A 4EATA 4MS4A 3F98A 4N7BA 1YMQA 4HS9A 3P4XA 3NDPA 4MGEA 5CMRA 2ERYA 2H59A 4ODIA 1QHHA 1ZL0A 2G70A 3AP1A 4YAWA 3MWDA 5HQOA 4ZWNA 3U7FB 1JWLA 3KA3A 4I5GA 1WM1A 3QV1A 5M04A 1OBFO 3ZHYA 2XYPA 4AKGA 1G5PA 1DFHA 3A6HA 1O94D 2P9EA 4DRYA 3WBBA 4G0WA 3RS2A 2HM7A 4KZKA 1DHRA 1G6Q1 1M8GA 2O5VA 2QMZA 4PW0A 5H8WA 5JXHA 3JRWA 4BYMA 2YV2A 1JEYA 1ZXLA 2B8JA 2P62A 4IKPA 3NHFA 2DQZA 2ERXA 3A31A 3PPIA 1DB3A 4ENVA 4CVPA 3EDQA 1GL9B 3NAMA 2QRKA 4KQHA 4V0QA 4QICA 4LOLA 5AUNB 3TGPA 1H3EA 2WWRA 1VKHA 1T35A 1UJBA 1JEOA 3EQ2A 3PR1A 2VYVD 4LI0A 1ZN2A 1DRWA 2QZSA 1HTWA 4K9RA 1DWUA 1T8SA 2AFIA 5HJHA 4MEJA 3TSWA 4BE7B 1N92A 2NUAA 1LWOA 1U7TA 3U3DA 4QU8A 1O08A 1C81A 5IAKA 1G18A 4OP3A 4XQGA 1QIGA 5CITA 2QBYA 3V4RA 1H8ED 4CM4A 2JS7A 4E5YA 4KBFA 1W44A 1ZXXA 4ZVKA 5TE9A 3PTLA 3INGA 3CLSD 1FX0A 2C5AA 1AXEA 5IULC 2ZJ5A 2GAOA 3R5XA 2C9YA 5CB6A 5FWDA 3KA4A 5IAEA 3B1WA 5TMBA 3RBCA 4XE5A 3VR2D 1JKXA 5EHQA 3VV3A 5HRAA 3LGSA 4JJZA 2AN3A 5AOBA 2VHEA 5EERA 2EYUA 3RH0A 1L9XA 1QO7A 2BM9A 4F12A 1JJAA 2QTFA 5D8OA 1P18A 3EN0A 3W0LB 1E6LA 3IEUA 3KHTA 2QX6A 1WF3A 4G36A 6YASA 1R6AA 3DA8A 3HU2A 4WVLA 2H1CA 4E03A 3RRJA 3STVA 1E5QA 1LX7A 1XDDA 3A4NA 2CFSA 4HQOA 2I2WA 4NH4A 4RPIA 3RIMA 1OAKA 2BT4A 3ZLVA 5KNDD 3UT5A 3AY7A 3UK6A 1EAMA 3USZA 1EYZA 2O8DB 1U65A 3IP8A 1KOFA 3TUZC 5THKA 3W05A 4BU1A 3IP6A 8GPBA 3BSWA 4F2DA 2GVNA 4NBRA 1WBJB 4M37A 2PZFA 2WM8A 3EAFA 3NP2X 3B7WA 3Q7RA 3IV6A 2PR7A 1OGYA 4RD1A 2CZGA 3VO9A 1F0PA 4MB6A 1RPAA 3HJUA 2B69A 2WTMA 1XCGB 3HY6A 5EJ4A 2BI7A 5J2UF 2CVHA 2X9QA 1E2QA 3W9YA 1QXSA 2MSNA 2XDQB 2Y1XA 1XXHA 4B35A 2R4UA 2QAIA 3M2TA 2IXBA 5H4HA 1T6BY 1R6XA 1T8PA 3B2QA 2DB3A 1AUQA 3NTLA 1MEEA 3SSOA 4DADA 4L8LA 2X8WA 5TGZA 2RHMA 4C2AA 1G59A 4IHQA 2FSGA 4BX3A 5JWOA 2BJYA 1QOQB 2C98A 3DEAA 3NGMA 1NBOA 3E3LA 4RA6B 4DLUA 3IO3A 4LVUA 5T41A 1XZJA 4AJIA 5C1BA 4DE6A 2PWPA 5CLQA 3GPBA 1JQDA 1KMNA 2FZ4A 3M33A 4MH0R 4LY6A 5K52A 3PL5A 5F77A 2EQ5A 2AX4A 4UUQA 1SUSA 3SGLA 5FRDA 3JWGA 5GIPE 4MWOA 1K6XA 4PZAA 1YQWA 4P5EA 3KX2A 3S5UA 1SKUA 2XYQA 1DC5A 2LUOA 4G5SA 1LU9A 3B48A 5L7TA 2N47A 5D8RA 2QENA 2O50A 1ISMA 2DJ5A 2YYSA 4TMWA 4EG8A 2Z5RA 3JATB 1P4RA 1TJYA 4NE2A 2W6JD 2JIOA 1JMYA 1WCIA 3M4NA 4L27A 4CCAA 3RNOA 4BNDB 2GJKA 1TZKA 2HDOA 1SIUA 3LHDA 4JT4A 2HAEA 3C5HA 1E7QA 4J9VA 2IIQA 4Z86A 2VJPA 2EL7A 4PZPA 1F5NA 1TLFA 1XAHA 1QH1A 3A9UA 5HIJA 3ZDZB 4KNWA 1YQEA 1W46A 4S1VA 1X0XA 3LQ1A 3PQ3A 1T5TA 2C82A 3D43A 3FWNA 4YQFA 4DSTA 3HB9A 3DMGA 4EWLA 4A10A 1H2HA 1HXHA 1VRCA 4ETMA 1J1IA 2PRZA 1GZDA 3DO8A 2JKZA 4XB6B 4CLOB 3MILA 5FEUA 1GGFA 1Z7BA 4OGLA 3WP1B 4AROA 4CDGA 1IZZA 3K09C 4FKBA 3R7SA 2Q27A 2JIRA 1CDEA 3JAWB 4UM7A 2HV9A 2HPAA 2I1VB 2QX7A 3KB8A 3L7KA 2GHTA 3QOFA 3HV2A 4J3NA 4YP7A 1PWZA 4Y2YA 5EZYA 5GJBA 4HXYA 3TPFA 1EGHA 3ZQKA 2D1YA 3E53A 1KQPA 3HY3A 5ER6A 3Q7SA 1H6BA 4KVRA 1YF3A 4RZXA 4CMBA 1JHRA 2WW8A 3MUNA 3ETLA 3KM0A 2V6GA 4PGAA 1YUNA 1HTBA 3H7GA 2I8AA 3H4MA 2KJQA 1NURA 1I0IA 5U1PA 3VZSA 2RIPA 5ALVA 4DV4B 4NBSA 3ZXXA 3OIUA 4D74A 3DHWC 4OIMA 4IMRA 3L40A 4EY7A 1HDGO 1IB6A 1ORVA 1Z5UA 4JUIA 4YAOA 4Z3BA 1GNPA 3A26A 3GJ0A 4PYNA 2WHXA 1UT8A 2QF7A 5D8XA 2JCXA 3OZVA 1NSTA 3PVRA 4EFNA 4YMHA 4CIWA 5JEDA 3ZZUA 3L8ZA 3BFKA 3BL5A 4ILKA 1YL7A 2F3RA 3Q8WA 4D0LB 2JIDA 4MW0A 1P74A 5GJWC 3RSHA 4JXJA 4BLPA 1YI1A 4LZJA 2E1RA 1YAHA 5G1NA 1E3WA 3G9XA 3K8ZA 1TCCA 4N0EA 1DC6A 3D5QA 4NAVA 5T67A 1S89A 1CX9B 3FPJA 3AVOA 5JD3A 4BO2A 2EZ9A 5AJZA 1WQ1R 2XJMA 4OQLA 3FYDA 1ZCZA 4IKEA 5FWXB 2D6FA 3PT5A 2RGNC 4ZMBA 2V55B 3MT8A 2EZ8A 1J49A 3VVAA 3RARA 4B44A 1BNCA 3A3KA 1KE2A 4CTKA 4ZJUA 1GPMA 3IJEB 4ZGWA 1JDNA 1T4GA 5JDIA 2JJ1A 3NM6B 2J09A 2SKDA 4FC6A 4G41A 3IVAA 1P6QA 1ZK3A 2E5LB 2P40A 2KE5A 4ESEA 3VYTB 2AE2A 1QX4A 2WBLC 5DRYA 1AY0A 1EHCA 1B1CA 1N6KA 1HKHA 4V0SA 2OORA 1Y4DE 5ENVA 2ZLBA 1MAUA 4NYIQ 1JI5A 5JO9A 4PS1A 1KYWA 2ZG7X 1E1MA 1ZUWA 2FA9A 2JKYA 2QVZX 3N05A 3IBFA 1WPRA 2C7BA 3FPAA 3ICPA 3L0CA 3NI2A 5DXAA 1X7HA 5IU6A 2EJBA 2JCVA 3MUEA 1EUMA 3F96A 1GFZA 2CWLA 1EI9A 4JC0A 2XB2A 4HK4A 3RHTA 1UFRA 1OFUA 1XKQA 3I1FA 4GVLA 1ZD4A 3TOVA 5PGMA 3F8TA 3KKNA 3T5BA 1QIKA 3VFDA 4S3MA 1HI9A 3AJPA 3F0TA 3O7RA 3ZWBA 4DR2B 1UPBA 2HIAA 3BXHA 4HN2A 4TL8A 6CHYA 3TQRA 2XNDA 3HGMA 4FB4A 1PFGA 3PFFA 1KMMA 2HNAA 4I36A 3G59A 1C4KA 4KNVA 4UQOA 2BN4A 3BS4A 3F5DA 1NJFA 2DC1A 4O2BF 3E9YA 3TOCA 1RZVA 2QQ5A 5EAIA 1WSAA 3HJTA 3OEHD 4G56A 3DP7A 1CZHA 3NQ41 5T3UA 3FCEA 1G2OA 1Y9JA 1ZIDA 3PJFA 2B0CA 3U9LA 3DL7A 2ZSEA 1E9VA 2FFHA 2V2IA 2YW9A 1XZMA 5CNIA 4NMWA 4RX1A 3NG1A 4LGYA 3D2BA 3ZHRA 2VOEA 1YZKA 1CZLA 3FKJA 1RYEA 2PX2A 2OLJA 5JTUA 4OAQA 3T4XA 2BI8A 3CCCA 2V7BA 3FYUC 3SSAA 2WKSA 4MVJG 3VSDA 1A88A 4BWFB 1QFXA 2IX3A 1KDOA 1IN5A 2A4MA 3C3YA 1PSDA 1M76A 3RAPR 3SHFA 1KYQA 1QHNA 4I8XA 1JBEA 2GK6A 1C2YA 2WZQA 1KFKB 3DDSA 3ET4A 4I4LA 4YLGA 5AESA 5LP6F 2FR8A 3ITDA 2B37A 3OOJA 4GR4A 3I9V1 2V6BA 4FEYA 2G25A 2ZKLA 1BWSA 1JHOA 3HJAA 4DQUA 3KDPA 4M8NE 1CHNA 2P9GA 1U3GA 4Y2SA 4Y2JA 3BORA 1MT0A 3RYIB 2VJQA 4B6FA 3GRVA 2QRNA 2VI5A 4HLCA 2PO7A 4KDCA 4AYXA 4D6XA 3RUEA 3Q2IA 3MGKA 4TKUB 1T8WA 4UBNA 1PDWA 2YC4C 3E84A 1JECA 2UYCA 4URFA 3CW9A 1YT5A 3MVEA 4KOAA 3U3RA 4LXHA 3K8OE 1NXXA 4RLHA 4ZAWA 2FPSA 4HDQB 4JI7B 2K87A 3GIWA 2BMAA 2J3QA 3H04A 3WIUA 4DJDC 5K0CA 5AVRA 1NMXA 4QOHA 1DRVA 5K3FB 3VHXA 4F56A 4U9HS 5J47A 2PBLA 3TMAA 1LPPA 3E23A 2G77B 1CUCA 2AOTA 3PWKA 5F51A 4KR2A 4OUDB 5JIBA 4PGMA 3TZBA 3A70A 2AJBA 3N0XA 3GNQA 4DBLC 1UVHA 2EU8A 2GFIA 3RK4A 3TLZA 1C4OA 1QTQA 3EVDA 2YXEA 2FZFA 3KFVA 4HQ6A 4YRLA 3V7FA 1AU9A 3PUIA 3G5LA 3DLAA 4F93B 3N9IA 2H57A 3W06A 2FUCA 4ETIA 2IYTA 2X7JA 3RYFB 1XGKA 2A84A 3AJOA 1Y5RA 1P7CA 2V4UA 3D4NA 3KSZO 3LPMA 2O48X 1VLVA 1NW7A 1XJ0A 3RGDA 3MTGA 5DNEA 5E7IA 2FXIA 1T1IA 2P6MA 2QW1A 4HRAA 3I2FA 1TCUA 2BSXA 3B5IA 4H3VA 5EN4A 1JIKA 4EGFA 3KQSA 3LBHA 5K0NA 4JI4B 2Q9BA 5CX1A 3MK31 5JC1A 5M2QA 4AULA 3AB7A 3AY3A 3NBYC 3D3JA 4TS4A 3CPHA 2WWWA 3NT5A 4PY2A 1BVHA 1D7OA 1SQGA 4MQFB 4A2CA 4CM9A 1KHHA 3VJLA 1H6DA 3F35A 3S5JA 4AG3A 1L5OA 4GGOA 2BJHA 5CU7A 3VKWA 3WK8A 4E2WA 3UH0A 3M3DA 4FOTA 4UEQA 4YRMA 2Y93A 1P2FA 4OHCA 5TVGA 5LYJA 2GF2A 4CMKA 2IXGA 2BZGA 3WRYC 2PQMA 1U2PA 3R8XA 2QNIA 3NKVA 5I6DA 1GILA 4FDMA 1I4TD 4IGKA 2XB9A 4NULA 1VSUA 1D2GA 2OSBA 4FUTA 3QSYA 4PSUA 1Y8RB 3AF1A 2G1PA 4EH1A 4OLAA 5EEGA 5EUMA 5G2OA 3N5CA 1CTQA 2AWOA 1M67A 2UZ3A 3LTEA 5DBFA 3ZVRA 3D3QA 1NE2A 4HQNA 4AKIA 4G84A 1XCLA 5F9MA 1E3SA 2D5CA 4RO0A 4OQFA 1KQFA 1CP3A 4ZCTA 2YIDA 5AR1A 4F45A 2XE6A 1VHTA 3DNPA 2I1LA 4S35A 5L3VA 3BFJA 1LXCA 1NUTA 2E2WA 4XARA 2G04A 3WYAA 3A4MA 5JFOA 2IPXA 3ACDA 5HGXA 4IIHA 2E18A 4KUGA 4WOCA 5IS2A 1P39A 2QUKA 3Q7IA 1TC1A 4IG9A 5EYPB 1FXWF 4ND7A 2C78A 4QNRA 4UTNA 3JQ6A 2Z1NA 3H16A 2E82A 2G76A 2PJDA 1KDYA 4CIYA 2KPOA 2ZDQA 3ROTA 1R5BA 1N3IA 1KSGA 5KBYA 1E1NA 5DSXA 1ZAYA 3C3AA 1U9YA 3BIXA 4YUAA 4F1KA 2LIVA 1P2GA 2AUTA 4TWRA 2DAPA 4OA5A 1UK7A 1NI4A 2A94A 3IHKA 4ZP1A 4U0JA 5LA6B 2Q5CA 1VA5A 3K4HA 2AC2A 1B71A 2B4RO 1LBTA 1E3WB 2N1BA 2WTXA 4B6JA 3T38A 2W42A 4C2BA 2X76A 1RJDA 1VTKA 3ETCA 2VP6A 2GRJA 3NHAA 1XCBA 4J0KA 1WPGA 1URPA 1NVVR 4YEDA 1MOQA 4IG4A 2PMBA 3JTEA 2BTQB 5TT1A 3RBAA 2HT6A 4QGAA 4DM4A 2FX3A 4EGAA 4LFAB 2XH8A 2BGKA 2FG7C 3WIVA 1P2SA 4D41A 3K70D 2WP8J 4OL0A 3SIXA 4F86A 4TXLA 1KEKA 3GRKA 4NBNA 3LU1A 1CUFA 4DLKA 1Z4KA 4IMPA 4A26A 1U9ZA 5DPMA 4YUWA 3QBDA 5C7IO 2FVYA 2H6EA 4LY3A 1ESNA 3V8RA 4G85A 1FA9A 1W1UA 4DQKA 3TMKA 2W6PA 3QSGA 3BA6A 5HMLA 5BR4A 1CJMA 1IBMB 1EFUA 2JD60 3I6IA 1DCKA 3BMOA 2GCNA 2CSXA 4FM9A 5IMBA 3WBJA 2ZIGA 3RK1A 3NDIA 3VHQA 1UMBA 3OPNA 3WHLA 4YRBA 2ZTLA 3L5KA 4DA4A 2F1HA 1ADBA 3MRVA 4JUBA 3FYSA 3I52A 3AK9A 4MWDA 4FE4A 3QIVA 3Q8KA 3GJQA 3PNMA 4FK8A 1XDUA 5AHXA 1OLOA 4X65B 3BJMA 4P1ZA 5AD1A 2EKQA 4DF3A 2I0FA 5TEVA 5E1BA 3MM4A 3KV3O 4EHFA 1BXGB 2HYIC 1CY0A 3GOHA 4BX8A 3TN7A 1EIWA 3EVCA 3EVFA 4KREA 2VZ8A 2AI2A 3OTIA 1AGRA 4JL8A 2A9PA 2DETA 4QFCA 1KAOA 1ENOA 3COSA 4II4A 3R09A 4WFJA 5DM2A 1TEHA 4KU4A 4O2RA 4JSTA 1P6UA 3T9CA 3A9CA 3W6ZA 2NYUA 4ZDJA 4YTEA 1NYRA 1PNTA 3WQBA 4OH7A 4QBIA 4AT1A 3SIRA 2FWMX 2VL7A 1O9IA 5CX4A 4N6GA 1AF7A 1F8XA 4YREA 3DBLB 4PG8A 1RYNA 2CNKA 4FMPA 4HTFA 5B55A 1J0AA 4REQB 4O4IF 4OGKA 2FMIA 2YJ3A 4GMKA 1N0VC 3EGDA 4KH1A 5IYZF 3M1AA 2VSNA 3UF0A 4D97A 2W4QA 1G7TA 3VKFA 1TKCA 3DOHA 1DIAA 2ESRA 2XQJA 1DC3A 1I7PA 3C6YA 5J8SA 4RDIA 1JXAA 1HLDA 1OLSB 3AETA 1YA6A 4UM9B 5IPFA 3GMSA 2A3NA 3EC7A 4I9HA 2GJAA 1B0PA 5DVZA 3BMQB 2HPVA 3NTVA 1NUPA 1NL3A 4IEFB 1RI1A 2PYZA 3KC2A 2J3MA 3IAEA 3N0RA 5C18A 3V9PA 1I80A 1V6SA 2VAPA 3C3XA 4Q15A 4LKRA 1LV8A 1NHGA 2FZ5A 2ZRNA 5CVCA 1P0QA 1O8BA 2A78A 3ERZA 1KH2A 4NY1A 1EHIA 2RHGB 4UNNA 4MKXA 3M6AA 1CY1A 1HE5A 3RS4A 3TLJA 3M6JA 1QE0A 4EJ2A 5ALXA 2PBZA 4BE4A 1RPJA 1B76A 4MUBA 4WNCA 2GEJA 3OAAA 4EW2A 3RUIA 5D51S 1FP1D 3OLZA 5C6FA 1RLJA 2JD80 2XUAA 1NMEA 1G8AA 4NNOA 4M8LA 3WTCA 5AKLA 1SKYE 1ESDA 1P60A 2D5KA 4UARA 3PCTA 2JAQA 4WBNA 1V8DA 4LRWA 3VU3A 2COKA 1K8QA 1QVZA 5CBPB 3L1IA 4KVSA 1C50A 2P6NA 5IT0A 4BNUA 1ZRSA 2F8MA 3DEJA 3FW1A 5FBLB 8ABPA 1ZGCA 4LNAA 1OYWA 1LPNA 1KMHB 4QU5A 4BGDA 3FHJA 1U8CB 5HSGA 4OBBA 4DJEC 5F7XA 1ZVVA 2JAHA 3WK5A 2VJMA 3G2IA 4RV9A 1IUOA 1E92A 4UUMA 3BE4A 4LQNA 1F2UA 3ROXA 5M34A 4KQGA 4PIPA 4R1LA 4AVYA 1D5CA 2GM9A 2OEPA 3M9XA 5E4FA 3PU6A 1YUXA 3QU7A 2UYOA 1BEZA 3FG9A 3LDFA 3O92A 3ZIAA 1LTQA 4PYKA 4E13A 2ZB7A 4EJSA 1S3QA 1KEPA 3KLPX 1RCUA 4HH4A 5J43A 2JGNA 4EVQA 5JFTA 4J94A 4LC1A 4HAYA 1C7IA 4M36A 2WT4A 1X7DA 2R25B 2R8PA 3NX4A 4DEVA 3FTPA 2A9QA 4YRPA 2ZVPX 4QO7A 5DM0A 4BY9E 2VCHA 5FOUA 3SMVA 2JGMA 4KIJA 1N1GA 2I99A 4NENB 1FYVA 5DTJA 3B6MA 3KBOA 1SVSA 2OCAA 3IUEA 2X2PA 4CDNA 4F2HA 4DSOA 1NLZA 3HL0A 4II3A 5IWCA 2I3DA 4MQ4A 1YFKA 3A0RB 1IN6A 3JQFC 4LZZA 4O4LF 2G9UA 4RYDA 1C9JA 4YI3A 1XZIA 3UW3A 1P7WA 4LC0A 3B3QA 9GPBA 1X80A 3HDTA 3T9JA 2W2LA 3LD9A 4NTZA 5ELMA 4B2YA 3DMFA 1VE5A 3U6BA 4WOJA 2C2HA 3WGIA 1ZRHA 3IILA 4ND5A 1K6IA 1XNGA 1M3SA 3Q6MA 2OO7A 4OHBA 5CYOA 5DHPA 3D8UA 4MKFA 3RWBA 4U02A 3WRWA 1Z6TA 2HBRA 2WU1A 4QFMA 3GLVA 3KK0A 4ROTA 5CVEA 5FA6A 4NMMA 3THOA 1YR7A 1ZSVA 2A4KA 1PX2A 4XDHA 3RFCA 1O6FA 3CWCA 2YRFA 4Y6LA 5KC9A 3H3XA 4CEJA 1O9RA 5BORA 1NMYA 4CDRA 5A3QA 3F8WA 2B8WA 1QV6A 3JQAD 1NE7A 2N9UA 4N03A 1VSVA 4BBPA 2PH5A 4LK3A 2QLTA 5E7JA 5A7GA 5IASA 2D7JA 3O7SA 2R6FA 3PHJA 4RTNA 4C43A 1EBUA 3GFQA 4KAAA 4DV1B 1WS6A 4NL4H 5EMHA 1KDRA 2VHTA 4JKOA 1PR9A 1PR1A 4Y2VA 4HQFA 3D2AA 3WK7A 1XHEA 5ALPA 2P3OA 3PNQA 2XNHA 1D3AA 1FSZA 1H69A 4LZAA 3O8OB 4RC9A 2ORED 5CXSA 5FIUA 4LJ5A 1WW8A 4CG3A 1KFCB 1C7RA 3SX4A 2J85A 4LQJA 3B60A 4ME6A 2OG2A 4G5XA 1HH4A 3DFKA 3IVXA 4RD0A 2XMGA 2JARA 1NU6A 2QI9C 1YB5A 3T7JA 3FLMA 2O2YA 1T0BA 3MBOA 4L3VA 3IMEA 1DDGA 4G5RA 4H35A 8LDHA 1K5GA 1U9CA 4Y7DA 1X94A 2JLQA 4ZQBA 3ZKWA 3NC0C 2QI9F 1DEKA 4MIOA 1UDAA 3OSZA 4TTAA 5ADWA 1X7YB 3HDVA 3WB2A 4A2WA 5CPFA 3UQZA 3HSKA 3R6LA 3ER8A 2C88A 3K9CA 2EIHA 1TA0A 2QTWB 1R4NA 1Q74A 1F30A 3JD1A 4MVJA 2XBMA 3ZU6A 3R2MA 4YV7A 1XC7A 4J9UE 1CQIA 4YWHA 4XUCA 3SJBA 4IDHA 3HXLA 4B73A 3VZQA 3CT4A 2IYRA 3KSRA 3NV9A 4LCBA 2QORA 2O3QA 1LI7A 2WF7A 3EBPA 3CR7A 1L1EA 1MMFB 5IUNC 2OE2A 2G82A 1L5YA 3PSAA 3WWEA 5P21A 1BEEA 1F6WA 3C1OA 1T6ZA 1RRKA 3HYNA 3WLTA 4CT0A 2UXDB 5BT8A 2IYAA 2FEAA 3WNDA 2NU9A 4RJKA 3U3JA 4EA6A 5L9AA 1G1AA 1HG1A 1PN3A 4QPJC 4W99A 2VNAA 3KVOA 4UBJA 1IZ8A 2AVNA 4AFNA 1OH5A 4M34A 1U2DA 1XDGA 5JG7A 5JRJA 5KZMB 5JS1A 2V98A 3GP3A 5ITSA 5J5CA 4RC5A 4ZKWA 1IHOA 1O6ZA 1C7ZA 4MB0A 2C4UA 1Q16A 1EWVA 2JFWA 1UBLS 4IS2A 1GTSA 1ZS3A 1QIEA 1NQTA 3DONA 4IVRA 1LNSA 1H2XA 4KVQA 1VSTA 4UDOA 3ICEA 5GU1X 3GC6A 3VYUB 2XGGA 4Q1AA 1A9XA 3GOQA 1C1XB 5CIYA 4QYSA 2H00A 1BHSA 1LBQA 4K5QA 2AZXA 1D6SA 4MS3B 4GF5A 4X92A 1L5RA 5CM8B 4EPTA 3EXG1 3HL1A 2B4QA 1IOVA 3CJTA 2HMSA 2Y1CA 2ZYDA 4J43A 3TZHA 4M22A 1HYBA 5DBGA 4DLPA 2Z6QA 3WI7A 1JFLA 1LW6E 3VNXA 3C1ZA 1RQRA 2ATCA 3JQ7A 4QATA 5DWDA 1J42A 4R68A 5LPNA 2P7HA 2L17A 2NAPA 1CUEA 3EZ9A 3GFTA 3BG5A 3TB4A 1QO9A 5DMHA 5G53C 3RVDA 1VP3A 2JHPA 4B31A 2R1UA 2O20A 4HUTA 3VR5D 3L49A 4G8CA 1PFKA 4KQ1A 4W7HA 2HRBA 2XWJI 2POCA 3EGDB 1VGVA 2XMQA 4C6TA 5CG1A 3JV7A 4QXPA 3NJ4A 2XTNA 2FHAA 3DQPA 3HBNA 3FPBA 3L0PA 3QA3E 3WS7A 5KQLA 1WDTA 1IUPA 3WKCA 5JJCA 1QFZA 1GLNA 1YL5A 4EB3A 1S3IA 1POWA 2V8UA 1E3QA 1CF4A 4UCQA 2QZPA 6ADHA 1ORDA 4KGDA 1YB2A 4FCWA 4IW3B 1FP4A 3H9EO 4A5OA 5BMVF 5I9NA 5KMGA 5SZIA 1AA9A 3VC1A 3T35A 3Q3CA 1V5WA 4B71A 1LFAA 1EESA 1I5OA 3IUNA 1ATIA 1T2NA 1WZIA 1YI8A 4IIXA 3C98A 4QXAA 1K0FA 4R1PA 3UAGA 4C0QC 5K45A 3M3PA 4TTJA 3B53X 4NV0A 2GCOB 4B6GA 4DIDA 4N1AA 4Q3OA 3KUKA 1UOOA 3C4JA 1GQFA 4GQAA 5SZHB 1FZTA 2O7SA 3MS4A 2CKDA 1OIWA 2IHVA 2ODQA 4AX4A 1D6MA 3FPLA 3FVRA 4FNAA 2VYNA 3IS7A 4QUBA 5EIWA 5EMMA 1MTOA 1OLXA 2X8JA 4E51A 2G9RA 3UB3A 1WVGA 2BFDA 1XZ8A 3ADOA 4NI5A 4PO9A 5T57A 3GLGB 1KI9A 4BMOB 2E85A 3WADA 1KP9A 5AXSA 1M6HA 1N0WA 3VDNB 2R6GA 3B9BA 1NXQA 3CURA 4MO2A 4K8RB 3GA7A 5L8VA 3CUKA 4GE0A 2RH8A 3TBHA 2R6HA 2ZBUA 4BFXA 1QK3A 1FF9A 4HY3A 4BB5A 4C7MA 3K6SB 1C29B 3RS9A 3HFSA 2HZ7A 2LE0A 3T9DA 4DYVA 1U7WA 2H1OA 1E0AA 3LLVA 1WB5A 3MQ2A 3T61A 1T0IA 1W19A 2A6PA 2QUAA 2Z1MA 3QBTA 2D2VA 4G0OA 4JU9A 1RXSA 3W5IA 5B57C 1AEWA 1BWPA 3WYFA 3JALB 3L4BC 2X5OA 4JU8A 3JX9A 3UKOA 3CX3A 3OURA 3EK2A 5L7WA 3FB4A 3KHSA 1M72A 2O3UA 2X13A 4LHSA 1A50B 1ZBQA 1JR3A 2EW1A 4S2UA 2VDQB 2XX3A 4I66A 5CJ2A 4IP0A 2GBPA 5I7VA 4L8FA 4UD2A 4CM4B 1GAQA 2HWXA 2NACA 2DFVA 3VISA 2JFBA 2QK4A 2R79A 1RYHA 2HIHA 3FPEA 4AMUA 2Q7DA 4HUJA 4PFJA 2DPGA 2WDZA 3F7TA 4DCGA 4DLAA 3ZD7A 3DVSX 1WP4A 4QUIA 4U7HA 1JPNA 3F6BX 3K9GA 1DAPA 3F5FA 3OQIA 5J59A 3Q41A 4X97A 5EXXA 3AERB 1S8OA 1JR2A 2IKSA 4H6PA 3SZRA 3DT6A 3II6X 4DV3B 4QNNA 2PL5A 2Y71A 4FOOA 1TU3A 5FO1A 4D4JA 4DRZA 2DPYA 3DGEC 5ILGA 4TGLA 4TMYA 2W2NA 4GOXA 2IPNA 4O4HA 3FF1A 4R8RA 1E7SA 1PJTA 1ZHFA 3FHLA 2RARA 2WRZA 4MWCA 1VJTA 3PRKE 4FQ7A 4DVGA 4UU0A 4IXDA 4KNYA 2ZE6A 2LP4Y 3PQ4A 1EVQA 1C3XA 2C0PA 1BKSB 1K5HA 4A3SA 4L0CA 2AOUA 5IJ0B 1V5IA 3LWDA 4ZA2A 4JJ4A 5EP4A 4WRRA 2BC9A 1N6HA 1RR6A 2PBRA 2QN8A 2X0IA 4IIEA 1X92A 1RQLA 4CQLB 4EB8A 2BSAA 3S40A 3UJPA 3HVUA 1CEEA 5GU3X 1AGYA 3UAVA 1V5EA 1H66A 4W9NC 4Y9DA 2V7UA 3KV1A 4B9AA 5BSMA 1R4AA 1JGCA 2BJVA 2ORYA 3EEBA 4C7VA 4QFBA 1UMBB 2QLFA 4QTYA 4UXHA 3O6VA 1HUQA 5BSKA 2HRDA 2JGIA 1LEHA 1EVEA 1W88B 2JK1A 1EFTA 1IWPB 3G17A 3KU4A 4ZYWA 1Z7EA 1I6MA 1QCDA 1JV2B 1I9CA 3BWEA 3PC4A 1A2OA 1SXJC 5ALNA 2VEDA 4ON9A 5C8YF 1M1NB 4L76A 1MO4A 3EDYA 1SHUX 4LIPD 4WOKA 1F4VA 2PGXA 421PA 2V0GA 1QGUA 2VSFA 2BEKA 3EUEA 3IAS1 4P80A 2QU7A 2X7HA 5FQOA 1RXEA 1BJKA 2BFFA 3FMOB 4MW9A 3GRZA 4R2LA 3S6JA 2Z90A 2OCBA 5T6MA 5CT5A 3JD4A 4U8HA 4CRWB 3CNHA 4FFOA 3V6LA 4PZ0A 1CLUA 5E1OA 3RE1A 1O57A 2J1LA 4WLEA 3GDFA 3AUFA 5EUCA 4RADA 1Y3IA 2FG6C 2HJVA 3TTSA 4EKNB 4F7DA 4N41A 1M10A 1YR6A 2BFBA 2V65A 3TEMA 4A73A 3BCSA 3S2SA 5B6IA 3VZDA 2UUAB 1LPBB 1M6WA 4L5CA 3PTAA 2OHHA 2XB4A 1DG3A 2VXYA 3I09A 4JLJA 1LRLA 3VA7A 1G20A 3RYHB 2AFHB 2IJGX 4KVZA 4BU0A 2RG7A 2P6PA 4B85A 1I2CA 3OFND 1P0FA 4LTNA 2MINB 4NAHA 3VO8A 3K9HA 1X8LA 1T0UA 4K8OA 1GKIA 3HPRA 2RDMA 2SKCA 3KB6A 4DLXA 4OHWA 2JH9A 1KDZA 3PX3A 3WWOA 1VE9A 4PM4A 1NXWA 5LIPA 2P3QA 3BAFA 1CQZA 2YJZA 3MW8A 4PSCA 5CYPA 3KFXA 3KWJA 3U17A 1M34B 2FPRA 1X7XA 2ZRGA 4I1VA 5I4IA 3I1YA 2IYVA 3LXRA 3H1GA 3JQ9A 2ZPTX 3MYYA 3EZ0A 2FN8A 3FN4A 4J8PA 4PC6A 5AW5A 3ITNA 8ATCA 5C46F 4MJ3A 1N2HA 5AOCA 5BRNA 3C0KA 3WLIA 1EUZA 4FFWA 1DX9A 1H65A 4MROA 3OLVA 3HLTA 3P1JA 3VNQA 2IW1A 3ORHA 2Q3EA 1EJ6A 4YALA 1PZFA 2B9VA 2C04A 3OQHA 1CW2B 2IEGA 2NV0A 4G3XA 2X2EA 4MS3A 4UEOA 1FJ2A 4BP9A 4KE6A 1XXHE 1CYDA 3CBGA 3I6YA 5JKMA 1UWVA 3DEYX 4LMRA 4P93A 3ROPA 2VJYA 1QP7A 3LX5A 1GFIA 1N5DA 1ZJ5A 2WLSA 3RE7A 4QYTA 1E32A 4LE0A 3SS9X 1QAOA 2ZWOA 3QK7A 1EDEA 1XQWA 3DXYA 3E3OA 1R4MA 2IFTA 2XUJA 2D2EA 2P5UA 2H5EA 3DOFA 3N0WA 1W1IA 3GAZA 3O75A 3QKWA 1S2NA 4XFJA 1UMDA 1YU9A 2BFCA 3CF4G 4FW8A 3WDSA 3TE6A 4A8TA 4B4OA 2CKMA 4B6QA 4D3YA 3KWOA 4PZEA 1WP9A 3H2KA 3UV6A 5HJ2A 1D2AA 4EQZA 1XZDA 2V8OA 4MQMA 2PUDA 1C3OB 4GKVA 2IIVA 5DRTA 1YFZA 2EKLA 2GF9A 5LJIA 2FPOA 3E7DA 2OUKA 2XRFA 4JLPA 5DW0A 1EM6A 1PEKE 3VO1A 1DC8A 1NBMD 3BUSA 4D46A 3HV0A 1EPUA 1LUAA 5JNWA 1XMQB 3T5CA 1I7SB 2VPXA 1U11A 3VMFA 3F6EX 5TY0A 1ZRMA 1RZ3A 4MGYR 4IIGA 4RVNA 1T43A 3WK6A 1OBVA 2VJMB 1PDOA 2XDYA 1RHUA 1RM4A 1Z45A 3Q0EA 5J40A 4RHTA 4FIDA 4GLFA 4GXQA 2CLMB 1IIRA 5AI5A 1NRIA 2R4QA 1R8QA 2REXB 3KQNA 4PGGA 4KACA 4KXQA 4C0BA 3QLVC 3CF0A 4F9EA 2NXCA 5EZYF 3CUWA 4I1RA 4OQDA 4MRRA 5DM60 5GQSA 2PXAA 3V4VB 3FRRA 1WSBA 4Q37A 3ISFA 1XPUA 5G3YA 3QKSA 1W49A 5A4AA 5IFLA 1K8RA 3K5PA 2GGSA 3QBJA 3H8SA 1DE0A 3B85A 3F46A 3NUZA 4Q16A 1H2WA 4F9TA 4F97A 1GTZA 2HSJA 5EJGA 2ZK7A 3RVNA 2JZCA 2IDMA 2LCQA 4XM1A 1SXJD 1GZ6A 4L6CA 2FFXJ 1LLFA 4ZZ2A 5CEFA 3EXHA 1CSEE 3P2IA 3OPMA 4E3ZA 1OMOA 2RK3A 4C4PA 3UAYA 5BQFA 1GSHA 4EUFA 3EIUA 3GJYA 3DOEA 2Q1UA 2NU8B 3UFXA 3L4EA 1UM8A 2XVMA 4F3CA 3E9EA 2JHGA 4RCYA 5LP1A 4HP8A 5IBCA 2R6R1 3K0CA 1XWIA 4FDVA 1CUZA 1WHSB 5HILA 1UPXA 2CZQA 3MJDA 4RZSA 3QW2A 4RAQA 1A77A 4YJKA 4EGSA 1IN7A 3GEHA 4YECA 4N3AA 1J97A 5H59A 2VDKB 1H5UA 3F39A 1A9XB 5H9VA 5IJXA 3QTLA 4X9XA 5AK4A 1S8FA 1GJRA 2H06A 2IHYA 2Q5LA 3INRA 3HDGA 5DHUA 4JQZA 3ZGXA 5B36A 1Q7CA 2YJKA 1TLLA 1XP8A 2V6FA 2WWTA 1KS2A 2XRYA 3OJ0A 3DFMA 1IJBA 1ACJA 4IDQA 4RA9B 5DXFA 3PTZA 3RIXA 4AD8A 5JYCA 4D3DA 3CWZA 4ACBA 3E3MA 1B43A 1S2ZA 1ZMBA 2PSEA 2YYAA 1W4AA 3U16A 2KHZA 1J07A 1YZYA 2IUFA 3TL6A 2XOKA 2JRLA 1PI3A 1XJWA 2W2VA 5FV7A 4BX2A 5JW6A 2C2KA 2W0MA 2VBFA 5LMZA 1I5RA 4NDZA 4R8KA 3MTQA 1VPVA 1OQAA 4BEJA 2E37A 2K5UA 2PXHA 2XOKD 3QMMA 4FGKA 4HPXB 3VR4D 1QWSA 1R8XA 2RJNA 4ACAA 2O14A 3AR4A 3QX9A 1ZMTA 1Z0SA 3L01A 4Y30A 1KEZA 5C2JB 4ZALA 4N8DA 4QQKA 3TX6A 2VDUE 1E98A 1WABA 5JNLA 1R4NB 5EEHA 1VCNA 1IEXA 1N5MA 4M7WA 1C9MA 3LW8A 4Q1FA 3DAPA 3DB1A 3C5WP 4POAA 5CLGA 1JU3A 5LLSA 4F4CA 5BP7A 1WDWB 3M6XA 3ZWKA 2P75A 1WDMA 2A5LA 4TKUA 5BN4B 2GBLA 1C8KA 3DAHA 1C1HA 3KZKA 3WICA 2PJUA 4HVLA 2WOOA 5AMXA 2ECFA 1WETA 3IKMB 1AOXA 3THYB 1E69A 2JGAA 2W6CX 2X3FA 3ZBUA 4CMAA 1X8JA 3LOPA 1ZDMA 3W3AD 2XWQA 5HFNA 1CFZA 4DR5B 1GUDA 3OWHA 3K09A 2HTFA 3LUJA 5D87A 2EWWA 1CUWA 3H1FA 3QPUA 3UMRA 4R98A 1BJRE 4IDPA 5ESXA 1CF9A 2SCUB 2HA4A 1P4HA 1PQ4A 1PD0A 4OUDA 3ONDA 2W2XA 1PZMA 1WV0A 3GPDG 2QJRA 2JASA 3R0JA 4WNYA 1NP3A 4DC0A 1EGQA 2G40A 4GKBA 4I50A 3TEFA 4RF2A 3ND9A 1ZVQA 3LPNA 4ARUA 1MKYA 3RC7A 2G5GX 2JLRA 2VNIA 2YY5A 2YXLA 4PCVA 3AJ8A 2I7DA 3X1KA 4F84A 4XKTA 1QRUA 3MCUA 2P9ZA 5IM5A 4N0MA 3UJAA 3QX7A 4X1KA 3WNWA 4D1YA 3EFOA 5F3DA 1Z38A 4EL5A 3FKSA 3BGOS 4MRSA 5DASA 1UDRA 5DTIA 5HP4A 2PTGA 3FTNA 2OCYC 3OKPA 3A28A 3IEPA 3VPBA 1W7AA 3VOAA 4XX1A 4E5UA 1SXPA 1DKMA 4LNUA 3N7TA 5FBHA 4DWVA 1BX0A 3CEHA 1DDIA 2RGGA 5K4AA 1XRJA 5KHLB 1PTKA 3BN3A 2ZYGA 5HZHA 1M5RA 1FVFA 4NBTA 1CR4A 4TMKA 3RYCA 1MJHA 2YQ4A 1I0ZA 1KDTA 3QH4A 4QUDA 3LCCA 4XGIA 4E4YA 4QG3A 1KJ8A 2EFEB 1WSDA 2XUIA 3DEZA 4MXDA 4PAWA 3WWDA 5EKTA 4UZSA 4L78A 2CGEA 5JWRA 1L4GA 2VAWA 2WSLA 3RG8A 3W2EA 3IPYA 3PJGA 3PVRB 1DNPA 1E1RD 1VIDA 1ZITA 2WZDA 4JT8A 1KO4A 3E4DA 4MCJA 2YDYA 5FLXA 2D4AA 5B7QA 1TK6A 4BFWA 5BUZA 3DE5X 3C41J 2ACVA 3T9EA 4RLQA 3U0BA 5CD1A 4Q18A 3ZDYB 1IH8A 1P5ZB 3GVYA 4DDHA 1E1DA 3WLFA 3EE6A 1FK8A 1XRMA 4BRSA 4JJGA 4OFXA 3G5AA 2I67A 4X44A 2BKEA 3PCXA 3PZRA 3V4SA 2JZOA 1H85A 2AVDA 3JQQA 4X3CA 2HU2A 4TTTS 3W4JA 2Z5QA 3BL8A 3DPSA 2WJYA 4QRIA 3PSHA 2WAYA 2I2DA 3PDIA 4CCYB 1TIBA 5EGNA 2QRHA 3MB5A 3SQMA 4TW3A 1CUHA 3U7QB 2AG5A 4JOCA 3WLMA 4R31A 4FKZA 4DCOA 4TM8A 4D3ZA 1LGYA 1NLFA 3ZU3A 2JBWA 2UYGA 1SVIA 5CP8A 3BRCA 4MR7A 5JOQA 1I7NA 2C41A 1NF3A 1SUAA 1QK4A 2EQBA 2TMKA 1UMDB 1NVAA 3GNTA 4NBWA 3IGFA 3JR7A 1T0PA 4JJKA 1GUYA 4R0NA 2M6RA 1WQ3A 3X1DA 3CUYA 3S2FA 4FSXA 1RWNA 3ZJ5A 2IV3A 1WY7A 2C7OA 1EE1A 3EVTA 4MGZR 1E5TA 1W4CA 2FEXA 1L7QA 2W8ZA 4FT4A 4NCBA 1NJ8A 4G0XA 3UBMA 4E70A 2XRZA 1UXJA 2GNPA 4G0ZA 3K2EA 3BREA 1KO1A 4RC7B 1HDIA 3OKAA 3DMNA 3CKYA 2J3HA 2B61A 4PANA 4BO9A 2Z04A 2PS9A 4RHXA 3W9BA 4RF4A 1QANA 3ETNA 2RB5A 4W82A 1PV2A 2QRVB 4Q1VA 1H8HD 1WV1A 3EXAA 2ONCA 4FOLA 4WACA 1W94A 1QOPB 2ZG9X 1CRQA 1MHPA 4BFVA 2MMGA 4M49A 2C5LA 2RHLA 3H97A 1K2VN 2JB9A 2WTNA 4OPMA 5C51B 4I99A 2IYYA 3AOEA 3OQIB 3P0EA 4R3NA 2FMKA 2RE8A 1FFEA 1DXOA 1MTZA 3QMWA 4FE7A 2NX2A 3FCXA 3KCQA 1P9LA 4TTIA 2P69A 4XYGA 4KITB 1HNWB 5CLJA 1M1ZA 2YJNA 4FYWA 4EY6A 5KOYA 1A7UA 2C3YA 4DQLA 1I6WA 5HCNA 5K8IA 4U2GA 3PVYB 2FSHA 5JZVA 3K9NA 2FZVA 1FE8A 2EFCB 3R9XB 4DCUA 3ZNNA 5DCYA 3OU6A 5EXEA 1LQ2A 3P9PA 1TD1A 1NN5A 3DZHA 4HDAA 8OHMA 3ASUA 2QAGA 5E38A 1ISGA 1WNFA 1IVNA 1MXFA 1XT6A 1YA8A 2F43A 2QJTA 3BBLA 3DZDA 1YUZA 3JVVA 4JLBA 1N4DA 4GPZA 4CT4B 4CTOA 5E1UA 2RIRA 3ZCPA 2CDAA 4DWWA 2IBTA 1ILEA 2ADFA 1JKUA 3JSAA 4RUKA 3U44B 2H18A 1NV9A 3L6EA 1C9DB 2FG4A 4X63A 4PNZA 4H1TA 4IDFA 4NAUA 2UKDA 3AF0A 3EZ7A 1JXQA 3QXSA 2OO5A 2OQVA 4YJGB 1UJ6A 2W2PA 2QNRA 2OWDA 3VHXB 3VR6D 2JFVA 1M1XB 4X91A 3M82A 3CX7A 1JHQA 3TWOA 4C7OB 3LAWA 1T13A 5DGCA 1W36B 1XTIA 1B8VA 3K0AB 3BZUA 4DT1B 1QX3A 2G4HA 1SOUA 5BVHB 2HSGA 1JVSA 1XVIA 3A1DA 3AFGA 2NAFA 2B9EA 1U90A 3GB9A 5G40A 4ABTA 3W79A 4JI6B 2VK4A 3WV5A 1GU0A 2WYVA 1M8FA 2QIPA 2XEXA 2QTZA 1AZWA 2HRRA 2P4SA 2IHKA 1LH0A 1OVGA 3L18A 3LP6A 1TMOA 4AX8A 2PU7A 4RZIA 3NEYA 2HHHB 3TW8A 2PUEA 2LR0A 2PLAA 2GMWA 3LCRA 4WXYB 1PGQA 3EY4A 4C1BA 1B3RA 1R9NA 2OHOA 4BBAA 4C7JA 4DAOA 3KSUA 2Y0PA 1HL7A 1BD4A 1U0FA 1YCFA 2BFBB 2W6JA 1S1MA 1M5TA 3ADBA 1EWYA 4Y6GB 4UTRA 1L7XA 1YMVA 3VR2A 1RPNA 1ZQ1A 4JKYA 4BFSA 2XKKA 2EJVA 5TIIA 2I4NA 4EUKA 4ZICA 3MWEB 1ZK0A 4UHJA 3RVSA 1FDSA 4RF3A 4EAQA 5GGYA 2I1QA 1Q5PA 2OORC 5L3SB 3VDXA 4DR7B 3CZCA 3T7CA 3GARA 1VE6A 3NHWA 5KTOA 1U9IA 3HVRA 2AQKA 5EQTA 4BQRA 5BSHA 1CEXA 3KKOA 1JVBA 1VLLA 2PCLA 2K6GA 1UFKA 4QEDA 1T5OA 1NBHA 2FOXA 4HGNA 4LHZA 5EQFA 3PIRA 3FNQA 2P77A 2IRWA 3SVZA 2AXQA 3CIFA 4KLCA 4R9SA 3KPYA 1R15A 5I47A 4LXGA 5ARBA 4LYXA 3QFTA 4G09A 2Y66A 5JMTA 1YZUA 2HTNA 4P3XA 2YBEA 3QZ3A 1GXSB 1FQJA 3HBJA 3LV8A 4OP1A 4AICA 3I5MA 4B3DA 3FD8A 3I83A 1UPUA 1R18A 3DQQA 4GPEA 3SBOA 4D8VA 1PQUA 2NSJA 4LRSB 2FPKA 4INAA 1JE0A 1OD6A 3URMA 4FWTA 2XITA 5BPHA 4LXIA 4MHTA 2I62A 2NW6A 3BVEA 3MJRA 2PSSA 1L4FA 4JC5A 5L6LB 4QIHA 1JT2A 1JEQA 2F1RA 1EK2A 2YIVX 4L9AA 5AM3A 2IS1A 4JT9A 3AF8X 2UVQA 3GLUA 4Q4LA 1XTPA 2EV9A 1DPFA 3S3TA 5DO9A 1E7MA 1DKPA 2MYPA 2XV1A 3VYSB 2HKIA 4W5QA 1N3LA 2DKFA 3WL8A 4K3UA 2PYBA 1Z07A 3R24A 5E9QA 3F9CA 1PF7E 4MI3A 2OCKA 1L7PA 1SHTX 3BERA 3L05A 4QRDA 5JRZA 2F1OA 2GK7A 4AJ9A 1KL7A 3B3JA 3L9XA 4P4SA 1I32A 1NAHA 4X7BA 4ZD6A 4G4GA 3A6KA 1FFSA 2ON6A 3OUUA 1H0HA 1R5NA 3EFHA 1K06A 1QG6A 1DARA 5LYYA 4A6PA 1XZPA 4FYPA 1DI0A 2PRSA 4J1TC 4P3YA 4QDUA 2BY4A 1RWOA 3N8NA 1AV6A 4DI0A 1J7JA 1JR3E 5CEEA 1YCHA 3G0DA 2C4MA 2Y6VA 3RV3A 5JNUA 2NU7B 1RE1A 1CQXA 2BFOA 3H2JA 3KJIA 3WVUA 1HG0A 1EFPB 2JIZA 4EVDA 1SVKA 5B7NA 4BASA 3LYUA 3LM8A 3THSA 4FYKA 1WXGA 2VF4X 3GLHB 4K46A 4MWZA 5ALLA 1RYYA 1PTJA 2A0WA 2ONZA 2R8ZA 3G2HA 1OFIA 4DR4B 1C4XA 2R9VA 2NXEA 2BMDA 5GOUA 3EOZA 4PV7A 3EGCA 3A2KA 1II0A 4W5JA 1X3SA 4IILA 4M7OA 3R5FA 5B6PA 3EXFB 1F2TB 4D3FA 4MMZB 1LV7A 2V59A 1TJ4A 1HFJA 4JITA 4WTOA 3RO7A 3DKPA 3B82A 4HH0A 3IC5A 4AF6A 5D00A 4DYHA 4EOGA 1XEWX 1A98A 4HN9A 4FX2A 3O94A 4OMFG 4ENRA 4JC8A 4DY4A 1ZMOA 5A5FA 3DV0B 3BK7A 2NYRA 2UZ1B 4CEJB 2XDQA 3KFLA 1KJWA 1XZLA 3L0IB 1X38A 4LNHA 4N8SA 3SXPA 1GG9A 1N0UA 4LSGA 1G17A 1YBFA 3JQ9C 1Z0FA 5AQEA 1ZC3A 1AVTA 1JXOA 1HSOA 1PEYA 3N28A 3Q4GA 3OAAD 4PQYA 3P0JA 3A0UA 4RVCA 5GPBA 5A4FS 5AW4A 3U3XA 1QDLB 4PCLA 5ITWA 1KDPA 1ORTA 5KYYA 2OB2A 3VH4A 1BCFA 1NQ5A 1CNEA 3IP1A 1W5EA 1OY1A 2ZYRA 3I4FA 4INZA 4JROA 2RAUA 1TTHA 2Q1SA 1CVLA 1AUOA 1JHZA 2Y67A 2ZQ5A 2BZ0A 2OKCA 3OE5A 4LSMA 1EGVB 3ZKWB 3ILXA 5LFAA 1ZN9A 1VI6A 4UMVA 2HR5A 4X64B 1V9SA 2P6UA 2CN6A 3K4PA 2XKQA 4CM8A 3SI7A 2JD70 2AE1A 5BWNA 3HKDB 3EHDA 1Z0ZA 2NADA 4H0CA 3TLXA 4BWVA 4TMXA 4M0CA 4JJAA 4H1WA 5BMVA 1ZINA 2XMPA 5K03A 4RDXA 5E3JA 3V6MA 2YZ7A 3JWEA 4F5ZA 1WX1A 2CXNA 4REQA 3RGWS 2AX3A 2FR8C 1A5ZA 3FSGA 3K32A 5FOXA 2CK3A 3GLTA 4L1KA 1E1QD 3KJNA 5J23A 1ZH0A 4LZPA 3SMQA 2I9PA 3COYA 4L85A 4JJ7A 3U3MA 1UWKA 4CU2A 5HJEA 3DMTC 2A2ZA 1XG5A 1XTQA 1E4OA 3QP9A 3F1LA 4LXUA 1T2AA 5KKCA 1GADO 2IZ7A 2NV2B 4XASA 1XZFA 2V74B 2OFXA 3OTWA 1YVPA 2X4IA 3PEFA 2ACKA 3W5DA 1FFGA 5TGTA 1SXJB 4EUEA 1JLRA 3LT1A 3AHIA 2JA2A 4JH0A 5AM5A 5I5EA 5KTTA 1PFUA 3WGHA 5L7YA 2AEJA 3C6BA 3HZRA 3L7CA 3E2PA 3IHWA 3A6EA 2VSYA 3FSJX 2VOJA 4JWTA 2WTEA 4EW6A 4N76A 3SYRA 5IKMA 1C1XA 2BW1A 2CD9A 2QF9A 1RQXA 3NETA 4YT2A 1BOFA 1IY9A 1R88A 4IXMA 3B6IA 2IYNA 3NBZC 3GFRA 3ETGA 2Q1YA 4MUYA 3GYGA 1TM2A 5C1DA 5TMPA 2P41A 2QL5A 1MJFA 1FTGA 1FFYA 2E48A 3GEEA 5JAOA 1GP2A 1GU1A 1DWOA 2I2AA 1NI3A 1TYCA 3F2IA 2UZ0A 2R1VB 1ZSNA 1UKEA 5AI8A 1WHTA 4EY8A 2G7MC 1DTEA 1T5LA 1PR3A 4LEIA 3JQ7B 3URKA 2WU0A 4BBJA 3C3EA 5EE0A 1JIUA 3GGPA 2D3WA 3OZSA 1I01A 3PGJA 3CW8X 3ROQA 3RS7A 3GEMA 4FLFA 4QM6A 3TW8B 4ECEA 1U0RA 4WZBB 5LQMA 3KYIB 3ORQA 4R71A 1CE8B 1Y8AA 3O3MB 2OMKA 2GKGA 1UFOA 2IK8A 3NJRA 1BQEA 5CBKA 2C5FA 1KMHA 5FFMA 3RRZA 2F55A 1MFZA 1NJ1A 4G8JA 4NE7A 5DGHA 5HS6A 3TJMA 1DTWA 1DG9A 1FS5A 3FYUB 1K88A 3IO5A 2YHBA 3K0CC 4WNAB 3SYMA 1MG5A 5EI5A 5KMGB 2YDXA 1GYQA 4KEAA 4F4HA 4P34A 3TF5A 1NP7A 2R1ZA 3WGVA 4YIKA 1BA2A 1B73A 2BKVA 3IUJA 3OI7A 4A92A 3WZMA 1JAHA 3GLQA 4BGEA 5KVAA 1EJ2A 2HGZA 2RI6A 4FBLA 2J9GA 1N9GB 4C07A 4M1WA 5LBUA 1VPLA 1L8AA 1A9TA 4A0HA 4C7XA 4LOAA 1NVBA 5E1DA 2QBYB 1ECBA 1KYTA 3PNSA 3Q72A 4EZBA 3WOVA 3R7WB 4RMGA 1ANKA 4YC7A 3VNSA 3D31A 1JA1A 1MQ8B 4QLBA 4P38A 2BSQA 1DT5A 2I6TA 3JYLA 1PZXA 1T9HA 1RXUA 1W0JA 1N57A 2L69A 3EDCA 3B51X 5BNWA 3N5KA 4TROA 3OZ7A 3ZGNA 2JAPA 4ZREA 3NV7A 5ES4B 1FEZA 4RWEA 4CTJA 4AM2A 1PK7A 1SELA 2F62A 2MMCA 2W2QA 3GCXA 4R1MA 2FDCA 1XN4A 1SAYA 4FGWA 3EH2A 5FT9A 1MVNA 2DQSA 3U62A 4X1OA 1LVGA 1VGRA 1YHNA 3DR3A 5FFBA 3LP8A 3ABIA 4JB2A 3WB0A 1UQUA 3QWIA 3T94A 4RE5A 3MWYW 4CMEC 3MWJA 3QD8A 1KRQA 4PXYA 5FHRA 1GEEA 1M0TA 4MS4B 3BWXA 3DXZA 3CVJA 3RVRA 1ZESA 3KG2A 2O8CA 1JHUA 1PL6A 1O96B 1BS9A 1QHHB 5WRFA 4YMUA 3EQ6A 1LW7A 3IAFA 3O0TA 4C2UA 3PGKA 1P0MA 1O3YA 2DHDA 1T3HA 3OX4A 2BHSA 1PUXA 1ZD1A 3KKKA 5GZ3A 1PVDA 3FNGA 4LDRA 3T3MB 2Z2IA 3HDQA 1G3MA 2HWWA 4O2AB 2C2XA 2FEMA 3BFXA 1MD9A 5T8KA 3WMFA 3QU5A 2WIJA 3FIUA 1WJGA 4IDCA 4LJRA 1N5LA 3C23A 2IXAA 3ZK7A 4F8JA 4BP8A 4G0PA 1G64A 4MKZA 4OGFA 4F85A 2NUBA 3LE8A 1E2KA 2VA9A 2PWYA 2DH5A 1RMYA 1XD9A 4TPKA 2WJHA 1U8ZA 2NXWA 5BV7A 2HOQA 4QYWA 4FOSA 2XVYA 2VK1A 4X20A 1VHJA 3EBOA 3IV7A 3G2OA 2BM0A 3LLCA 2PAFA 5AVWA 1FUKA 1LLUA 4D4KA 4C30A 1H2YA 5TQ2B 3R9WA 2VT3A 1SUCA 2VLBA 2NU7A 4DNOA 3AHEA 3VR0A 4KE9A 3FOBA 1NDHA 2Q3DA 2R6AA 3E0XA 4KQ6A 4LZNA 1X86B 1V7ZA 3C6KA 4IUYA 1ZA2A 4IEEA 2H9AA 2F7NA 4LPKA 4NEGA 3T52A 4BLSA 1AS0A 3FVQA 5JJLA 1JDPA 3S2GA 1SEPA 4KQIA 1UDXA 3HXQA 1X7YA 2GEUA 2JKVA 3MS7A 5GWXA 2GK4A 5I8PA 4MVYA 1MZVA 2F9MA 3NTOA 2FFJA 1J30A 2IYEA 2O4CA 1ZS9A 2QN9A 2UZ1A 3GVPA 1V6CA 2FI1A 2ZB8A 3HJCA 3R4CA 3AV0B 4UVGA 4DJAA 3OC0A 3HA7A 5GM2A 3R2RA 1LLCA 1YULA 2YFYA 1T9DA 1IUNA 4PYQA 3TRJA 4NH0A 4BB6A 4KR7A 1LY1A 4MSUA 5H7XA 4Z4GA 4ZPJA 3T9FA 4BN0A 5CGQB 1QYXA 3N86A 4O4IA 4EYKA 3PC6A 3ZE0B 4DJFC 4IMIB 1IBRA 1MABA 1VPEA 3JD2A 4M89A 2F48A 4TTRA 1GN9A 3PR2B 2ZI9A 2PUJA 5JYBA 4DR6B 4YVZA 1GIAA 2NZVG 3OQVA 1QIIA 2G0AA 4LBWA 5HIKA 2V8TA 3ZGLA 5GU2X 3VBCA 3ZK8A 3M5DA 2NUTA 1M83A 3FOFC 3PFKA 1RTKA 2Q21A 1GCOA 1S2GA 1GXSA 3DAYA 4ZVRA 1L4EA 1V3QE 2OCXA 3IOBA 5HZGA 1YBHA 5KKAA 5CK5A 4M98A 3QVVA 1ZH2A 3KSBC 5IYZB 4X84A 3T7IA 3J81k 4X54A 1K7FB 1TVKA 2J6IA 1N6PA 2JJ2A 2NO1A 2Z4SA 4RKWA 5IDVA 5IJWA 3W34A 4TKVA 1K5PA 5J9FA 2J32A 2O9JA 2C58A 2WUWE 1F0YA 3IULA 3LUHA 4DUGA 5BOSA 3ICQB 5A5VA 2IBMA 4ID9A 3WNZA 1RYBA 4J07A 4P7FA 2FK8A 4PPFA 4D82A 5DHFA 4UVDA 1EWRA 3MD0A 1E7YA 3GEGA 3TZCA 4R05A 3R9XA 4YJ3F 3A4VA 3VO2A 3L04A 2AZMA 4YPFA 4EG1A 3IURA 1HDCA 1AG9A 2Z9CA 3ZLTA 1DBPA 3TRIA 5LYJB 3U13A 3WJ7A 3FBGA 3A04A 1DIOB 1O6GA 2ATIA 2WM2A 4XCXA 3UB2A 2H2DA 2XT0A 1GZ4A 4KMRA 4CM3A 5FEJA 2R47A 4IJWA 5HFJA 3CUUA 4OBWA 1O5IA 2O8NA 2UV8A 3N2GB 4KQEA 5AVQA 1JSZA 3MAJA 4KQ9A 1FUYB 1Z33A 3GROA 1A5SB 2VTBA 3OGHA 1MHTA 3HPQA 3C14C 2XIJA 4DA6A 5BWBA 4TVBA 4WXHA 4GLOA 4Q6WA 1VSBA 3UK1A 3KLNA 4M9QA 5JANA 1DXHA 1GCAA 2O6LA 3JPWA 1E4VA 1SNYA 3WQHA 2PT5A 2GA9A 1J8FA 1ZJZA 4FNOA 3EVAA 3JAKA 2W6NA 3UMYA 2FWRA 2RFLA 2XTMA 3HM9A 4NYMQ 5GJVC 1OKKD 2XJ9A 4GEGA 4KMMA 2IV7A 1TF2A 4MUMA 3CJRA 5DGDA 3CXUA 1WTAA 3PCRB 2FG8A 1YDFA 1YASA 1VB5A 3OJCA 2WIGA 4B0PA 3A05A 3IERA 1GWNA 1RLMA 1UZAA 2AS0A 3V48A 3MT7A 3TXYA 4RM3A 1THZA 3I9OA 5EMJA 2AW3A 2FMXA 5IZCA 1M2GA 1CUJA 3ZTWA 5B4TA 3I2IA 5FWNA 3VUFA 3D1LA 1LCIA 2CUTA 4X6YA 2X3YA 2DBQA 4Q9IA 3O7MA 5EZQA 3VU8A 3FMFA 4F71A 3W9UA 3X1XA 1P1IA 3DOJA 5JASA 4UAGA 3EZLA 2X1HA 1YZHA 4MWBA 2H7XA 3RS8A 4C0KA 3RKUA 4WN3A 5EGSA 2EBHX 4JYZA 1COWD 2ZE7A 4N7MA 3RU7A 5JBQA 3WBFA 1FJXA 2XRMA 3AVXA 1S02A 3C3DA 3KJXA 4AURA 4D57A 3AQIA 4MO9A 2V2LA 1CEQA 1VLHA 3D4LA 2Z8YA 2EGHA 5LA6F 1AKYA 1ZAKA 1W0KA 3DYIA 4J0QA 2WOJA 2W2LD 4HQRA 4FX5A 3BF7A 1B8UA 1DRKA 1NDUA 4H15A 4DBLE 1Q0ZA 3PDUA 5F76A 1Z18A 3GP5A 1IBSA 2IDJA 3PXXA 4KIGA 3OZDA 4BNYA 2JPDA 4O29A 3RBVA 5HZKA 2P0YA 5FOSA 2GASA 2X6QA 3QKSB 4OH1A 3UYLA 2C8LA 4CI9A 1HEIA 4Q12A 5AT1A 4ATNA 3CNQS 1TGVA 4ZANA 3LXMA 3L84A 4G1MB 4GPTA 3OY2A 5FPPA 3TLGA 1KJZA 1TUIA 4EUSA 1N77A 2BR3A 3GRUA 4V03A 4FTWA 3KQHA 5BNZA 1KMIY 3AL2A 5AW1A 4EJSB 1FB5A 4AKHA 4ER7A 1HEUA 3O5AA 1Y5MA 1A5AB 2R60A 1ISIA 2PKEA 1Q0PA 4XPIA 1FDRA 2CYBA 3GLHA 2PDAA 4Q0MA 2JD0A 4EVRA 2NU8A 1Y6GA 3HP7A 1TTTA 5AM4A 2REOA 4I9GA 3KR1A 4W8HA 4QTXA 3G9UA 3JQPA 1ZU5A 1IPFA 2DX7A 3P9YA 3HJFA 4KRFA 5KX5A 3IV9A 2HXSA 1YD7A 4TMZA 1SWVA 3Q12A 2L0XA 1CUXA 4OMDA 4OJYA 1KZ6A 1Y82A 3FE2A 3TOSA 3WL3A 3E9RA 1Z5ZA 2H1WA 3T5DA 5AOAA 5FQNA 5KVSA 4AO6A 1TAUA 4II4B 3C39A 3LCVB 4ZMRA 2FMTA 4DMHA 1W85B 3RTEA 1Q21A 1CU1A 1T6NA 1QE5A 3GCDA 2HNBA 4W9MC 5HGJA 1HYHA 4TOCA 2JVIA 2WTLA 4RVGA 4UQLA 3DHEA 5DHSA 1XP5A 3DPUA 3PGXA 4PHFA 2RHWA 3OJXA 1NXOA 3FOCA 4ESVA 1R8SA 2OAQ1 5J4LA 3CXRA 4NFLA 5D6NA 2WNIA 2CCJA 3EOBI 3LKZA 3HEBA 3CLVA 4MYCA 2PWBA 3IMFA 3HB1A 4HRXA 4U7FA 1VHLA 2P4EA 1JU4A 3F38A 3NBFA 4IDOA 2JHFA 1TMYA 1T2UA 4IFTA 3EAGA 4Q66C 3SSNA 1XWWA 4WADA 3D3NA 5IVHA 1ULUA 4JFAA 4R3UC 1EU1A 4EG6A 1D1QA 1X0VA 2GBIA 4N7RA 4EB6A 4IZIA 4PSDA 4BS9A 4QD3A 2QGZA 3ZE7A 1L3CA 1GKKA 4GMFA 1L5KA 1RVDA 4S1PA 1GLVA 1Y3DE 5HMMA 3UB4A 5KYWB 4FPXA 1YZ3A 2QX4A 2DBRA 4WFQA 1Z6QA 2O8VA 4TOFA 1Q2XA 3VRHA 1DATA 1E3IA 1WCYA 1UKCA 1E8MA 2YS6A 1DO2A 5EIEA 2P5TB 3O0DA 3IELA 3BRSA 4BO5A 3LX6A 2QQEA 2HMVA 1PKXA 1ZIXA 2AI1A 3KUDA 4LE1A 4QSMA 4R1SA 3K1ZA 3RIGA 3S55A 4C3ZA 5J3JA 4Q03A 3OIFA 1XCPA 4OJNA 2JIMA 4R9UC 1W87A 4OAPA 1SZDA 3P9KA 3RIEA 5A7HA 4CF4A 2DSTA 1SXIA 1XKLA 4UC0A 1G1MA 1KEUA 4J49A 4PQFA 2CLEB 1U2SA 3R0IA 3LCUA 1NC3A 1TUGA 2V7GA 2ZE5A 2PU5A 1MB2A 2ROQA 4Q24A 3SLRA 2P2NA 4YACA 3UC9A 5BSWA 1MQSA 1KFBB 1ULSA 3HU1A 4N9WA 3SKXA 4YP5A 4UKDA 3CGWA 3G5UA 4I50B 4KH0A 2E3JA 1CC1S 1UBTS 3NP9A 1JKVA 3SHTA 2X23A 1D2EA 4XFKA 5THXA 1L3BA 5D2CA 1J9ZA 3P71T 4TV9F 2WUDA 3VDRA 4GKJB 4JX9A 2OGTA 4H7KA 3MGAA 3ISEA 1VRWA 2QLMA 1F7VA 5CPBA 4OQXA 2H2HA 1USGA 2OM2A 1TVKB 3E5MA 4F0JA 5KDDA 3UGJA 1ABBA 1NVEA 3Q5DA 1WPXA 1BQ4A 4PX2A 5FFFA 3P4UA 1UC4B 5TS2A 3B1KA 3IEXA 2EX0A 1UXHA 2XUGA 3JZAA 3K6RA 4ND3A 4QHSA 5CW1A 1RBQA 2PT7A 4ZKEA 4RSHA 3T12A 1G16A 3NDBB 2B7LA 621PA 4CFSA 4DWOA 2YNMD 5AW6A 2CEAA 1R50A 3Q0TA 1QV7A 2WV7A 2ZBQA 4MQLA 3KAKA 3RPEA 1RJFA 3KX9A 3A4LA 3DOIA 4MDYA 2ZDGA 5I7OA 1TEVA 1HDRA 3IEIA 2ZCVA 4HYYA 3EUFA 2RGRA 4R40A 2PA3A 3LHIA 3WA7A 3VU9A 3OE7D 3VAZA 4CLHA 4CL2A 4PPYA 1WLSA 2YV1A 1QHGA 4MV4A 1L8QA 2OV2A 3B6JA 3HVKA 3MD9A 1MV5A 1AZSC 3NTQA 3TLGB 5DN6A 4DCMA 5JY6A 1R6DA 2QVYX 3PHHA 3BRQA 5LB2A 4MRMA 2C57A 3G8YA 3GMDA 3PYLA 2FK7A 2HF2A 2J0VA 3C21A 4W6ZA 1O1YA 1MVOA 2PGDA 4CNQA 1SIOA 4GI5A 1C30A 2AR9A 4B33A 3OETA 1Y4AE 4G1UC 4J1NA 2PNJA 4WE3A 4F5WA 4DXHA 1U80A 3AIKA 1JA0A 2D5IA 3TECE 5AVJA 1SXGA 4HRVA 1II8B 3NT2A 4HBZA 3ZD8A 3L1HA 5F3RA 1L4MA 4LOKA 4FBMA 3UWKA 1ODJA 4B74A 1IXSB 1GG8A 4AK9A 3DDOA 4KQKA 3CPSA 3AMVA 4UMFA 3RC9A 2IHNA 1DX4A 1Z5VA 3GQVA 3KETA