2PEZA

Crystal structrue of deletion mutant of aps-kinase domain of human paps-synthetase 1 in complex with cyclic paps and dadp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
176
structure length
176
Chain Sequence
RGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetas
publication title Structural mechanism for substrate inhibition of the adenosine 5'-phosphosulfate kinase domain of human 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 and its ramifications for enzyme regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 69
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pezA00
2G1JA 1E9RA 2BBTA 2VSXA 2W58A 4PHFA 1M74A 3G5UA 5A4JA 1AN0A 4QXAA 3CF0A 2NIPA 3VKWA 3AKYA 1AS3A 2QE7D 2F9LA 3B13B 5TY0A 3PCRB 3SJZA 2EQBA 4O2LA 3I1FA 3EA0A 1B23P 2PL3A 2IS2A 2KJQA 3U7EB 2GJ8A 3VR2A 1E0KA 4IVPA 1AZTA 3LY5A 5CM8B 3MJHA 4TL7A 2D2EA 4F93B 3O8CA 3OE7A 3I61A 3MWYW 3RHFA 4MRNA 4AI6A 1M8PA 3OEEA 5M04A 2ASEA 1JALA 3ZLJA 2OUKA 4BRWA 1P3JA 3T1QA 2VP9A 2WVJA 4KVAA 3K0FB 2CNWD 3QVVA 4DLYA 1OFIA 4TMKA 1UJ2A 2CK3D 2XB2A 3K9GA 4YMWA 3RNLA 1G41A 1KMQA 2QP3A 1AIPA 1BS1A 4CYMA 1E0AA 1ZBDA 1KDTA 1LB1B 4KSCA 1KJZA 1W36B 2F1HA 4Q7LA 3UG7A 4U7DA 3AVTA 1ZD8A 3RRNA 1NY6A 1M2OB 1OSNA 4HAUA 5FTLA 3VHXA 3OFNA 2CCJA 2GCNA 3B85A 4L16A 1P61B 3NG1A 2G3YA 2AFHE 3K70B 1E9AA 1D9ZA 4XWOA 3HPQA 3Q72A 2ZR9A 3UK6A 5KNCA 2QQEA 3BFXA 5KYKA 3AVVA 2R9VA 4XOIA 1A82A 3TNFA 1A2BA 1WXQA 3HWSA 4Q00A 1XXHB 3OE7D 2FFAA 2OFOA 4JKYA 1ONBA 1GDDA 4RZ3A 5HCNA 3RS3A 2J59A 3SYLA 4EUNA 4Q9IA 3N70A 5G40A 1N6PA 2IWRA 4BFSA 2GZHA 2IXEA 4ZPXA 2MSDB 4E22A 4PR0A 3HU1A 4P3YA 1T6NA 5FPKA 3U44A 3GLGA 3LX5A 1NMZA 4NCIA 1KKMA 2CE7A 4JT2A 1P6XA 2A5GA 4TYQA 3T34A 4Q9KA 5DLQC 3NC0C 5IK2D 3L0OA 1EXMA 2OE2A 3RC3A 3RSOA 4W9MC 1JR6A 1SGWA 4URUR 4HAXA 4NBSA 1T91A 3I8SA 4ITRC 4URZR 2V6JA 1I4TD 4TMWA 1U0LA 3B9QA 4OI1A 3U3RA 4BFYA 2O0JA 4DSNA 1RIFA 4CEIA 2RKOA 1W4AA 4DIEA 5J4HA 3NHAA 3UWOA 5HZHA 2C78A 2IS6A 3A8TA 1QHYA 4QC2A 1W36C 3FFAA 4A6XA 2LKDA 1XCGB 3KL4A 4MRRA 2WAXA 3MGCA 1XEFA 2GEUA 2V8OA 4HAVA 2UKDA 2ZUBA 1AGPA 2BM0A 2VSOA 4LSGA 1DO2A 3B78A 3ZQ6A 4KFRA 4BLRA 3ND9A 2OAP1 3C4JA 4AIIA 2X2EA 3TW8B 5JWRA 3V9PA 4KSBA 1MO6A 2VA8A 1PUIA 4A0GA 1Z3IX 3FMFA 2WM9B 1JQJC 3CR8A 2ZJOA 4IFEA 4CZ2A 1SXJE 1LS1A 1Z6AA 5FL7D 4EPTA 3LH5A 4TQ9A 2C99A 2DWOA 1NVVQ 4GZMA 4NL4H 2VL7A 2PLRA 2QMEA 3H4MA 2GKSA 2HJVA 4TLCA 4JVSB 1U2RA 3UANA 4A8JA 4KBFA 2AX4A 2B7BA 5KPJA 2QGNA 2Q9AA 2YJTD 3W8RA 2G77B 2GAOA 4FCTA 4BZPA 2F1JA 5SZHB 4KLZA 1CJKC 1SULA 2E9SA 4TZ6A 2O8FB 3TSOA 1CEEA 3CIOA 1FL9A 1NVUQ 2G83A 2V7QD 4LHWA 1XJ0A 3GEEA 3Q8XB 4Q9JA 1KI3A 3HDTA 2KB0A 1U99A 2ZI3A 1Z07A 5CIQA 4KI0A 5JRJA 2JA1A 2OCPA 1G64A 3M1IA 1ZM9A 4ZO4A 1E32A 1AM4D 1EWRA 1HEIA 2PEYA 5FBWB 5CJPA 2XTNA 2A9KA 1MV5A 4F38A 2IK8A 1MKYA 1YU9A 1ZP6A 3AUXA 4P33A 5GJWC 4JLOA 4DDWA 2JJ1D 3CKLA 3L0SA 3EWSA 4JMPA 1Z22A 4DJTA 4M53A 1OXTA 5TXGA 1IN5A 2FOLA 3AV0B 3IGFA 4HUQA 3TSWA 4LJ8A 3QEJA 4RZUA 1U98A 2YWHA 4AWXA 3AKDA 5K8LA 1TF2A 3I3SR 1XPOA 1V5WA 1QHHB 3QKSB 2Q6TA 1IHUA 3SE0A 3T61A 4BASA 3FHCB 1I2MA 4FCVA 2AXNA 1F2TA 4OI2A 3U2QA 5J4KA 5J47A 1SXJB 4A2PA 2OXRA 1RJ9A 3IO3A 1W0JD 3GD7A 4TL8A 1BYUA 2I4IA 3CNLA 4LHYA 4PPGA 4BFZA 2O5VA 2IYXA 4DLZA 4MRSA 3K9NA 4AK9A 2YVUA 1LF0A 4IXNA 1KK2A 1VCNA 1OB5A 5AUNB 1YJ5A 1G6OA 2OCBA 3IQWA 5DHAA 4A8JC 1SXJC 4TSFD 5EE1A 3QG5A 1HURA 1H8HD 3CWZA 1P9NA 5G3YA 1EFCA 4QNMA 4JIMA 5CJ2A 1Q3TA 1EK0A 1FX0B 1OFTA 3AVYA 4LI0A 4RFSB 1T0HB 1X3SA 2MMGA 4A4DA 2NPIA 4N0DA 5TARA 5CITA 2ATVA 2JLUA 2AFIE 1MH1A 2RGGA 2QP4A 3THYB 3C5CA 3E1SA 4IXMA 3FB4A 4ACAA 2EYUA 1XTKA 3DZ8A 1JECA 2B21A 3FHOA 2ZUDA 3KQUA 4A0HA 4JS0A 3AKEA 3QG1A 3RC8A 2Q3FA 1XP8A 4IOMA 3WY9A 5JI2E 1JEDA 4GDFA 4B35A 1ZM2A 4OQNA 2QNRA 3I4LA 1U9IA 4PO8A 5J40A 5C4GB 1OB2A 1KI6B 1Z0IA 1TNDA 4BECA 5L3SA 3VQTA 1BKDR 4DEXA 4BGDA 1G3UA 1M7GA 2FPLA 2MSCB 1A2KC 3J81k 5FH9A 5FBRB 4RKEA 1KSGA 4G5OA 1E2JA 1NSFA 1VYTA 4DDTA 5FBLB 2XX3A 3QENA 1UADA 4U5XA 4DC9A 2ZANA 3IUYA 2WJHA 2QAGB 5G41A 4YMVA 1Z83A 3FPAA 4HLCA 1G4AE 4JLVA 1OHHD 3B7GA 2IYRA 1WE2A 3SOPA 5B30A 2C9OA 3L0PA 1N5LA 1G3IA 4Q4JB 1DTSA 2OCAA 2QPTA 5AK0A 2HV8A 3FYHA 3DMDA 4YDHB 3WRXC 2JAQA 1BMFD 1ZU5A 1K5DA 4KAXA 1E96A 1E2HA 4D4MA 4IOJA 5KO2A 2ZRNA 5IHPA 4V0NA 2R6FA 4PC1A 3K1JA 2XTMA 3X1YA 3AP2A 4LHXA 2J7PA 1II8A 2IF0A 3X1DA 4F7WA 2J0SA 2F43A 1NG9A 2ODBA 1EFRD 2D74A 1NJGA 4TQAA 3C41J 4BEBA 3IO5A 3MAAC 4PQRA 2QMOA 4D4LA 1WB9A 5BN5A 1XPRA 2BEKA 3K09A 1GUAA 4GBMA 2AXPA 2G0TA 3K9LA 1W49A 2ZR7A 3A1VA 3KJIA 4FMCB 1OF1A 2JIZA 4DB4A 4HDQB 1O87A 2WPDA 5CDFE 4B6EA 3KJEA 1VECA 3TIFA 1GNQA 4EJSA 1E2FA 4S2EA 4EJSC 4Q4AB 3OESA 1G20E 2OV2A 4UNSA 3Q3JB 1LW7A 4PX9A 5DI3A 1ZUNB 3A6PC 3GLHE 5J4YA 2QQ0A 121PA 3KX2A 3BK7A 1L8QA 1G5RA 2TMKA 3HU2A 3KQHA 3CF2A 3AF1A 3IKJA 3B60A 3RRMA 3KFVA 4JLJA 4DDUA 1G3RA 1F48A 5CYPA 4YMTA 5H8WA 5K8IA 4Q5IA 4B44A 3GLFA 1OYYA 3K0AA 3E5HA 4JSYA 3VNVA 3RLFA 3I32A 2WOJA 4Z1MD 4WXRA 3THOA 1E9CA 5JJKA 4EKDA 2ZROA 2ZRIA 2HF8A 1XX6A 4Q1EA 5B57C 1G8YA 1OYWA 4UNQA 4YDSA 4OHVA 3WMGA 3D6TB 4IDNA 4XTCS 4TYNA 2IYYA 4MYCA 3SHFA 1XU4A 1QVAA 2PLFA 4QKQA 1E94E 2KWIA 5KSYA 3S1AA 2L0XA 1Z8FA 2GF0A 4Q1DA 4DWJA 4DSOA 4YLGA 2GILA 5FOVA 1V43A 1KKLA 2GBLA 4Q66C 2QROA 2OFXA 4GOJA 1D2MA 2GETA 2HDNB 1TTTA 3PITA 2BIFA 2W83A 3K53A 2EFHB 1XTRA 4LJ6A 1G3QA 4OI0A 1U8AA 4RCYA 2QBYA 4GI7A 2FX3A 1T4GA 2AD1A 3B1VA 3DEFA 1E4YA 4WW0A 3MWJA 1QHXA 4MH0R 4M2LA 4GOXA 1OIXA 4MDFA 1E2KA 2VQSA 1D8TA 2F43B 1PV4A 4C7OA 3NDPA 2BWJA 3RWMB 4LY6A 1GKIA 1OLOA 3P20A 1JI0A 1OHHA 1Z2CA 1IJEA 2WBLC 5FUXA 4RKFA 3VTKA 2JLQA 1NNEA 5EUQB 3LVRE 4OJKA 4DDVA 821PA 4JBYA 2CNWA 2WSMA 1FQKA 5GJCA 4A0RA 1OH5A 1UKZA 2FFQA 4Q7KA 5KDLA 1M7HA 4L8GA 2JJ1A 3LA6A 4TL6A 1AS2A 4PXAA 1ZIPA 3EPJA 2GJAA 1XF9A 3CH4B 3KJHA 1Z2AA 2P3SA 1QHGA 3SS8A 3K09C 4X8MA 2QTFA 1J8MF 1EFRA 2RGAA 5FI0B 5JS7A 2V9PA 1NLYA 3CONA 1VYVA 5FR2A 3ASZA 3EASA 4LV6A 4GFDA 4CF7A 5KHOC 3EPKA 2RGCA 3LXXA 2X8AA 3U44B 1IN6A 1M7BA 1NMXA 2GJKA 2NO7A 1DE0A 1QVRA 3Q9LA 4NCJA 3QKRB 1SHZA 4PPFA 2A5FA 3NHBA 1JJVA 2BM1A 4GT1A 2ZRPA 1E3MA 1LVGA 4DLTA 1MO5A 3IHLA 2RGNA 2XEXA 4MGYR 5EZ6B 4RD6A 3CWQA 4Q03A 2CBZA 1ZM7A 3CX6A 4BZXA 3TGPA 2HXSA 1VYUA 4Q4AA 4LOAA 3EG5A 3PIRA 3FHTA 4JLDA 4EQ6A 1BOFA 3R9IA 4US2R 3MFYA 5EE5B 4US0R 4QJ3A 4FWTA 4AC9A 2CL0X 2WJJA 4YMUA 3KTAB 1GRQA 2D62A 2ZSEA 4JJZA 3I62A 5JJIA 4Q18A 1J99A 2A3RA 2EWWA 1AA9A 1K6MA 2F6RA 2C9CA 2ZI5A 2R6CA 1KDOA 1XD8A 3TUIC 1R2QA 4BE7B 2DR3A 4TMTA 1P9RA 4X8OA 2KI5A 2NO0A 3GJ8A 3F3YA 2BDTA 1G6HA 1EFUA 3CF6R 4MKHA 1GG2A 1DAFA 2X2FA 5H68A 1R5BA 3EW9A 1N25A 1TQ2A 2GA8A 2Q9BA 3T1OA 2KBEA 2OO7A 3QQ5A 3SDZA 1II8B 3NDBB 1G8FA 3PEWA 2JLXA 1NY5A 1E4VA 4ZDWA 3WBJA 4DVGA 3QXHA 4OQFA 3ICQB 1A1VA 3X1WA 2QMHA 2HXYA 5DIFA 3IIKA 4CDGA 1XMVA 4M0LA 3TE6A 1NIPA 3C14C 3QSYA 1RZ3A 1TQDA 3AH8A 3O8BA 1ZVQA 4UNNA 5JJLA 1ZC4A 4NONA 2G6BA 4KVGA 2VP0A 4JLMA 3QPUA 4GNKA 2A5DA 2AHOA 1ZRHA 4Y0VA 3JVVA 2WKRA 1YZNA 4I1OA 2FA9A 3EZ7A 4US1R 3I73A 3AVPA 5FI1B 2GXAA 3KTAA 4YMSA 2ZM5A 2R6GA 2H92A 1XFAA 4X8HA 1GNPA 2W6JA 1S8FA 1E2LA 4LUCA 1SVLA 3U7FB 1E9BA 5FUWA 4RFSA 3CRQA 2QP9X 2JLZA 1QHNA 1NLFA 4G5QA 4LJAA 1X8JA 2F1RA 2C96A 2YKGA 1AKYA 1P72A 8OHMA 1KSFX 4G5RA 2OXCA 2YWEA 4M1WA 2BMEA 4BFXA 4DLXA 4TT3A 5EJEA 3TAUA 1AZSC 2IXFA 1CU1A 4HZUA 1COWA 4ARZA 1VTKA 4XTRA 4QBGB 5FPHA 4I1VA 4MGKR 3WNCA 3BORA 3WHLA 1XTJA 4G01B 4I1UA 2CHQA 1G18A 2G1KA 2JIZD 3FKQA 3GEHA 1J7KA 4TTQA 5E7MA 4RD0A 3KFXA 3Q7QA 1CR1A 1E2MA 4BRUA 3FWYA 3ND8A 4Q01A 2ZS9A 2W0SA 2IBMA 1BH2A 3DM9B 3KXLA 5E95A 1B0UA 3ZYCA 2R44A 3QKTA 2FPMA 5EXPA 1AQUA 5JSZB 3DHWC 4NZYA 4NE2A 3LX8A 1MABA 1T8UA 2GCPA 2NGRA 3D31A 2YYZA 4PSAA 4H1UA 5KDOA 2Y8EA 3QIAA 5DISB 3ECCA 2RB4A 2HLDD 3KXIA 4M1MA 2R65A 3LVQE 4XH9B 4ZDJA 4Z1MA 1IONA 3RDPA 5HR5A 4LJ4A 2AKYA 2J0VA 5FFMA 4EFMA 3GFOA 2CL6X 1KI2A 1Q21A 5DH9A 3WMFA 1N0VC 1N3BA 1KOFA 2QEQA 3IIMA 4B34A 2WOOA 1E2IA 1BMFA 1W4BA 2QSYA 1QZXA 2FZ4A 1JR3A 2OSBA 1E6CA 2ZRDA 3GLFE 3T5GA 2QE7A 1KJWA 1ZMXA 3LW8A 2VP5A 3LAWA 2EW1A 3SJCA 4B76A 4EFLA 2PCLA 4M1YA 5DN6D 5JEDA 4NKRA 1YQTA 5LDDC 1G8HA 1OE0A 4M4SA 1ZCBA 4PQFA 4LGMA 4ZDIA 2C95A 4DBLC 4GPTA 5C4MA 4OL0A 4UJ5A 1NVVR 4II7A 4RD2A 3EZ2A 4DLUA 5AJYA 1SHKA 2NPFA 3DPUA 3OEED 4XWAA 1XNJA 2VHCA 2VLIA 3ICEA 1C9KA 1RRPA 4QM7A 1I4LD 1XEXB 3W5JA 721PA 1GKUB 2REBA 1CIPA 3EC2A 2P2LA 2H16A 3AF2A 1E9EA 3OEHD 3UMFA 2IYWA 2FE4A 4PC2A 2XZOA 3W6NA 3TUJC 1OXXK 2ODNA 3TUZC 3KKQA 4TLBA 4KFTA 4PSKA 4EPVA 3U61B 4QM6A 1I4DD 4P31A 3EX7C 4QGFA 1KAOA 4QL3A 4DZZA 4OBEA 2PZEA 2QTVB 1OPXA 4TL9A 4E07A 4D2IA 2XSZD 3GCGA 1HT1E 2AK2A 5AUQA 1YZQA 3WYAA 3FGNA 3R7WA 3P32A 5AJXA 2F7SA 3RRZA 5B64A 1KO5A 1W7AA 3IEVA 2AD5A 3KDSE 3RYTC 3T06B 3F0TA 3FFBA 4N0EA 1W48A 2GBLC 5F2EA 2B6HA 2OFWA 1ZUHA 4KYUA 2C04A 3E2IA 4L9WA 2ZYTX 2W2XA 5EP1A 3UKDA 4MDEA 3R7WB 3HYRA 3PUVA 4JVNA 1N2CE 2WWYA 3QXCA 2QMUA 1KYIA 1E2NA 4Q1AA 1ZD9A 4B6FA 4PQYA 2FFBA 3KKOA 2KSQA 3QKUA 2YWFA 1OH7A 1Z63A 1HYQA 4JVLA 1NRJB 3BWDD 1RYFA 1NMYA 5FOTA 4PFSA 2NO9A 4MYTA 1XBTA 3SJBA 4BFWA 1ESMA 2VBCA 2RMKA 4DCTA 2FZLA 1KI9A 2LWIA 3PVSA 3FVQA 4XD7D 1XTIA 4AG6A 1LF5A 5EZ5A 3VNUA 3QF4B 2JJ2D 4AKGA 1CXZA 2ONKA 3IDQA 1T3HA 5L8VA 2GRJA 4RD1A 4DEYA 3UMSA 1GZSA 5EP2A 3TR5A 4NYJR 1L4UA 1G7RA 3ZJYA 4POAA 1E79D 1IY1A 2F9MA 2GDJA 4O2RA 1X1RA 1R5OA 1PZNA 4LBYA 4ZDKA 1GOTA 3A4LA 4EIWA 2WSSD 3PV0A 3MRSA 4M1KA 2C8VA 5G3ZA 2IYSA 4A1FA 1II0A 2ZJ5A 1ZIOA 4HLUA 1C1YA 1A4RA 1U90A 4B75A 1S1MA 1SVWA 2YZ2A 3BERA 4OQLA 4ZI3A 1XD9A 2IEYA 2K5UA 3MSXA 2CLDX 1MOZA 3I92A 4MRPA 1VHLA 3QVUA 1UM8A 4QBIA 4Q7JB 3NXSA 4EPYA 2ZS7A 2OILA 4IJMA 4KLNA 1R10A 2ZE7A 3DM5A 3Q5DA 2VTKA 3CZQA 4B73A 5GJVC 1DPFA 1HV8A 1S9DA 3LXRA 5FUYA 2PH1A 3EZFA 2VRWA 5EXSA 3U4QB 3ZD7A 4BWYA 2EYQA 1UDWA 1TEXA 4LBWA 1QRAA 4M9XA 3CBQA 2GJ9A 3LBHA 2J41A 1EFHA 3FMPB 2R6AA 1SKQA 1FNNA 3EA5A 3BB1A 4C0HA 4HUQB 5CLQA 3PEVA 1WA5A 2XOKD 2YOGA 3UXMA 2A30A 1L2TA 1DBSA 2P67A 3FKSD 4OHWA 4U02A 4DB2A 2ORWA 3DOFA 4CIDA 3CNOA 2Q9CA 1S1CA 4UKDA 3QPWA 1R7RA 2BBSA 3AP3A 4LDJA 3SYNA 1OH8A 1ZM3A 5LBIA 5GJBA 3K0CA 4CGZA 2ODEA 2XGJA 4E5UA 3P27A 4HB3A 4JYBA 3NEYA 4PC3A 4MA4A 5TDHA 2OM2A 4OHZA 2CHVA 2WTUA 1ELOA 1NN5A 3BD9A 4NCHA 4CT4B 1SVSA 2DB3A 4UJ3A 2H57A 4M8NE 3ZD6A 1IY2A 1Z29A 3CUEF 4YONB 4ASUD 2D3WA 1VKJA 5KUTA 1R0YA 1TMKA 1TL7C 1VIYA 1VCOA 4BLPA 3QXJA 4B2IA 4P32A 1R6BX 1CR4A 4A8JB 2JDIA 3W3AA 2ZSAA 3BH6A 3TQFA 3T35A 2GEVA 1US8B 3MD0A 4D26A 1Z47A 5SZJA 4G5GA 5E4FA 5EP3A 2VEDA 2C03A 4C0AC 1JB1A 4C0LA 2PT7A 3EWAA 3ZQJA 4B71A 5JI3E 5LD2B 2NG1A 4JJKA 4XIGS 2CLCX 5JHHB 2XXAB 2O8EA 2H17A 2ZJ8A 4JLNA 2VP6A 2W2VA 2HYDA 2ZRCA 3QY0A 3VX4A 4D25A 3NKVA 1NJFA 3LW7A 2ZE5A 4HAZA 3EZ6A 4TYWA 1TF5A 2H1LA 1G4UR 2PJRA 2ZYUX 3AGQA 3TR0A 4BLOA 4YXWD 2ORVA 2QN6A 4AKIA 2GVDC 1ZNWA 3ZZ0A 2ZVPX 1R0XA 2WKQA 4KV9A 4D0NA 1CF4A 3H84A 4M21A 4UNPA 3VR6A 2JJ8A 3B1ZA 2O8DA 4HB4A 5CDFA 1GILA 1E98A 1N6LA 4HEJA 1R0WA 1QHHA 3QKSA 4C4PA 5KNDA 1Z6GA 4KODA 4IEIA 5UKDA 5A0FA 4F92B 2J5XA 4CEIB 3AVUA 5TMPA 2DFNA 4LWZA 4URVR 2V3CC 1G17A 4C0QC 3NBZC 3QE0A 2ZITA 2DCUA 1N6HA 2RGXA 3QBTA 4URWR 2AN9A 1RPZA 1XMIA 2N1BA 4BPBA 1Y63A 3EPHA 4AKHA 1W4CA 3RANA 2ZU6A 2GNOA 2G0NA 5CB6A 1N5IA 3B1XA 2BMDA 5DYIA 3I72A 3REGA 3N2IA 4ZCMA 3UMRA 1F60A 3TSZA 2BOVA 3B1YA 4HATA 3L82B 1XJQA 2NO6A 3CX8A 3MCAA 2GVZC 4G0NA 4NP6A 4QOSA 3DVLA 2O8FA 1X8LA 2P5TB 1ZINA 3LNCA 4JSTA 1OIWA 2OZEA 2V4ZA 2BKEA 1S3GA 3CR7A 1JXMA 2R62A 1FFHA 1EGAA 2ZR0A 1BO6A 5EXXA 1E9SA 1EFTA 1TQ6A 2QPAA 3IPYA 2J0UA 3QNUA 4I4LA 3VR4A 2FV8A 2ERXA 2ORIA 3AKCA 4IFBA 2B7CA 3WYGA 2QSZA 3THXA 2WWIA 1R4AA 1Z0FA 2V54A 4XD7A 3Q5EA 5KSPA 3RWOA 1KY3A 2CEAA 1WMSA 1P7CA 3AF0A 4DRZA 4Q9HA 4QJ4A 2FSIA 1BIFA 2FEOA 4KU4A 1T3LA 2QU8A 5FPTA 2YINC 3ZGXA 1KMHB 1G5TA 4DXAA 3LQQA 4XSHA 4XWKA 1DADA 4FWIB 3W6PA 4O0MA 1E2EA 3ASYA 3ZDQA 3DO6A 1YR7A 1IBRA 4LYFA 2FEMA 3OF5A 4S35A 2WJGA 2NO1A 3CPEA 2QY9A 2QENA 3L0IB 3UIEA 3SI7A 1XJCA 1Q3HA 4D82A 1N0WA 2DWQA 2GWHA 2VF8A 5BQ5A 3CNNA 3IPXA 5P21A 1FNMA 3SYKA 2B8TA 1ZAKA 4PO9A 5B58C 2LCFA 5IF9A 3I5YA 3ZVNA 4A0FA 4FINA 4B2PA 1HQCA 4PHHA 521PA 4FXPA 4TYYA 3NBYC 1WCV1 3PG5A 3I8XA 3IQXA 1XEWY 2YWGA 1OKKA 1CR0A 1K5GA 3SBEA 1DAKA 5AJZA 4Q21A 3HU3A 1KNXA 2WAYA 2NZJA 4LC0A 4AY2A 4FMBB 1QG2A 3UPUA 2QRZA 2ZJYA 1VDZA 2Q3HA 3L43A 4PAOA 1JR3D 5DE3A 3B82A 3L8ZA 2WWGA 2HLDA 4JLKA 5H1YA 2C5LA 2IHBA 2GJSA 4IDHA 4OYHA 1SKYB 1CJMA 4LYHA 1IN7A 4TTPA 3TW4A 1H8HA 4JBWA 4DUGA 3EAQA 2Z43A 4BZQA 4M9QA 1IAQA 1QHSA 3K0FA 4D4JA 4M22A 2BC9A 3HP1A 2BVNA 5AJWA 3X1ZA 3OFND 1LV7A 2XZLA 2QG6A 4A36A 3UATA 1Z0AA 3C5HA 4B3BA 5FOWA 4QGGA 4RY2A 1CR2A 1P2UA 2RHMA 3HPRA 3PXGA 2VH5R 4IOKA 1W36D 1AGRA 5BW8A 4DLWA 2PT5A 1P2SA 4EDHA 1U0HC 1DO0A 2JLRA 4PO1A 2WPDD 2ZUCA 1S96A 3R8FA 4V0ME 3VX3A 2UVQA 4BLSA 4CVNA 3AB3A 3PR1A 2BCGY 2RGNC 2YNMA 4BFTA 3TJZA 3ZS8A 2FG5A 5D3MA 1KHTA 3REFA 1E2PA 3X1XA 5KDDA 4K81B 4HSEA 2ZIAA 1Z6YA 4ZKEA 4QGHA 1UKYA 1KI4A 3EXAA 2FFHA 4XVQA 5IK2A 1DEKA 4WAUA 2GK6A 4GP6A 1DVRA 3KQLA 1JAIA 3OHMA 621PA 5DGXA 2JLSA 5BN3A 2Z6VA 5KOYA 2V1UA 1RC8A 4HB0A 2VF7A 5JWHA 4UXJA 1P9WA 3EZ9A 2IL1A 3GJ3A 4IRUB 3NWJA 1TUEA 1Q57A 2Q0HA 3DZDA 3W8NA 3NEJA 4FW9A 3B1WA 1IQPA 1TU4A 3GJ5A 2X19A 4U00A 1WBDA 3CPJB 2GESA 1GTVA 2BBWA 4BUJA 1E99A 2VP2A 5H70A 4DKXA 4UQOA 3VFDA 1ZNZA 4M1SA 2C77A 3LO5A 4F4JA 1G8GA 4RSGA 3U3KA 4JZKA 3CB4A 5KPDA 1QBKC 4ESHA 4CEHA 1NVWQ 4H1VA 2PX0A 1PUJA 4MITA 3G0HA 2J46A 2BMFA 4G3XA 4TN1A 4C0SA 2P6RA 3U4QA 1NN3A 1XB2A 3IEUA 5FTNA 1N0UA 2V1XA 4M1OA 4LZZA 2GHIA 4FCWA 2H7VA 1XD2B 4HYYA 4L9SA 5BXQC 1GM5A 2FU5C 2WHXA 2V55B 2HCBA 4B3CA 4E09A 4KO8A 2W2TA 5L3RA 5SZKB 2XB4A 1QG4A 1FTSA 4LHZA 1Z6XA 5FPYA 1TADA 4A82A 4JLAA 1WDTA 5TB5A 1RW4A 3A1TA 4PPNA 1VG8A 1RVDA 4B32A 2ZE8A 1OJLA 1NVXQ 3FKSA 4HLDA 4KJZA 2RGEA 3BRWD 1CJUC 1KGDA 1ANKA 2O0KA 3BFVA 5DNYB 5F98A 1TUIA 2B8WA 2JLYA 2A5YB 2N42A 2RGDA 1ZNXA 2D7CA 2XAUA 3PUWA 1X6VA 4IVRA 5FPSA 1SXJD 1PVOA 3KQKA 1KK0A 5DI3B 1YZLA 3ZS9A 3GLIB 1XTSA 2RGBA 3H1TA 1GWNA 4WA7A 4B3XA 5BWMA 3KQNA 2HT1A 1F2UA 3W90A 1IXZA 2IA5A 1NF3A 1GRNA 3GLGB 3K8YA 1CBUA 5JWOA 2MSEB 3GLIE 3KKPA 4PHTA 5DHFA 1JPNA 2RAPA 2OLJA 2CJWA 2HCJB 2KBFA 2ZVQX 2JDID 3BIFA 4C3ZA 3EARA 3PUYA 1G3MA 1YR6A 2DFLA 1M6NA 2C9YA 2D7DA 2B92A 1RRFA 1VCIA 1LFDB 4AYWA 1EWQA 1HQYE 3H0KA 3O8DA 4RD4A 4NMMA 4F4IA 3K70D 1T8TA 3GJ6A 1FP7A 3DMNA 2VPPA 2OESA 1GL6A 1RJ9B 4WIAA 4R9UC 1W0JA 2OBLA 1F2TB 4KYIB 3SHWA 2D06A 4PZZA 3T1VA 4MYHA 2XOKA 4ON9A 2GF9A 4JLBA 3NBFA 1L4YA 1ZNYA 2IT1A 1DAHA 4EPWA 4Q4HB 1NG1A 1U9IC 1X86B 3D3QA 4ERNA 4H9GA 1DAGA 3P4XA 4DIDA 1DOAA 5CM9C 4ZV4A 1J2JA 4LJ7A 1F5NA 5KU1A 2VHUA 2J3EA 1M34E 3I5XA 3GLHA 1SQ5A 3E70C 4TMVA 3GQBA 1BYIA 3C8UA 1S4QA 2ZJZA 1MO3A 4P0TA 1Z28A 5JHGB 4Q1FA 3GFPA 3KUCA 4LC1A 5AUPB 2JLWA 4RFVA 1LY1A 3Q7PA 5F9FA 3U3MA 4ZCIA 3AEZA 3SZRA 4P4SA 1EESA 4FI3C 2IYLD 1GRRA 3GFTA 4Z8XA 4B33A 1K8RA 1PJRA 1G7CA 1XZPA 2QGZA 3AF4A 3KZ1E 5HKKD 4A92A 1KI7A 2P65A 4R98A 3U3OA 5KNBA 1US8A 2ZI9A 3PEYA 1KJYA 3AGPA 3KJGA 1UAAA 3T12A 2IS4A 4D80A 4C30A 2H8KA 2W6ID 3FDIA 4OHXA 4Y0AA 3TK1A 4ARZB 4I81A 5LD2C 4NYJQ 4Q7MB 1WBBA 4NHOA 1F3OA 1Z5ZA 1NBMD 3LLMA 2JJ2A 4DCNA 5JCZA 2WIAA 1S3SA 2Z5FA 5FOUA 4V0MA 2A5JA 1Q44A 2CMKA 3QUSA 5K8TA 3AVOA 3RS7A 2ONJA 2VO1A 1W5TA 3CH5A 4AYXA 4L15A 3THWB 1Q12A 1TQ4A 1Z06A 1R8SA 5L3VA 2FDCA 1UKEA 5CYOA 1IJFA 4FIDA 4Z8YA 2ZXUA 4CEJB 2DY1A 2O8CB 4LCBA 2IF2A 2QM8A 3AQ4A 1W2GA 1Z6TA 1TX4B 2GCOA 1XDBA 4LBVA 2PX3A 2UZ3A 1PLLA 2F3RA 3A1WA 3IILA 5HE8A 3ZIAD 3ADBA 2ECKA 1DELA 1N6NA 1EG7A 3MWLA 3RS2A 2GXSA 4Q4HA 3CX7A 4D4KA 2JCSA 2OBNA 1CJTC 3NC1C 3PEUA 3R20A 3FMOB 3P1JA 4Q1BA 5HZKA 2VSFA 3SJAA 5KSZA 2W00A 2WWWA 2QZ4A 1KSHA 2RHDA 4NYMQ 2EFEB 4OK5A 2BEJA 4L4UA 2ZI6A 4QBHA 5SZIA 3VR3A 4DCVA 4JL5A 4YXWA 1OFHA 3LQRA 2ZPTX 5LB4A 3BH0A 2FSHA 3EPLA 1II9A 1JNYA 1OXSC 1Z0DA 1OKKD 2XNDA 2AKAB 2P6UA 1SVOA 4P4TA 4OQMA 1KTVA 1VPLA 3CRMA 1W0KA 2D4HA 3RRYA 3TKLA 1E0SA 5ELXA 3Q85A 1HE1C 4W7SA 1XXHA 3KB2A 2ZAMA 2IX3A 5E7JA 2XJ4A 3LV8A 2CCKA 3NVAA 4IOLA 4QHTA 1XEXA 1YE8A 4HAWA 2PMKA 3SQXA 5F9HA 5TVKA 2FGJA 4AD8A 3DDCA 5CLLA 4WZ6A 4R7ZA 5B2ZA 5JEEA 2MMCA 4ILEA 3DOEA 3KKMA 2WWFA 4I99A 4MKIA 1CS4C 2ZRLA 2YOHA 3JZAA 1U0JA 3GLHB 2PJZA 5CB8A 3U3JA 1ZW6A 1RE0A 4OKSA 2X77A 2CLSA 2RCNA 4O3MA 4KCGA 3R9XA 1VG0B 1KDRA 1U94A 1FUKA 1E2GA 4KFSA 2ANCA 1AS0A 1CJVC 1Q1ZA 4LYAA 1CP2A 4Q19A 2GEDA 1YR8A 1Z08A 3OIUA 1GP2A 1P73A 2FH5B 6Q21A 1F6BA 2JEOA 1VHTA 1QDEA 3B5JA 1Q1BA 1YHNA 3TVTA 2WJVA 5IRCD 2ZU0C 1G8PA 2IXGA 3ADCA 4BLTA 2XNDD 2O8CA 2H18A 5KTYA 2J45A 1J90A 2IC5A 2PMDA 4IHQA 4JYCA 5L3QA 1DARA 1FUUA 1OXVA 4NCKA 1G7SA 2CVHA 1CTQA 4C7OB 2ZSBA 3A1UA 2P5SA 2IYUA 4LPKA 4D0LB 3TQCA 3TBKA 4G5SA 4JKIA 4PANA 3W9YA 1IY0A 2FJUA 4QJ5A 2R2AA 2KE5A 3KXKA 3VMFA 2QL6A 2Q21A 3WRYC 3LWNA 1NBMA 1MRSA 3THXB 2QT1A 1UBFA 5A5GA 4LJ5A 4F4CA 2EU8A 4JT4A 5CK5A 3LDAA 1LTQA 3LRPA 4PAQA 3ZVRA 2IHYA 4B3FX 2VHQA 2BJWA 2ZRAA 3QBVA 1PLJA 2Z4SA 4TSFA 2AK3A 1R8QA 4GRAA 2ZRMA 3BE4A 3C16C 4QHSA 1NN0A 3W34A 1D2NA 4CW7A 1KK3A 5FOXA 2OG2A 3D8BA 1E9FA 1HTWA 2WZQA 4OJQA 4QHYA 3TVDA 1L7VC 3SC3A 4C9BA 3ZIAA 1JXOA 2CDNA 3BS4A 3EIEA 4IVQA 2ZE6A 5IDVA 4GOKA 1KAGA 1GIAA 1TF7A 1ZJ6A 2ZJBA 1IM2A 3GPLA 1M1YE 2F55A 2FN4A 5L3QB 3V00A 1U8ZA 4GSYA 1GNRA 2PEZA 3QXSA 4PTLA 5EXTA 4UNRA 3OIWA 4IKEA 2ZRGA 5E3HA 4WZBE 2NZ8A 3GJ4A 1KMHA 2FPKA 2IYZA 3F8TA 3CRVA 3X2SA 2HJGA 3B8HA 2DFKB 3ZZUA 4BEJA 1G16A 3U7GA 4V0KA 4QBFA 1Z0JA 2XXAA 2ZS8A 4B3DA 2W6JD 3WBKA 3RSLA 1W2HA 3W5IA 3P26A 1W47A 4XJXA 4HI0E 2V7QA 2ODWA 2QT0A 1NSTA 2ANBA 3PUXA 2FWRA 1GKYA 2FF7A 3CM0A 2DPXA 2BHRA 3KKNA 4N3NA 1KK1A 5HE9A 5LB2A 3SEAA 3VKGA 1Q20A 3ADDA 1EX7A 5C2JB 3BB3A 1D2EA 1A7JA 4LV5B 4W5JA 1R0ZA 3WP1B 1DAMA 1G1MA 3K70C 3CRRA 2JGNA 4G1UC 1MABB 4OQXA 2EWVA 2GXUA 3H2YA 2VYFA 3FMIA 3WNDA 1N6KA 2OEPA 3WXMA 1XPUA 1JQLB 2JATA 4MUBA 2CHGA 4MGZR 5AJVB 4GP7A 1LNZA 1OXUA 2VHTA 1VMAA 2O8EB 1UF9A 2CJWB 2VIIA 3WP0A 4NH0A 4DCSA 1AK2A 4TQUS 3BAFA 3VAAA 1ZC3A 1N6OA 1SVIA 4LPSA 1NN1A 4OI4A 4W5WA 5KSOA 3U5ZB 3U6BA 4NU0A 4NYMR 3NIBA 4EQ6B 1VG1A 1G21E 4HDOB 2X1VA 5AR1A 4LX0A 4UXHA 4IEEA 1KZ7B 2BKUA 4Z51A 4LRWA 1VG9B 4J0QA 3KB1A 1WP9A 4FN5A 4QFMA 4DLVA 2HUPA 1P2VA 4R2HA 3V4FA 5HCIA 2J1LA 2CXXA 5IT5A 2NQ2C 2O8DB 2ZYVX 3BFKA 1W44A 3DKVA 3IBYA 2QAJA 3SFVA 1Y3AA 4A15A 1ZYUA 2YV5A 1UBGA 3EIHA 3JZMA 4F91B 4ZIRB 4Q9LA 1Q1QA 1GITA 3QXXA 1NP6A 4Q02A 2LKCA 2WICA 4OK3A 2WJYA 4Q4JA 1UKVY 1YZKA 1OV4A 2ERYA 1YZGA 2IYTA 1G7TA 5FBQB 3IHWA 3GMTA 5FTMA 2YC2C 2FMXA 2QTHA 3RAPR 4D81A 4LK2A 3VR5A 4Q4LA 1KO4A 3ADKA 3QPVA 4JBXA 1MRNA 2IS1A 1U81A 2UZIR 4C0JA 4HAYA 2C2HA 5FL3A 1OW3B 4HUTA 3K0SA 2G88A 4LJ9A 4M1TA 4D6PA 3AVXA 3BC1A 1KSJA 1I2DA 1RYHA 2CL7X 3D7MA 4LV8B 1IXRC 1CLUA 3CZPA 1D6JA 3KUDA 2Q3MA 1JPJA 3IIJA 1HA3A 4GZLA 1YKSA 4GMDA 2J7KA 5FTJA 4WXPA 2Z83A 3WHKA 4B48A 3F5FA 4AKEA 3LLUA 1DG1G 1UFQA 2XZPA 3SN6A 1FTNA 2O0HA 4O25A 1A5TA 1ZM4A 2BMJA 3NBXX 3OIVA 5CIWA 4TLAA 2E1RA 1OFUX 3FTQA 4HB2A 1XTQA 3NH6A 1KO7A 3S1AB 4URXR 1HH4A 4M9SA 3L8YA 3P4YA 1YZUA 3NH9A 4P4SB 2XJ9A 4MGIR 1P62B 2PZGA 1QF9A 1XRJA 4W5HA 1UDXA 4EAQA 2HEIA 2DHRA 4Z54A 1O3YA 4EPXA 2ZRHA 2EFCB 4DHEA 1P4SA 3TRFA 1FPMA 2J87A 1N6RA 5EE9A 1N6IA 3GLGE 1S9HA 2HT6A 2YC4C 2Z0MA 3C7KA 4N1AA 1ESNA 3BB4A 4QGAA 3RS4A 2NMVA 3MG9A 2IWHA 5E7IA 1NBME 4A6PA 2AWOA 1VIAA 5FOSA 3WYFA 2H5EA 2O8BB 1W0KD 3VHLB 3IBGA 4FD2A 1T5LA 2F1IA 3OEHA 2I1QA 2QRNA 4JLPA 4WVFA 4RZ2A 5FR1A 4WZAE 1GL9B 4PHGA 2WIBA 3CLVA 3N5CA 3R9WA 4V0OA 3QI2A 1H65A 3CO5A 2E87A 1ZU4A 1IOZA 3BXZA 2C98A 3PJRA 4QNRA 4A2QA 1E1RD 3T1TA 421PA 1N5KA 1X1SA 4B2LA 4EFNA 4IDOA 3THYA 4X8LA 5F3WB 4DT1B 1KI8A 2REOA 3AP1A 4NTZA 1KNQA 5DN6A 3MLEA 3AVQA 4ESVA 2A2ZA 4DLSA 4OHYA 1CKEA 4ZCLA 1HY3A 2W0MA 3JVUA 5DSZA 1AKEA 1CRQA 2YHSA 4MYUA 2NTYC 4QG7A 5EP4A 5JFGA 2R6DA 1Q22A 4KXFB 1C4OA 2I3BA 2QAGC 2ZI7A 1UEJA 4TMXA 2GZDA 3GJ0A 3QKRA 4MQBA 4URYR 5AWFC 4BLQA 5LPNA 1PLKA 1J70A 1WRBA 1COWD 3BJIC 1DAIA 5HKKA 1E0JA 3O8RA 221PA 4JVMA 5G53C 4AYTA 5GVSA 1HUQA 2OLKA 1GL7A 2PZFA 2QA5A 4NYIR 1HT2E 3BH7A 1P75A 4C0KA 1Z0KA 2IYQA 3VU9B 1YRBA 4PAMA 4WBSA 3RS5A 4E03A 3CRW1 1P5ZB 3PQCA 1UEIA 3LFUA 1SKYE 2OAQ1 4HLUC 1OH6A 1S0UA 2IEZA 3U7HB 2BCJQ 4TLDA 4DSUA 4ZKDA 2P6NA 2G9NA 2QI9C 4ZIRA 1XCPA 4EJSB 2QORA 2ZRBA 4R2IA 3TLXA 1FW6A 1TU3A 4P4UA 4V0LA 1T9HA 3GLFB 4XVRA 4Q1CA 4Q47A 4BFVA 3THWA 5JECA 4JL8A 2VP4A 5C46F 1E69A 1GSIA 1RFLA 3UWKA 1XZQA 4V02A 5J4VA 4RVCA 1AQYA 1XWIA 3CPHA 3ETLA 4K8OA 4PC6A 4TLEA 4A9AA 3GJXC 3ONWA 3W3ZB 3LD9A 1JBKA 1XMSA 5FTKA 2ZSFA 4YC7A 2XITA 3MJRA 2IUUA 3ZH9B 3VR1A 4QRHA 2OCYC 1KO1A 4ABYA 2F3TA 4MKGA 4DT1A 4PSVA 5JS8A 1T3SA 5GADl 1X8KA 3ZVLA 2ZREA 2HYIC 3A4NA 3GJ7A 5J4LA 4CRWB 1R5NA 1FOEB 4GL2A 3L2OB 4HZUB 3BOSA 5TV2A 5EE0A 1VCMA 3PUZA 4I1SA 1E1QD 4IW3B 4TYPA 2WJIA 1P60A 4TWZA 4DCUA 4NPHA 1E9DA 1W5SA 1GAJA 1U8YA 2GXQA 2W6IA 2WKPA 3O47A 2J9RA 2R8RA 4HLQB 3U60B 1W46A 1FZQA 2EFGA 2SHKA 5BN4A 2OBMA 5D3MB 4TTRA 5JLJA 1SXJA 3K9HA 1G9XA 1H8ED 3G82C 4LHVA 5J5CA 5L3SB 1YRAA 2XSZA 3LBIA 4M9ZA 1P2TA 1MO4A 4CEHB 1MR3F 3TMKA 2GK7A 2IUSA 4PZLA 4PC7A 1KI1A 1UPTA 3U6KA 2XTZA 2RH5A 1ZUIA 4TT3D 4MKFA 4PZYA 3R8CA 2QAGA 4HDCA 1W1WA 1E2DA 1UBEA 2ZJAA 5FBVB 2GCOB 4PPQA 4AURA 4A2WA 3CW2A 3M0EA 4C2TA 3BBPA 3HYTA 1KO8A 3SR0A 1OT3A 5AUOB 3VKHA 5FL7A 4ACBA 2VHJA 2O52A 2EVWX 4HZIA 3QJYA 4R71A 4LJYA 1UBCA 3FE2A 4KITB 3GEIA 3A58B 3ZZTA 4NDZA 5DO9A 5JMTA 1XCMA 1IXSB 1JAHA 1SVMA 1IN4A 1MT0A 2ZSDA 1RRGA 1KY2A 3HJNA 3M4YA 4K46A 2OT3B 3WNBA 4RCZA 5K8UA 1YZTA 2IUTA 4IDQA 1NIJA 2WMNB 2CK3A 2YOFA 5EE3A 1YR9A 2GZAA 2REXB 1H8EA 1IN8A 2BBOA 3A1SA 1NI3A 3AF3A 1W4RA 1AJEA 4RD3A 4GMXA 1JEEA 1XMJA 3OIYA 1D5CA 2QUZA 1DAEA 2IYVA 2FNAA 1XEWX 5FUVA 1SVKA 2PCJA 2ZRKA 3GLIA 1OIVA 1J8YF 2FGKA 1JR3E 3BGWA 3SFZA 4LBZA 3SNHA 4C2UA 2O8BA 4ASUA 1ZCAA 1TEVA 4XSGA 3EIQA 4FMCF 2J7PD 4LYJA 3B2EA 1NL3A 1T5IA 2ZI4A 1WF3A 1Q0UA 1YVDA 4XVUA 2ZJ2A 2JLVA 2ATXA 3UG6A 4B3GA 4CEJA 3T15A 2CVFA 3QEOA 3GP8A 1XD2A 1KDPA 5D3QA 4JL6A 2WV9A 2ZRJA 3K0CC 3OZXA 4UXIA 3PENA 5GVRA 4MUAA 5DYGA 1GFIA 1NKTA 2N46A 3B6EA 3ZVMA 2JASA 3SU8A 3C15C 1TPZA 3AVWA 3SQWA 1S2MA 2ZTSA 2AL7A 5HTKA 3MWKA 3TH5A 3RABA 1E1QA 1G291 2DFTA 2A7QA 4L5BA 3VU9A 4YQFA 5JZVA 3DL0A 4EPRA 4RZXA 1EX6A 2DBYA 1JJ7A 5EQTA 1FMLA 2ZAOA 4ZI2A 4TZ0A 2EFDB 4DLRA 1DS6A 1E1RA 1GVNB 1NKSA 2AWNA 3OAAD 2DYKA 4KHZA 3QF4A 3TAHA 2GTPA 3MMPA 1RRCA 2J0QA 1ODFA 1FX0A 3FOZA 2WWHA 1XXHE 2AR7A 4OK6A 4DUGD 1T0JB 3WMEA 3PFIA 3T5DA 5HPYB 4V03A 4C0BA 3B9PA 4WOPA 4BFUA 4RJLA 4FMDF 4B74A 1DG3A 1QHIA 2GAAA 2PBRA 5JBQA 5JRZA 4NYIQ 5C18A 1LS6A 1NLZA 4B43A 3LBNA 2WSSA 4AG5A 3QF7A 5CK4A 5ANRB 3HR7A 3A37A 1CULC 2CCGA 4CT5A 3HR8A 1HE8B 3SBDA 1F2UB 4DSTA 3A4MA 2WMOB 2WWXA 2QM7A 4KBGA 3M6AA 3RVBA 1KIMA 3H86A 5BYJA 1SZPA 4KFUA 4B47A 3EC1A 2D2FA 4FMDB 1Q1EA 1ETUA 2ZEJA 2ZRFA 2ZQ5A 2P0EA 1G5PA 1FQJA 5C1BA 3MUFA 1ZD1A 2OHFA 2Z4RA 3NTUA 3OAAA 2A78A 3RS0A 2J0UB 3DKPA 4D0GA 1RKBA 4BQSA 4MRVA 3AUYA 2XNSA 4TMZA 2BJVA 1E79A 3K0AB 1KZGB 1D9XA 3QOFA 2BV3A 1E2QA 2V6IA 3N2EA 2NOAA 2QPOA 2FSGA 3A36A 1KI6A 5EUMA 4NCNA 1G19A 1WQ1R 2ZYWX 5JSZA 1N5JA 2ZETA 5JCPA 3V4RA 2HF9A 1FP6A 5BYKA 2QBYB 3W6OA 2CE2X 2DWPA 2FSFA 1FMJA 3K0EA 3AM1A 2IW3A 4Q48A 1TAGA 2I1VB 5DI9A 1CRPA 4IDPA
chains in the Genus database with same CATH superfamily
2VSXA 3Q7TA 5CH8A 5BVHB 1HDRA 3G5UA 4X0EA 3QLJA 3VSCA 4QXAA 3HABA 3CA8A 5DTJA 3VKWA 2JGRA 1LW6E 2QE7D 2F9LA 3B13B 5I5GA 3ZZ1A 1SG0A 2ZUUA 1KAEA 3R24A 3PCRB 4KK4A 5TY0A 4QU5A 1X38A 2GN0A 4O2LA 2HA0A 4K1XA 5EIHA 5D00A 4EJ0A 4ADSG 1K75A 3KEFA 4RLFA 2W4IA 3CEHA 4X7PA 2KJQA 3FW1A 3VO9A 4BAGA 1OZAA 2Y76A 4IHJF 2XBUA 3OI7A 3OPYB 3MJHA 3BICA 3M5PA 4TS9A 2WTEA 1KXJA 4B84A 4YDRA 1AN9A 3OE7A 1OI2A 1COZA 4KXMA 1K97A 2DTDA 1HG0A 1SOVA 3MUOA 4N8SA 3T41A 5C5CA 2OCIA 1ZK0A 1FFAA 3ZHYA 5BV0A 5M04A 3CUKA 1MJGM 1JALA 1EUDA 4ZV9A 1VSBA 1W88B 1WHSA 3TLKA 3ZY5A 2Z9CA 3CBGA 2OUKA 4WZBA 5KYXA 1KEKA 3ZLJA 4U2CA 4KVAA 4PZDA 2QN3A 1FFCA 1CQPA 3QVVA 3WYEA 1IHXA 2N1MA 2OHXA 1VXOA 4IIEA 4U6SA 2XB2A 3K9GA 2RDMA 1AIPA 4BNDA 1EGQA 1Y89A 3KSDO 1YQ9A 3KXDA 4WL0A 2VDWB 4YAFA 1OSNA 4Z53A 4X3OA 1XPJA 3AG5A 3L06A 4OBXA 2YIVX 4XGKA 1K7YA 3HCOA 2CCJA 4QO7A 2WHPA 1J1ZA 4IINA 2HRQA 1Z15A 1C1HA 1HFWA 4OI1A 4Y9UA 3E81A 3M5DA 5WRFA 4R1UA 1OTHA 5KOHB 1GPWB 2G3YA 1AB6A 1UP4A 3BD7A 4C20A 2ZTLA 1D9ZA 3OCCA 4G4GA 4OSEA 5FI3A 2NVUB 2ZR9A 1AUOA 1YCFA 2AR9A 4C01A 4I19A 1RWNA 1VL1A 2QPLA 2QQEA 4WKGA 4RULA 2R9VA 4BCDA 3F6YA 5L95A 5AJUA 1L4KA 4NOJA 1ZMRA 4QDTA 1WXQA 3AIOA 3HWSA 4Q00A 2HNKA 1UC5B 1MA3A 4MR9A 3I0ZA 3MQ4A 3C97A 4RZ3A 3H11A 2HLHA 2D0IA 2J59A 3EDMA 3RS3A 5HWSA 4ENRA 3AR9A 8MHTA 5BSHA 3NHMA 1JZTA 1EX9A 2MSDB 4PRKA 4UCWA 4BNKA 2LCIA 1SC1A 3PGMA 1O95C 3EQ9A 4MR7B 1O57A 3DE0X 3T52A 3CB2A 3BZWA 4R6WA 1U7OA 1KKMA 2CE7A 4FQ5A 1P6XA 4JT2A 1LBEA 3NMUF 4HWSA 3RKUA 3EY4A 4TYQA 3W4JA 4Q9KA 1ZIYA 2B4RO 3NC0C 1TQHA 1EXMA 1I1HA 2OE2A 3G17A 4TVBA 1CQIB 1SGWA 1EUCA 4FYVA 1T91A 3BWBA 1QE0A 4IUCS 1VSVA 4M7WA 2V6JA 1I4TD 4XUCA 1CC1S 1Z68A 1D03A 1KJJA 1ZD4A 2O0JA 3KV3O 5COBA 4ZEWA 1WLSA 2PUJA 3DFFA 3EGWA 3NR2A 2V9ZA 3NHAA 1PW7A 3TW8A 4HAOA 2I80A 4YXFA 1IWPB 2I2XB 1W36C 5T5QA 3FFAA 4RJ2A 5ER6A 3CVYA 1XCGB 3AM3A 5C7LO 1R0KA 4PTZA 4NV3A 5I9MA 2GEUA 3QV1A 4QECA 5K4AA 3N53A 3G13A 1QAOA 4TTSA 5EYPA 4B82A 4UU8A 2E0IA 2E4VA 4LNHA 1CIVA 4KFRA 3D3NA 4BLRA 1VPDA 1Q19A 3C4JA 4AIIA 1TKCA 2X2EA 1U0GA 1UPAA 4R2WA 2VA8A 1FQOA 3FCEA 4GYJA 2DY0A 3V6LA 1CR6A 2WD9A 3L4SO 3QNMA 1D3AA 3H2GA 4YIKA 3VGJA 5KQGA 2JGDA 1WS6A 4LRUA 4Q34A 3W78A 3H2ZA 4Q1VA 3TVYA 4IFEA 1UPXA 1SXJE 1CFZA 1IUKA 3KQSA 1LS1A 3R0IA 1AO0A 4TS1A 3BMQA 1A5AB 2VQ3A 1TLLA 5KNBD 1R66A 4L8VA 2PLNA 1NVVQ 2AMVA 4DMHA 4W1SA 1GZHB 2VL7A 3EFOA 1FIUA 4TLCA 4JVSB 3M1LA 2VYVD 4KBFA 5MFZA 2VK2A 1P29A 4DJJA 2G77B 4J7AA 5JSKA 2GAOA 2OC9A 4N3CA 4XGIA 1RBMA 4LMAA 1OAOC 5SZHB 3GL9A 3B38A 4KLZA 4TZ6A 1CEEA 1ZH4A 1WSAA 2O8FB 4JGBA 3L4BC 4XJVA 3CIOA 3QUQA 2ZSJA 3ORFA 1Y1PA 5EIFA 3QKIA 2IPAB 4OHKA 4Q9JA 1KI3A 5DV9A 1X9HA 3H87A 3M1YA 1KC3A 3MTAA 3KHUA 4FFMA 2ZI3A 1WW2A 1J0AA 3L0BA 3E9YA 2OCPA 3KSMA 1G64A 3M1IA 3QITA 4PGAA 1ZM9A 4RK6A 1XE3A 3DEYX 1L9KA 3NM6B 4WRRA 4B87A 2PEYA 4E5DA 1BGVA 3I1JA 3KUXA 2XTNA 1L7QA 2AIRA 1WAMA 1MZPA 1EVQA 2AMJA 1FRFS 1M1YA 1GDTA 2IK8A 3NIGB 2O20A 1Y4SA 4P33A 4HYTA 4DDWA 2JJ1D 4PINA 3EWSA 2E1PA 2QTAA 5TXGA 1I2ZA 3FETA 1A5SB 3GELA 3R4VA 2ZJ1A 4GSKA 5ERGB 1NUTA 5EKUA 5H5JA 5JVDA 1U98A 4GPZA 1TF2A 3W2IA 5IJ0B 1A9QA 3UNXA 3PTLA 2IXBA 1QORA 1IHUA 2V96A 3AHGA 4BASA 1DC4A 1WJGA 2X6RA 3BJEA 3T38A 1F2TA 3ZNPA 5K01A 4A2PA 1PWZA 1ZY2A 3DVRX 2XMRA 1WKBA 2F1OA 5HRUA 1BYUA 1J42A 2P68A 3NHJA 2Q5CA 2I4IA 3D1LA 3CNLA 5COAA 2PL5A 2D3TA 3VOSA 3A6KA 4XYGA 4AXXA 1USWA 4NZPA 4O1IA 4DYHA 5K3OA 2N9UA 3EZXA 2HWXA 1YJ5A 2OCBA 3IQWA 1KAHA 4U6NA 5THXA 5AUNB 4UTNA 5EE1A 1ZHOA 3QPCA 4KQ1A 4RV9A 3S1SA 3SBOA 3LP6A 2OHHA 4GLBA 5CJ2A 1JFTA 1OFTA 4TKUA 5A62A 4BMPB 4LI0A 4RFSB 3AVYA 1S89A 1NR5A 2DFDA 2ZVJA 5TARA 1Q7TA 2CUZA 2NW6A 4ZJYA 2JLUA 4H15A 2O1SA 4WZ6A 3ULKA 1MH1A 2NV2B 2RGGA 4EWLA 5BMVF 2QP4A 4RELA 1KORA 3E1SA 3RB8A 3THYB 2H54A 1XTKA 4TT8A 4EHFA 4Z2AA 1JECA 2B21A 5H4HA 4BN0A 3FHOA 1Z4NA 1A4IA 2G5TA 1Y5LA 2QLMA 2I29A 2D00A 1JEDA 3ZWNA 4GM0A 3L4JA 5AYVA 1OQAA 3PYLA 4B35A 1OA0A 1D09A 3Q4GA 4RM3A 2OD2A 2QNRA 3I4LA 1JXAA 4PO8A 5J40A 5LOVF 1KI6B 4ES6A 1TNDA 3VQTA 1ZLXA 1ODTC 3ORRA 4BGDA 1G3UA 2DSNA 4MMYB 1I1NA 5A2GA 4IXTA 1XO1A 1VMKA 2ZZMA 4MNTA 4O4JB 3T3GA 4H77A 3F5DA 3BXEA 4DDTA 5FBLB 3M34A 1ODJA 3QENA 5TE9A 4WOJA 5J2UF 4QUHA 1ECBA 4OF4A 2JCVA 3CEAA 3SLRA 2QAGB 4BB6A 4IJQA 5G41A 3KKLA 4HQKA 1PHPA 3RVNA 4DCGA 5C1DA 1V45E 4HLCA 5F33A 3NVKI 4JLVA 5FA8A 3B7GA 3NJ8A 1WE2A 5EIOA 3J81A 2C9OA 1SUDA 2QU7A 2JFPA 1V35A 3AEKB 1IHDA 1CF9A 2X6QA 2XA9A 3U4IA 5E2BA 4RL4A 5DYGA 4YWJA 1WD5A 1CUJA 2P9BA 5JAQA 1EQ2A 3NASA 1THZA 2JFBA 2KS6A 2CFIA 2WKSA 2ZXEA 5HRAA 4Y2YA 4CLRA 4LYGA 3A6FA 3D1VA 1IOVA 1E1MA 1G55A 4L6CA 4HVAA 4FFVA 2DT5A 2ZRNA 3JQEA 4R8MA 2XA1A 4UAUA 2R6FA 4V0NA 4NE9A 1UBUS 4PC1A 4X1OA 1A7UA 2R1VA 2J7PA 4M0EA 3C3XA 4GICA 3E61A 1MX3A 3P4UA 1BEEA 3H0CA 3N2KA 2J0SA 1NZFA 1V11A 1KQ3A 5K5EA 3B53X 1NJGA 3HN6A 3DAOA 3FYTA 2XYRA 2VPXA 3IO5A 3MAAC 4F56A 5KCZA 1ZXXA 4D4LA 1EJBA 5KO2A 2VBFA 2Q2OA 4JT9A 4MGEA 4MKRA 4RPJA 3RFCA 4HR7A 1Z0UA 1G8MA 4HG2A 1LBHA 5LQCA 4CTJA 2IU3A 3A1VA 1ZH6A 3KJIA 4JR0A 3VSDA 4F6RA 1OF1A 2JIZA 5BSKA 4E7OA 3HJFA 1FJHA 2QRLA 3ENWA 2WPDA 3V8MA 2JAWA 4PYJA 2PX2A 4JEUA 2W2LA 4B6EA 1T6BY 5KQLA 3GLQA 4QYTA 1ZONA 1VJDA 2PO7A 3OESA 1T5OA 4F71A 1AXRA 2XWQA 3NIDB 1D2AA 3RK1A 1YI8A 4BV2A 5K6RA 5J4YA 4LXGA 3KX2A 4OUKX 1L8QA 1DJMA 4RU1A 1FNBA 4D1YA 2ZB4A 3HVJA 1NX9A 3HU2A 4FJ1A 1HT0A 4C76A 4JLJA 3GPIA 4JUBA 1F6DA 1XC7A 3MWEB 3TF5A 1F48A 5CYPA 4YMTA 1IBCA 3RC9A 1TYDE 4Q5IA 4B44A 3GLFA 5H8WA 2OG1A 4OMDA 2NXWA 1K92A 2IZZA 2W6ZA 5C35A 2YICA 1WVMA 3O8NA 3THOA 4JN6B 4D8WA 5CG1A 4WDRA 3PRKE 1M34B 1URPA 1ZHHA 4JC8A 4CCAA 1G4HA 2B1IA 2HF8A 2HHAA 2VJBA 2P4QA 1SOWA 3ZE6A 2QSUA 1G8YA 5B57C 5HSGA 1BXRB 1EZZA 1W0CA 3D6TB 4IDNA 4TYNA 5K20A 1ZQ1A 2IYYA 2VRBA 4HDKA 1QVAA 3QEMB 2PLFA 2PQ0A 3MT0A 3ON5A 1K1EA 4QEKA 1MAWA 2HR1A 2QR2A 1CEQA 3NIWA 3I6ZA 1IC6A 1HFEL 4BQIA 1KHHA 4OHPA 1TEHA 4OM7A 5A7FA 2DVMA 3F6PA 3SIRA 2FWAA 4AIRA 5C5IA 5FOVA 1V43A 2R7NA 3A3KA 4Q66C 2CLOB 1EVIA 3IR5A 2KHZA 5AVZA 1JDVA 3F1KA 2GETA 1NRWA 1U1FA 1UINA 3K53A 3ZHZA 1QGZA 1RWKA 4OFZA 3HXPA 4AZ3A 1FFXB 1OTXA 5LA6A 2CFTA 1IG3A 1SCIA 3N87A 1F2VA 4OI0A 1U8AA 3EGIA 1EFPA 4HH3C 5EZSA 3B1VA 2NUAB 2QBYA 1PT8A 1TC2A 3C1OA 3MWJA 1FQWA 3QOYA 1QHXA 2DBRA 3R1IA 4GOXA 4NU8X 4Y6PA 5G0UA 1J5PA 2WKWA 3ZW7A 4AMGA 4D9EA 1JR2A 3V34A 2VDOB 2XUQA 3B6JA 2QYHA 3FRHA 5CGZA 3VDNB 3VKFA 1BJKA 1G2QA 1HDGO 2Q4OA 1ZD3A 1ODKA 1JI0A 2QUJA 4H7KA 2NXNA 3DBHA 1XLTA 2KYRA 4FJ2A 1IJEA 1K3FA 5ENDA 3E8XA 3O2JA 1HSOA 2JLQA 5AKJA 2KQUA 3ZE2B 1HGXA 2VN8A 821PA 1LPNA 1U1DA 2CNWA 2XAAA 2WSMA 3H7AA 3WYDA 4E12A 1FQKA 1ZCFA 4LDNA 2PSJA 3EB9A 5JO0A 1L7OA 2R00C 2ZWMA 4O6VA 1NJ8A 3FPEA 2MT9A 5IW8A 2NSLA 3E5RA 1WHTB 4L8GA 5HM6A 3GBVA 3O94A 4NJMA 4DNQA 5TEVA 1TA9A 3L46A 1AS2A 3F5QA 4AJ4A 2Q6OA 2GJAA 4I46A 3WGIA 4RGBA 2A7XA 2AJBA 2VLBA 1GPDG 2YFQA 3K09C 3R5SA 4X8MA 2PE5A 2W4QA 1J8MF 3AUTA 1J22A 2BGTA 3HKCA 3SS9X 1RHKA 1WW3A 3KP1A 1H2EA 5FI0B 3PFNA 5JS7A 2V9PA 2NTJA 5CFLA 2FJPA 1VYVA 4FUTA 3BA6A 1H0HA 3EASA 2PUBA 1JHDA 2VDRB 3U44B 1NMXA 2GJKA 2NO7A 5A1TA 3DXZA 4B1FA 4EZBA 1RYMA 5K6AA 4A27A 3EEYA 4GM4A 2A5FA 1CVIA 3TX2A 1JJVA 2IY9A 2B8NA 1Y1QA 3OJLA 5A4AA 1LVGA 4CIVA 1S8OA 3KWLA 5DVZA 3PJDA 1F17A 4L08A 5JO9A 4MGYR 1A97A 3SSNA 5GIPE 1DGQA 2NZWA 1JLLA 1C4KA 4Q03A 2KPOA 2NQTA 2QQGA 1H2ZA 2CBZA 3MRVA 2PRYA 5AKZA 2EQAA 2YIDA 3N2KB 3PIRA 4LOAA 4RF3A 4EQ6A 3FHTA 4ZVVA 1DT5A 2BI8A 3Q2OA 3NFYA 4US2R 5EE5B 1MIHA 2AEMA 3KAJA 4HQLA 4US0R 4AC9A 3U37A 3I5UA 4JELA 2I91A 4CMGA 1ZX1A 4LJKA 2CBGA 4LSWA 4YMUA 1YL5A 3KTAB 4JJZA 3QNWA 4JP3A 2A3RA 1NHGA 3CVJA 4KC0A 4BKQA 3ILVA 3G68A 1PR6A 1PQUA 2ZI5A 1KDOA 1AKMA 1GTG1 3JPWA 1A9PA 3CO0S 4BE7B 3ZBQA 2NO0A 3DC2A 1K5PA 2EV9A 2PIDA 2YN2A 4L95C 1M5TA 3VPFA 3BCSA 1O9GA 1WCIB 2F48A 1DAFA 1V1RA 4DL9A 4PZUA 4TLMB 1TT7A 2J9GA 2Q9BA 4HVCA 2Q6KA 3DBRA 2GFIA 3N2ZB 1ISFA 3T9CA 2OO7A 4BQRA 4RK0A 1II8B 2I4MA 2JLXA 1KYYA 3WBJA 1N8TA 1IN1A 1DFHA 1UKCA 4NICA 2SBTA 5B1DA 3C45A 4JU9A 4P5DA 4TN5A 3X1WA 4ZICA 5BMVB 2A9PA 2QMHA 3KYDB 2YXBA 1YOBA 2HGSA 2NTEA 1WY7A 1J2UA 1QOZA 2VHWA 3ENZA 2PZBA 3OKPA 4M0LA 1NIPA 3LCMA 1NC3A 3AH8A 1JQKA 1ZVQA 3PGKA 1DBWA 3WGVA 1AGYA 1J23A 4RLHA 3OZVA 4PIVA 5KJEA 4IF4A 3QPUA 1AUXA 2A5DA 2RH9B 3FCYA 2VAMA 3QWFA 1ZRHA 3DAHA 4OFXA 2IZ6A 1YZNA 2Q5OA 1PYGA 4CDNA 4US1R 1ZOIA 3O03A 5CVDA 4OG2A 2ZM5A 4JA0A 5BO5A 1S7CA 1VGVA 3CS3A 3NNNA 4X8HA 5I9TA 1V2HE 3ZDEA 3CY6A 5HJ5A 2WDZA 4HBZA 4MV7A 1YE3A 4KPUB 3S7ZA 3WDKA 2WQ6A 1BN7A 4RFSA 3WWDA 4YT4A 2X9GA 3ESZA 2JBAA 2QP9X 1ZN8A 3HV2A 1NLFA 2ECFA 5BSTA 4ESOA 2K7FA 2JLZA 1DTEA 1G20B 1JEJA 4ML3A 1HTTA 1BU8A 1TI7A 4KOAA 4L5JA 2PSFA 3I6IA 5INTA 3AFIA 1AHNA 3D7SA 4G5RA 5ALNA 2AW5A 3ZCTA 4M1WA 5DTMA 3GFRA 1ZA1A 4TT3A 4WMLA 3WL5A 4FHGA 3E3MA 3KKZA 1NF2A 4G36A 1CU1A 3WV4A 5JALA 4UE2A 4HRYA 2FXVA 3NT4A 4ARZA 1NP7A 3T3EA 1EP9A 4W5RA 4QBGB 4WH0A 4AMZA 4MUIA 3TFOA 4I1VA 4LXUA 4QDKA 4YAEA 1SN7A 1RKXA 2O3RA 4CHTA 3ZPXA 1U2DA 4HF7A 4I1UA 3CLTC 5HF8A 4ZCQA 5E7MA 3SQLA 3WLJA 2OHJA 1XRQA 3Q7QA 4OP2A 4EITA 4QTYA 4ITVA 3N2NA 3WBBA 1PR0A 3FWYA 3ZGNA 1X7YB 2O0LA 3DMYA 3DYVA 4GG1A 3U81A 2ZS9A 3VV2A 4UHBA 1N8NA 3HVIA 4FX5A 3C3AA 2BFBB 5CTJA 1G9SA 2RI1A 3K2IA 3OKFA 4NE2A 2I3DA 4OXNA 4D3YA 4ZQFA 1MABA 3EGXA 2OPBA 3HP7A 1DIBA 2Y8EA 3D3WB 1P1HA 1GSAA 1R74A 3CSUA 3LVQE 3AR4A 1C8BA 4JI1B 2WF8A 4D9BA 5JYDA 1AU9A 2Q7XA 3STHA 2P35A 5FFMA 1P9LA 3A3PA 1U2EA 3CX4A 3D2BA 1HNWB 4DQXA 4EFMA 4YRPA 3KUKA 3DDSA 1KI2A 1Q21A 3FOAA 1SAYA 3VTZA 1N3BA 3L7MA 5JXJA 1AKRA 4B34A 4ER6A 1T9GS 3UHFA 4RK7A 2QSYA 2YZMA 1A9OA 1QZXA 3H5IA 1CUAA 4XCVA 2FZ4A 3Q12A 2FHPA 2OSBA 3GLFE 5NLLA 1UXOA 3NDRA 5E2AA 3DR3A 5CA1F 3LW8A 2VP5A 4B76A 1N9GB 1RLMA 3ZG6A 2CNOA 3JYLA 5JEDA 3WAGA 4B8YA 1CZLA 4ZAXA 4RK4A 3L79A 1GRVA 4KYVA 5LDDC 4REOA 3H6HA 1C30A 1Q1GA 1GA1A 4TWAA 1X1CA 1I4EB 3DW1X 3K96A 1NUUA 3ZWQA 4ZDIA 3BMXA 4JHLA 1QUEA 2C95A 3ETEA 1U8EA 4K9LA 2WWVD 4DBLC 4EH1A 3V3KA 2HWYA 4HDNB 2WAAA 3HR4A 1KWGA 3B3QA 4YJ2A 1QP4A 5COQA 3QUTA 4L6IA 1M5RA 5ITZA 1L5FA 3ADPA 3ROZA 1XVIA 3LTEA 4O2BF 3OO1A 1A9SA 1T4BA 3DTVA 5AXDA 4JV5B 2NT4A 3ESYA 4I5GA 3UF0A 4HQ6A 3VPSA 3EEFA 4GI2A 1GKUB 2REBA 1CIPA 4KEAA 5D8DA 4EP1A 2P2LA 3AF2A 3M4ZA 1PR3A 1E9EA 1M1NA 2TECE 3EQZA 2P40A 4HNTA 5LKRA 2FE4A 3CCCA 4PC2A 2VUIB 4PLHA 4AJJA 3W6NA 2M6KA 4MQUA 1JN0A 3U3XA 5IU6A 3S99A 1AMUA 3TUJC 1OXXK 4NHEA 4BV9A 2JBAB 5IAGA 3DTVB 1LNSA 1UIMA 2P9HA 4PSKA 2O4UX 5DNCA 1Y3BE 1I4DD 3EX7C 3U61B 2JGKA 4QGFA 1KAOA 4QL3A 1ZJWA 4OBEA 2QTVB 2XR1A 4M0CA 4GYKA 3VYVA 2EX4A 2XSZD 1FDVA 2P0AA 2AK2A 2HREA 2R47A 3DE7X 4MI6A 2W2KB 1YZQA 2VSQA 1U0SY 4HQ0A 3LNTA 4I8DA 5D1NA 2Q8NA 1MC1A 2OCDA 3P32A 2XDQA 4EY5A 3G5MA 2F7SA 2OGZA 1N32B 4FSHA 5B64A 4CMBA 3GH1A 1KO5A 1Z5GA 5LQSA 2AD5A 4N48A 3CNEA 2P41A 4K5QA 1S8AA 3RYTC 3FFBA 4KREA 1KQOA 3IVCA 2O14A 3E2IA 3BHJA 4PVDA 5FXMA 5K8VA 5LIRA 4Q05A 3R7WB 3MXOA 3KQWA 4I6JA 5F5LA 4YCSA 4E11A 4BLWA 1THMA 2WWYA 1XG5A 1V8PA 4YP9A 3LZ6A 3UHOA 1OBHA 3ETJA 3QXCA 3USZA 2PL9A 3FUUA 1HMYA 1E2NA 4Q1AA 4E70A 3FD8A 2FFBA 3KKOA 3D3WA 4RZSA 4FR0A 4BMZA 2V7VA 1OH7A 3OQIA 1NMYA 1GQYA 5K9ZA 4G4SO 5B1SA 4BP9A 2NO9A 4MYTA 4RPKA 4BFWA 4ZYVA 4CXMA 1B14A 4K3UA 1VCHA 1ESMA 2RMKA 1Y98A 2Q3JA 2FZLA 1KI9A 2QTMA 1UC8A 2OB2A 3FNFA 3MJEA 3OZFA 3PVSA 4GWLA 3J7AC 4LKOA 5CLHA 4RADA 1IBMB 2IBTA 1TGYA 2GBGA 5EZ5A 1X7XB 2BFCA 4V2UA 1KFCB 5ED4A 1KP3A 3EFEA 4ZMSA 2A57A 3CXUA 1X1BA 3LP8A 1ZJ4A 3EEBA 3NNSA 5FOQA 2QJOA 5DSXA 4EG0A 1OWMA 3DZIA 1L5OA 4IIJB 4OB6A 1G7RA 3M4XA 4PLWA 1E79D 1IY1A 1XOIA 2F9MA 4N0MA 4W1QA 3W4IA 2XQKA 1ISHA 4GM1A 2XGGA 2EJVA 2QZSA 5F1KA 4EIWA 3MRSA 4MYRA 4M1KA 3VSBA 5JATA 2C8VA 5BN5B 5G3ZA 2IYSA 1XKQA 2EEPA 4UEJA 5IT0A 4ZTZB 1Y8ZA 4DR4B 4BNDB 4EX7A 1BROA 1C1YA 4B75A 3DVAA 3WRVA 4PZ0A 4ZI3A 5FV4A 1XD9A 2K5UA 1YMVA 4OQQA 4BCBA 1I7QB 1N7JA 2W6NA 4A6EA 3HXOA 1ZESA 4N8DA 1E59A 4QPNA 4P92A 5THKA 2PMEA 3T8YA 3EVFA 4TMFA 2I3AA 1YS2X 4AUMA 5CFZA 4KLNA 1L7BA 1LC3A 3VUEA 3DMPA 3DM5A 2VTKA 4V1CA 5JTTA 2HRRA 2BE7A 3NGMA 5FUYA 1Q7BA 2PH1A 5EXSA 3HCDA 1OMOA 4BWYA 1JI3A 2B3TA 3WAKA 3ZD7A 1XJWA 2IPLA 1QRAA 2CV1A 4OV6B 3LBHA 2J41A 2CWWA 2KLHA 3AXSA 1HYHA 1RRMA 2R6AA 3FMPB 3OPYA 4H17A 4J0CA 4RVFA 3I39X 5FQOA 2FK7A 4FLFA 4HH0A 4C0HA 3W6ZA 5IULC 5CLQA 3N6XA 1WA5A 3FUXA 1PX0A 3RG8A 2CMGA 3I45A 1E77A 5IZCA 1BTOA 2VTEA 2YXEA 3FKSD 1QGAA 4XXHA 3SC6A 3HJBA 4Q37A 1UFKA 4PEVA 4EMTA 4UKDA 2X5JO 4B6RA 5K3EA 1FVHA 2E82A 2RBEA 3NHZA 4CV3A 1E18A 1RLJA 4WKBA 4EABA 4BEJA 4F8YA 1Z26A 2PTHA 5GJBA 3X3HA 1UPCA 1T9CA 1DB3A 1QAMA 3K0CA 3P0FA 4CGZA 2NZ2A 4WE3A 2YMPA 2V0CA 4E5UA 2XVZA 1IWBB 3JVIA 4MA4A 3BIWA 3LUHA 4RMNA 2CHVA 3G49A 4JJ6A 1ELOA 1NN5A 2NZUG 2Y4OA 3PGLA 4IXWA 5BP7A 3HCPA 1LBSA 1F9EA 1T5DX 1HLPA 1NQTA 1IY2A 1SKUA 3MYRA 1EFVA 1RZUA 3AR5A 3CUEF 4YONB 4HRAA 1P7WA 1TL7C 1MAHA 4R6XA 1VIYA 5EHQA 3WFIA 3JQ7A 3T3DA 4H59A 4PVCA 3UENA 4M55A 1MNAA 4P32A 1E0DA 2XD4A 1I4WA 1GCGA 2JL1A 2VDJA 3BH6A 1UK9A 3TQFA 3GZ4A 2GEVA 4FHEA 1SHUX 4NZZA 4G5GA 2I1WA 3O5AA 1DINA 3IEIA 3WK8A 2OV1A 1UPBA 1XHFA 4F46A 2VEDA 1JB1A 3V4ZA 2P75A 1NW9B 5LD2B 3VH4A 4WNAA 4TKMA 2VP6A 3S44A 3ZK7A 2HYDA 3QY0A 3VX4A 4D25A 1I1QB 5DPMA 4X62B 3PC2A 2DGDA 4HAZA 5BR1A 5HQTA 1RZRD 4MS1A 4C04A 4K6GA 3ER9A 4ZVLA 2H1LA 4MCAA 2HMTA 1QAQA 1C2TA 2ZYUX 3AGQA 4L5YA 2ISQA 2BCEA 2ORVA 4YV0A 1GGKA 5A4IS 4P7JA 3LT0A 4JJ8A 4LE2A 1Z73A 4FTWA 1DMSA 3GGJA 4PYNA 4YAGA 2WKQA 4HWKA 1SCJA 3HDGA 3VR6A 4E4TA 2OMEA 2W37A 3ET4A 1W52X 3B1ZA 4DBLE 4O4HB 1O0CA 5KTRA 3FZYA 4LCEA 4NLLA 4UCFA 1QHHA 3QKSA 3JQGB 1NDUA 2K2QB 4WKCA 5AK6A 1HOTA 3FRIA 4J16A 4FGJA 4IEIA 2BUCA 3BHIA 5G0VA 5A0FA 3W2HA 3PUKA 5YASA 2I6SA 1M2EA 4AKSA 3TTTA 4TTTS 2VNKA 5DHUA 3M9LA 2G8LA 5IVPA 2XVXA 1P1JA 3WL7A 3O1LA 2FLKA 2CUKA 2GTIA 4URWR 1Z13A 5KVCA 5BUCA 1RPZA 5F9MA 4IEFB 5IKOA 5HNKA 2N1BA 3CZ5A 3BF7A 1Y63A 3ZCPA 3GV0A 2X3UA 3PNVA 1EAMA 1TFRA 1UFOA 3NUQA 1DT3A 2JVKA 3NC4A 1J2EA 1WMAA 5HIMA 3IUMA 2IX9A 1QK5A 1N5IA 5IF3A 5DYIA 5EUCA 3FA2A 2PBFA 2Y3IA 3HFSA 3REGA 1MQAA 4AWBA 5B6PA 1F12A 1E7SA 1LPMA 1W96A 4KUGA 2EBFX 3UCEA 3QLUA 3UJ7A 1LPPA 2HXGA 3TNDA 4MVJG 4LDPA 1KE2A 2EJCA 4DMFA 2XB8A 3FYUB 4MIKA 4MV4A 5JPCA 2Y0PA 2PX6A 3JATB 1XJQA 2NO6A 4PBTA 1YK1A 3BXOA 1IPFA 1QGDA 2AH5A 5M7EA 1X8LA 2O9JA 1QYIA 3LNCA 3JAWB 1QSGA 5AKIA 5C4IA 2V4ZA 2Z6AA 2BKEA 4DLBA 3LX4A 1RQXA 2LP4Y 3ZGLA 2DLDA 1FFHA 3GQBB 5AQ1A 1W9MA 1EGAA 4ZMBA 1JQAA 4Q9DA 4R05A 4RXUA 4C07A 5KBYA 3DMTA 2WA2A 1QS0A 1B2RA 3GN2A 3WSWA 3VR4A 3RS8A 2ERXA 1ZICA 1OROA 2B7CA 3DGEC 1APBA 3CN9A 1PGPA 4X7BA 1O8BA 1R4AA 3THXA 1GLVA 2PN1A 2PX8A 4GX1A 4CN8A 3O3MB 3FOFC 4KXLA 3ZBTA 5KSPA 4QODA 3RWOA 3N1UA 4WCVA 5GAJA 1FDOA 2QD5A 4Q9HA 2Y67A 1BIFA 2FEOA 4BWFB 2QU8A 5FPTA 4M0KA 1EQUA 2Y99A 1E2UA 1KMHB 4EHLA 3CGGA 2GPSA 3S8YA 3KBOA 2XD9A 2ACKA 1M2VA 3MHTA 1WCXA 3KVVA 3JWJA 3O84A 3RIHA 2IRWA 3G9ZA 3DLAA 4JP5A 3U0VA 3DO6A 4QUEA 4IJ5A 3PNLA 2HQRA 4NARA 3IV9A 1QLWA 2V7BA 4YS6A 5C1OA 1G21B 2OXIA 2QENA 3K1TA 4CNQA 4TKLA 2OVFA 1K2WA 1DKNA 1Q3HA 1XJCA 4QXRA 3SI7A 4CUKA 4DM7A 1L5RA 6AT1A 5IXYA 5KYWB 2F67A 5EKXA 5F4ZA 1C8VB 3EMKA 2HI0A 3PVCA 3SYKA 1P8JA 2VUHB 3DE2X 3RVRA 1G20A 4PO9A 5B58C 4TSKA 1SG6A 3ZVNA 5A0VA 4X1KA 3R9XB 3SHOA 3QTBA 1NYQA 4DCMA 4EF4A 1OTYA 1E8MA 1C81A 3I8XA 3SBEA 2YWGA 5D5HA 4MQ4A 1DAKA 4RLSA 5AJZA 2YJ4A 4Q21A 3HU3A 2WAYA 1R1DA 1Q14A 4D8TA 6PFKA 3EJWA 2GCGA 3UPUA 2I4LA 1KVSA 2QUAA 4BX2A 4MLDA 1L5WA 1UANA 3DG9A 3P5SA 3BTOA 3KQOA 5GM1A 3B82A 4CKZA 2ZVDA 2WWGA 4BTVA 3BXPA 1U6JA 2HLDA 2VJNA 3AYXB 3CUSA 3DBLA 3VC1A 1ISRA 2RH8A 4FZ3A 3JD4A 2GJSA 2TYSB 3GRYA 4A26A 3ACCA 3Q9UA 1MAVA 2PD3A 1WF6A 4M8KA 2Z43A 3M82A 4Y67A 1GHTA 4M9QA 2PJUA 1NBIA 1M6YA 3K0FA 3HN7A 4A0QA 2F17A 3NOXA 3HGMA 3O9ZA 2XYGA 3O83A 5AJWA 2GZSA 4BJ1A 4RV5A 2QRGA 3M3DA 1UT6A 3U7RA 3C5HA 1IJBA 5FOWA 3HXKA 3VC7A 4C5AA 1U2QA 3GX1A 4S0ZA 2QGFA 2E85A 4L4XA 4RLQA 3IOBA 1F0KA 3HRIA 1JLSA 2RHMA 3PXGA 3L8MA 3IT3A 4UM8B 2VUTA 1STOA 3EXFB 4OB8A 4XB6B 5EWLA 4DQ0A 3K6SA 4GPBA 3LT5A 4IOKA 1EHYA 1JJFA 2PT5A 3BD6A 4EDHA 1KYZA 2L18A 4HZGA 5LU9A 1IVSA 1DO0A 2GPBA 2JFHA 2JJMA 3AFNA 4IQFA 3R8FA 4V0ME 4IM7A 3V1UA 3F4KA 2VPIA 4CVNA 1QC5B 5IASA 1PBNA 4OA8A 4MW4A 3DE3X 1OJ7A 4X20B 3ZS8A 2I7DA 3VC3A 4BFTA 1KHTA 1NV9A 2QZJA 3BWCA 3E3NA 4BMSA 1JDBB 1P7ZA 4XYEA 2PKRA 5DN9A 2GH1A 3W2GA 3WC4A 4Q9NA 2GLTA 4EO9A 4FGLA 3AY6A 4O1HA 1VJGA 2I4OA 4JLWA 1Q0LA 2B5OA 4I5EA 3DH0A 4Z4CA 4Y9DA 4QDOA 4NFHA 5EPOA 4CLHA 4L50A 3HA7A 3WJ7A 4GP6A 1HFJA 3PLAE 3JWIA 3ME5A 5CU7A 1WPXA 4EGJA 621PA 3UGJA 1GQOA 2PQ2A 2Z6VA 2OYSA 5EY5B 1RC8A 4KSYA 4RL6A 2DLNA 3ZWYA 2ZSUA 5C9ZA 2V98A 3W8NA 1TUEA 1Q57A 1LWOA 3DZDA 3E22B 3NEJA 3NTOA 1W1UA 5D85A 4E5VA 3N28A 3SHVA 3CNQS 1KZ6A 3GJ5A 2QIPA 3KS9A 4MB6A 1PR5A 4U00A 3EFOB 3WRYA 4JI3B 3SXUB 1NQ5A 5CB0A 3C6XA 2J9ZB 4QULA 3VU3A 3ELWA 1OWPA 3VFDA 4X41A 1W75A 2C77A 2HQBA 3UC5A 4YXWA 4DG5A 3ZCUA 4IZIA 2WK1A 4AO7A 5HOQA 4WXYB 2GN1A 1PUJA 4J29A 5TGDA 3CUUA 4P3KA 4Y9TA 1NN3A 1N0UA 3OJXA 2JPDA 1Z56C 4S1VA 2CJPA 5ENVA 1SXGA 5BXQC 4HYYA 2OL4A 1GM5A 2FU5C 6REQA 2WHXA 1IDOA 4MB0A 3OTGA 3A0RB 2RK6A 5L3RA 1FPQA 1OBOA 3W8DA 2XB4A 1QG4A 1FTSA 4BYMA 1OVGA 2W2LD 3GEMA 4JLAA 3A1TA 4GQBA 4ZODA 3KZOA 4B32A 4OVKA 3B36A 4WACA 4D9FA 4KJZA 1T0BA 1DIAA 2GHTA 1CJUC 3BFVA 1NGSA 1TUIA 2B8WA 1BSVA 2XAUA 2ZTHA 1YK0A 1AZLA 2A5LA 2DBVO 3FJYA 1RYBA 4IVRA 1SXJD 4X3PA 5LDGA 1FS5A 4MS3A 1PJZA 3KQKA 1F8YA 3D2CA 4NPAA 1TVMA 4Y7DA 2BTOA 4WA7A 2HK7A 1NURA 1Z6QA 3DV0A 1XNGA 1BE1A 5EZYB 2HT1A 4Z6KA 4Z7NB 1QS0B 3SBXA 1NF8A 3RARA 2C9DA 1NF3A 3L04A 1LSUA 4D43A 4S04A 4GZ6A 3LHKA 3LRTA 2MSEB 3AJEA 4PHTA 5IVHA 1JPNA 5A71A 2RAPA 3K8QA 3OTQA 1LBIA 3T7SA 1U9JA 2HCJB 3BIFA 3EFHA 3OOSA 2Y66A 1QYWA 2PKYX 4DYVA 4FB5A 4DV6B 3H2BA 1X7ZB 2W6MA 3PL5A 1C9YA 2GBFA 3EARA 3PUYA 5DHPA 4M7PA 2H5LA 1G3MA 5AW3A 5AVSA 1M6NA 4DUZB 4EAAA 3U3ZA 3URKA 5KNCD 1A5ZA 1U7DA 3R6LA 4HQNA 2Y1WA 2HF2A 1DX9A 2EAUA 4PGGA 1I7NA 1XZJA 4AYWA 3KU1A 2Q07A 5DOVA 1J0CA 1HQYE 1RR6A 3O8DA 4RD4A 1UJ6A 3L9XA 1YSCA 1C4XA 2H4ZA 2H7CA <