2PH7A

Crystal structure of af2093 from archaeoglobus fulgidus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
227
structure length
220
Chain Sequence
GMDVEIVEELSKMLAGRKAVTEEEIRRKAIRCALKIMGARLVGIDAELIEDVTCSLIDLHFSEKVKIGDVLFYHPHVIKPEKEDFEQAYFEYKQSKKFLDAFDIMREVTDRFFEGYEAEGRYMRKYTKDGRNYYAFFSTIDDTFEDVDIHLRMVDEVDGDYVVIVPTENELNPFLKFFKQYSEDAKRAGLKIWVVNPDEKTIDPFIGYPKDFRLLKGFKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AF_2093
publication title Crystal structure of AF2093 from Archaeoglobus fulgidus.
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 54
structure length 220
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3400.10 Mainly Alpha Orthogonal Bundle af_2093 domain like fold af_2093 domain like 2ph7A01
3.40.50.10670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold af2093 domain 2ph7A02
2PH7A
chains in the Genus database with same CATH superfamily
3BL5A 3G5LA 2QUIA 1HC7A 3UJBA 5HQ3B 2YWHA 4B3HA 4MVJG 2RAVA 3GLFA 4FW8A 3T9AA 3W6ZA 3JQ7A 3PGKA 4PZLA 4ZVKA 4L2IB 3V9AA 3N76A 4DQLA 3G0OA 4EF6A 4P4SA 1TJ3A 1UKCA 3L43A 1SU7A 1DSSG 3KYDA 1ENZA 1XD2B 1MXFA 1ZS9A 2XD4A 3H9UA 1H4SA 4XGNA 3RD5A 1R0RE 4M9CA 4OOFA 3Q3EA 4YUWA 2HLDD 1U2QA 5DWVA 1FF9A 1R0BA 1G3UA 2CL6X 4GI2A 4GXNA 4L51A 2HIAA 1T0UA 4NOMA 4PSVA 1KRXA 2QKYA 4UD6A 4YK7A 5G40A 4LYHA 1IOVA 2GHQA 2XB2A 4J3FA 4Q4AA 4MMXB 4X7RA 5JWHA 2DLDA 4UMDA 1AGRA 1TUBB 2D1FA 4OI4A 5AKLA 3SXUA 2YBDA 2EC5A 3UT5B 3KDSE 4BV8A 5ABPA 3TLYA 5M5BA 4TWIA 1EHYA 2QU8A 3Q7TA 4B5LA 1J2RA 3PDWA 4BYMA 4RM3A 3VHQA 1DIGA 4A92A 1ZMBA 4JELA 3PFIA 5EJAA 3JQ8A 4HR7A 4LBYA 5K01A 1JJAA 3LBIA 1UXHA 2GCPA 5K20A 1XKLA 1GSOA 3MTIA 4Y0AA 1E6MA 2YUIA 4V0ME 1WBDA 1CUXA 4BNHA 1SPBS 1UXIA 4INAA 3EX7C 5DK4A 5IJ9A 4RPLA 3BE5A 3C3WA 4DIBA 2HDWA 2IXTA 2VBCA 1FQWA 1VDMA 2A9PA 4F45A 1EDBA 2VHCA 2BISA 3FHJA 4WZAB 5DLQC 5I51A 2W2VA 1ZQ9A 2ZXFA 1YO6A 2ADFA 4J94A 4WVFA 4AG6A 3FNBA 1YVRA 5T41A 1VDZA 1IXRC 3K5PA 1RRPA 3WLMA 3KXPA 1TECE 1P19A 4AKIA 4HDCA 5CYGA 5KTRA 4I8DA 4QVKA 4ZGBA 3KZMA 3KS9A 2IBMA 5TQ2B 1ISPA 4FN4A 5JVDB 4CRWB 1ICIA 3CMCO 2IV3A 4C9BA 5K0ZA 1QTQA 1DIOB 1LF5A 4WDQA 5HEKA 3BMQB 3NEAA 2FKNA 2ZATA 2E9SA 2QRUA 2ZYIA 3P1JA 3PYMA 4YRCA 1E8MA 1M2VA 2N47A 1D3AA 3K5IA 4YXWA 4GOKA 1LVUA 4D57A 1CU1A 1HFEL 1LWOA 3Q8WA 2E5FA 2WM9B 5DWQA 3EZ9A 3NVAA 4D97A 4ZYXA 1G4AE 1HSOA 2HB6A 3RVQA 4CM9D 1SXJC 5AXAA 2OQRA 2I6GA 4BGDA 4B47A 1NWCA 3A9UA 1C9DB 3GC6A 4HX2A 5FKJA 3G8CA 4BX3A 5JBIA 1V11B 2Q3JA 3KUKA 2MINB 2Y2VA 4BVGA 4D96A 3W90A 2Z3ZA 4IV5A 3HABA 2HA3A 4EO9A 1CR1A 3WGUA 4H1WA 4KITB 3GEEA 3PQ8A 3O9ZA 3BMOB 4P0TA 4BWYA 4RD3A 1ZD5A 3E9EA 4X8HA 3K8QA 3IFSA 3BILA 2YCBA 3AR2A 1YCDA 1HE2A 2O1WA 1DU4A 1L1EA 1TMYA 3C3EA 3MLBA 3QBTA 3EWNA 3KZNA 1HK7A 3RUDA 4BKRA 5IKPA 1AHIA 3A2LA 4KBGA 2ZWPA 4TXJA 3Q85A 2PRSA 1TYZA 1WF3A 3UQZA 2J9XB 4F72A 1WCXA 3A32A 3HUFA 5ALEA 4B48A 4C7KA 3O74A 5K3DA 4PN3A 4QJ3A 1MC1A 2D4AA 5C1DA 3C8ZA 1WSDA 3C8HA 3AEXA 4QQRA 4DS3A 5IMSA 2I7TA 1BD3A 2GWHA 3GWZA 4XCVA 4XQGA 4Y6OA 4QYIB 5F51A 2O3SA 4WWHA 2DAPA 3AESA 4G4SP 5AJYA 4HI0E 2F59A 1CY0A 3GMIA 2ACWA 2DY0A 2JBAB 4GP6A 3UWKA 5C52B 1I10A 1FLDA 1V0JA 2CNKA 4R9NA 5I7WA 3ONDA 3JU3A 3C39A 3QOYA 3HYRA 4Z9FA 5F77A 1Q22A 3CJTA 3RBXA 4AKEA 1GLNA 1DJOA 3A10A 5EP3A 4FYVA 3CNQS 1LNZA 4R0NA 5FD8A 2BGRA 1V1MA 1UFKA 2NGRA 2X41A 3RUHA 3KOMA 3DLHA 2GB4A 2YV2A 4WI1A 3WSVA 3RVSA 821PA 2Q46A 5IU6A 3N7UA 2ILTA 3AUSA 5JQGA 5IM4A 1LFAA 1NJFA 3MJTA 3O8OB 1OKKD 3BDVA 4XLTA 4LDZA 3TZBA 4JI6B 1WXDA 2G28A 1GV0A 4CNBA 3DEYX 4LG1A 5TPZD 5KOHA 4U8GA 3I5UA 1KQ3A 1QUFA 2WHQA 4ND1A 5CX1B 1SUDA 1BE0A 3OWXA 3TTUA 2O1EA 3E4CA 4IRXA 4GPTA 1XZ8A 2ZRMA 4BUZA 2BMWA 3GPDG 3KHUA 2I6FA 5H1YA 1I9CA 1NVVR 1PUJA 2UUBB 3Q7RA 4YCBA 2WAOA 4Q47A 9MHTA 3JS5A 1H0SA 1AUPA 3BB1A 1DEHA 1E6UA 1MB2A 1IZYA 4FNGA 3IURA 3D7NA 2JLRA 4JCOA 3AWIA 2AYZA 3BZUA 1KJQA 3MINA 2EKQA 4CT0A 2D4HA 3TRKA 3WYCA 1U2DC 3HNPA 3W5UA 4MDFA 3UAYA 2ZBVA 4MS1A 2LDXA 2FLWA 3CJRA 3R0ZA 3GG9A 5IJ9B 1KL7A 3GLHE 3FNQA 4R1NA 3Q8XB 4MQEB 4V03A 5CT6A 2E4XA 2D59A 2BONA 3AI1A 1H8HA 3EIUA 1IAVA 3ZOKA 3KQYA 5JSYA 5KOYA 3FOWA 5MN5A 4L07A 3OLXA 2REQA 1J0EA 5BVGA 3GGSA 4I55B 3PDIA 4YXFA 2AOWA 2AGVA 1HMPA 3INGA 3KCQA 3O83A 5DXJA 2A5GA 4G3XA 5A9TA 1JTVA 1TM1E 1U0SY 1FW6A 1Z0UA 3R3UA 1AV7A 4FHGA 3IIKA 3QBEA 1SMKA 3EVDA 3C8MA 4PY2A 1LVHA 1Z4QA 5LP1A 3K09A 4II2A 2VPPA 4LCEA 1P7PA 5BV1A 1C81A 2HLPA 1YZNA 3JASA 1A9SA 1XNGA 3K6RA 1V6AA 3GEDA 5SZJA 4CQNA 4OKIA 3V4ZA 3DDWA 1I5OA 1ZUWA 3FPKA 4ZOLF 2GXUA 4YAJA 2XQFA 1OAOC 3KEQA 2AH5A 1QP4A 1OC2A 1PJCA 1BWPA 1FFCA 4QXQA 2PGXA 1HYQA 1D2RA 2G36A 3K0HA 2OGSA 3QKRB 4ZQEA 1PG0A 1VJ1A 4C88A 4EB8A 1QVZA 2A1IA 2ECPA 3EGDB 4Z7OB 1Y5LA 5HUJA 3SYLA 1J9ZA 2O0HA 3B52X 3G1WA 3DM9B 5EHIA 5FPPA 3ZQJA 4NZZA 2P2GA 5P8WA 3GNTA 2HTEA 4FOTA 5IULC 2PAFA 3OCCA 1OU4A 2WSMA 4CMEC 3DVLA 3QPWA 4BZXA 1GP2A 3P0HA 2RHJA 3K73O 1Q1ZA 4RPIA 2V59A 5DSZA 1SKQA 4O2AB 2DYKA 1TCCA 3DKKA 4ESEA 1FFHA 4JC4A 3L07A 5K0CA 4IEIA 3W79A 4I3HA 1M72A 1T5LA 2HA0A 3CZQA 4PAQA 4CLOB 3FGNA 1J8VA 1Z73A 1XX6A 4UUQA 5EG5A 4N40A 4MV9A 4RZ2A 3AMVA 3LLVA 4JKIA 4G84A 3KWLA 2BTOA 2FWIA 1UH5A 4MKHA 3C5WP 2JAQA 3ETDA 3PXEA 3QUCA 3GFSA 2HF7A 5BQXA 6Q21A 3N2YA 3C24A 5FAKA 2OV2A 2VF8A 4FDMA 2A4MA 4WN3A 4GKJB 1DCKA 2QAGA 2WWIA 2AZ4A 2NU8A 1BHSA 3FAKA 1R6XA 3CW2A 1OWLA 4LE0A 1JLMA 4JEHA 1QGOA 5D84A 2PGAA 4K03A 4MQUA 4ZJZA 6GPBA 1BQ4A 1Q0ZA 1ZU5A 4UBLA 4AWBA 4AS3A 3SYNA 3LSYA 2P9JA 3AEYA 2VXYA 4GWGA 3SM9A 2XY4A 1P1FA 2Z58A 3PEVA 1T2VA 3Q3IA 2AYXA 4I5DA 4NBNA 1Z6QA 2Q5IA 2QRLA 4XGIA 4Y2UA 3RC9A 2VP6A 3DAGA 1LBEA 2AW5A 3L7YA 3ND6A 5I9NA 4B6SA 4ZU6X 5JZMA 1T4DA 2UDPA 3NKVA 4OYYA 4X97A 1H2EA 4ZO8A 1E2DA 1VQ1A 4BBZA 4F9TA 2R751 1C9EA 2QPTA 4J16C 1J33A 5JFOA 3D0KA 4I4TB 1G3MA 4Z1MD 1UKBA 2I5PO 3C48A 4DYDA 4DSZA 1BEZA 4RDXA 2FXIA 3A4TA 4LPSA 2IS4A 2VTEA 1G3RA 1RIFA 3OQ1A 3LLCA 1UFOA 4L0QA 2G9QA 4MX8A 4Q9KA 3SYKA 5GINE 3OTGA 2ZCJA 1VG8A 2QLLA 5K2MA 4F38A 3LM8A 3ZTTA 4B2IA 2VSXA 1Z4JA 3P2EA 2QRVA 2OLJA 1A96A 4GR9A 4EBBA 4HC4A 1CXZA 2C5FA 1J21A 2F9MA 2JH8A 3DOOA 2VWQA 3LBAA 4G0YA 1NZDA 4IUBS 4KK4A 4R51A 5JZSA 3C3CA 1U8FO 2QIOA 1W2GA 2QM8A 4BQIA 1EVJA 3EDQA 1SXJB 2AOVA 1QBGA 3K2EA 3MTDA 4PYKA 4JUDX 3JYPA 4UCFA 4OXYA 1UFVA 4ZKDA 3UOGA 4YRLA 3AF2A 4URHA 4G2NA 1RNLA 1ISIA 5ALDA 4WLUA 2FWNA 3ESAA 4A27A 1ONBA 3GRFA 4P31A 1B6RA 1CR4A 1U63A 2G0TA 2WKWA 3WRYC 2B5VA 4BE7B 1D4OA 4PG4A 5GGYA 3RREA 3ABOB 1F5SA 1N1EA 1AKMA 5ER6A 1IQPA 4GOOD 4JQCA 3BT7A 3OJLA 3B8EA 1FNNA 3A1EA 4KIGA 4PWYA 1UOOA 5MF6A 3TI9A 4R1UA 1CIJA 1C3EA 1SIOA 2I71A 2J6CA 3EMBA 3VZCA 4F5DA 5G4KB 3B38A 5JRJA 2B1GA 4IJQA 4LN1A 4OB6A 3FTPA 1BN7A 2A0UA 2XYHA 3OTOB 2E0IA 4Q00A 2OG2A 3SGLA 2CCJA 3QFHA 1D0SA 4NFYA 3CIFA 4XTRA 3EUAA 1DGQA 3FNFA 4KBFA 5ITSA 1ECFA 2OCYC 3KCNA 2BDEA 4LJ4A 1AKWA 1KRHA 4PPFA 1HLDA 2KM1A 2I76A 4M54A 3LXRA 3WIOA 4KQFA 1LSUA 2H9AA 5JO0A 3EEFA 2H7CA 4EYOA 2YXLA 4D80A 1RZ3A 3RHZA 2GAIA 2ORYA 2UZ4A 1L7BA 2FR0A 4DCOA 2G8NA 8ATCA 3KOOA 5SYAA 1KH2A 4HP8A 2HN9A 2QYOA 1L5VA 2WUWE 4IXWA 1YS7A 3DKVA 4TL8A 3C3AA 3PR2B 4QXPA 1EG7A 4GPZA 1AGPA 3S5JA 1QDLB 3WVNA 4B85A 5BRJA 1YRHA 2DOKA 2IEAA 2QIPA 1QQ7A 5BNIA 1X19A 2PX3A 2ZK7A 3MCUA 3CUEF 3Q5GA 2JLSA 1BH6A 5I7OA 2UXCB 4C14A 1PJAA 3BTVA 1PR6A 1WD5A 3DEKA 4A6DA 1Y63A 4BEBA 3JVIA 4RLSA 1W4BA 3LAWA 5AVOA 5GONF 4FYKA 2IV2X 3U3DA 1A88A 4EA9A 1H65A 1H3NA 3NUGA 2WE8A 4ALKA 3FDXA 1AB5A 3V4PB 3AVYA 3Q0IA 4ZU3A 2Z4RA 2J4DA 1S2OA 2FU5C 1Y0BA 3W2IA 4FM9A 4ZT7A 2OXFA 5FL3A 4EGAA 2QTFA 2Y0PA 2IPNA 2PJDA 2R79A 4ICIA 4OXRA 3GLIB 5LC1A 1CNFA 2FR1A 4BJ1A 3KQMA 1U3FA 2R8BA 2PX8A 3H0CA 3C6QA 3MILA 4FDTA 4JUAA 2FYTA 1GFWA 2JLBA 5DTMA 3I92A 3Q7PA 5KQMA 1GGKA 4YI5A 1WPQA 2OM2A 1G59A 2EP7A 4NU8X 3R5XA 2H16A 3H5TA 4R3WA 4JZKA 3U4QB 4HD8A 4NKRA 1F60A 3W5HA 3OFKA 5KOHB 2NTVA 2W4QA 5DK6A 5DZSA 3SYTA 2YCLA 2OEPA 4XJXA 3SZUA 4C22A 2D6FA 3O8OA 6CHYA 2II6A 2Z8YA 1Q7BA 1N2HA 4RS4A 4UVHA 4M0PA 4L8FA 4R8KA 5A4MS 2YN0A 4BFWA 4P81A 5LR6A 4PHTA 3K0BA 2ORWA 5A9SB 1B00A 1SIUA 4P8RA 1I51A 1MT0A 3ZGLA 3GGJA 4NXMB 3BBLA 3VO9A 4D3YA 2BGGA 4N03A 3VOAA 5BSFA 1KI8A 2V0GA 2WUFA 4I50A 3CNHA 4Y1RB 3SQXA 1P1JA 2HWXA 4UPDA 1U7UA 5AQEA 1YK1A 5E9QA 3RFUA 3AJEA 4CMBA 2R7KA 2V6BA 3P20A 3SPXA 1GZ4A 4IHJA 4XVQA 4C01A 5ITVA 2XJ4A 5DBHX 4DRXB 4K9SA 1K0UA 3NQ41 4G0UA 3WYBA 2A9RA 2Q4EA 4QOSA 3LY8A 2BM8A 1Z0ZA 3HWWA 1HDIA 4MS1B 2RK4A 3HVUA 1BKDR 4M0MA 4REMA 5EZ5A 1J90A 5DE3A 1KEPA 4MB2A 4DWVA 1XJ5A 1MLDA 5FV4A 1SOUA 3PNVA 2ZYRA 4Q5IA 2D8MA 3IEXA 4B43A 3Q0TA 5KDLA 1Y8QA 3R9KA 1ZUIA 1JRLA 7REQB 2Y77A 5THXA 5BN4A 4OJTA 1P3Y1 4V0SA 3H1GA 3UWSA 4E1BA 3OJXA 1UQUA 2GHRA 3F5MA 3MSXA 1ESCA 4WNIA 2OO5A 3WL3A 1QHSA 5BYJA 2C0QA 2BGMA 4PW0A 4NHEA 2H52A 1RM4A 1UAAA 5BW4A 2XBMA 3OHPA 1R5OA 3U4DA 4AP6A 4D99A 2B7CA 1BMDA 1XZGA 2J4CA 4K9KA 2IQIA 3DHEA 1YKFA 1LV7A 2KE5A 3K94A 3MK31 2P0YA 1O95A 4KTTE 1DBRA 1UJBA 4BGEA 3NTRA 1OLUB 3ESCA 5KPDA 3LH5A 2WTMA 2Y1GA 3QKWA 1N2ZA 1YT5A 4FFNA 2JIPA 4YGXB 1OYWA 4TQ9A 4ZGWA 1H2YA 3B1FA 1IZ8A 5IM5A 2PD6A 2Z57A 1IPFA 1CJBA 3H9GA 1CDOA 2R8ZA 1UBSB 1OJLA 4OAOA 4W6QA 4K6HA 1JR3A 1T3HA 1TD9A 3K8ZA 2R6AA 4GI1A 3WV5A 3FBTA 2CZCA 1OW3B 2QE7A 1WZNA 3B1VA 1WUYA 3WJ2A 4QXOA 5E6UB 1CNEA 2PS9A 3SSMA 4FFMA 4CYMA 3ROZA 2QTRA 3EZ2A 3E8SA 1NLUA 1GG9A 1W93A 1T25A 1Y1TA 2VOEA 3KJIA 5TV2A 3TBHA 3GT7A 3UT6A 3WLLA 3S4YA 2ZVJA 3O0TA 4JGGA 3FLAA 4IDFA 2IYFA 2R5NA 4TSRA 3OOWA 3AETA 1QQTA 3M6LA 1N33B 5I9MA 2I1QA 3SC2B 3PHGA 2CKMA 3MELA 2HU7A 4HAVA 2Z09A 2WAMA 3IH5A 3VMFA 3ZKAA 2VPQA 1AX9A 4BO1A 2IHBA 3IAHA 2PUDA 5CA1A 3W4IA 2HQRA 1P7ZA 2Q2QA 4DYHA 4O0MA 3FCEA 4L5AA 3IO5A 3PNSA 4X1KA 3SIXA 2ZTMA 3FOZA 1VLQA 5HBRA 5E6SA 3FCUB 4E5SA 1GTG1 5J2TA 3CYFA 5ALQA 2YJGA 3KVVA 3BDAA 4R81A 2ASVA 2Q6TA 1ZGCA 4N6NA 4UNPA 2IS6A 3BF7A 2I78A 3ND9A 4G26A 3OM1A 1Q6YA 2QTVA 4TS1A 1O95C 1JFTA 2PVSA 4BVEA 1SVOA 1RTTA 4KZKA 1K5DA 1NVFA 1E2UA 1O8CA 2P9EA 5C5EA 1LFDB 2CVHA 4FR2A 4QTUB 1PFQA 5E1MA 4BNYA 1RR6A 1ZJJA 2H4ZA 1YDEA 4G1UC 4IDEA 4O4HB 4BC0A 1FFXB 1GPDG 3KQUA 3VH1A 4DCCA 5TPZA 1DAKA 1FP6A 1EFTA 3EA5A 4WD3A 4BVAA 2QD5A 1ZICA 2X8JB 3QNMA 4L4UA 4B8ZA 1CJTC 4AULA 3WAJA 4NEGA 2Y1CA 2WU4A 1ZHOA 4ZEOA 1VL2A 1C3OB 1X80B 3CLVA 4EEKA 1JBKA 1B42A 2BHRA 1NPTO 4LWZA 5EHNA 3TJRA 4EELA 5HRUA 2ZYUX 2QXYA 1OJ7A 1RAFA 4MQEA 3UK7A 2A9QA 1ACMA 1W49A 3KFXA 1U9JA 2GLUA 4MR7B 1Y1RA 2DR3A 3WLHA 4D9KA 1OB5A 1A0OA 1YRBA 2RG7A 3EBLA 2EBUA 3Q5EA 4BFXA 1EDOA 1S3SA 2FNAA 4BLOA 1DBVO 1GKUB 2CD7A 2X7JA 3L6BA 4HLDA 2JA2A 1W47A 4K6MA 3OX4A 2Z2ZA 2QX6A 4MULA 4B84A 5BN5A 2O8EB 2HH9A 1MW9X 1YL6A 2C8VA 4N39A 1ZCZA 3QMMA 2QENA 1SGWA 3P32A 2EKZA 4WGFA 2K5UA 2FP3A 4J0HA 3LU1A 4KAJA 3QELB 4LQ4A 5K0TA 1J2EA 1I7PA 1TAGA 1V7QA 1XQWA 3IAFA 4YNBA 2FPIA 2PA0A 3N28A 1EDZA 1A1SA 1PUIA 3ANSA 4NMMA 4OKNA 2FEMA 1ETUA 4GUDA 4HT3B 3OSZA 2SHKA 1G17A 1QVAA 3CISA 4HS4A 5TJHA 4F3TA 1YB1A 2WJ4A 2QMYA 3ILHA 5TF4A 2C7QA 3WB1A 2GSDA 1E62A 1FXWA 2ZUTA 1WDTA 1K3UB 3LRTA 3MWGA 2XRMA 3W4JA 3UGJA 2BEVA 2X8AA 4BDTA 4PVCA 2CLLB 3F6PA 2BFMA 3FDJA 4JDPA 1WQ3A 4RD4A 4RIHA 4NCAA 4B6FA 1I80A 2KSQA 4IIVA 2DHEA 1JZQA 1XNJA 2A30A 4MUFA 4G8CA 4EI2A 3BXXA 4JBYA 4V0NA 3CX4A 4DWJA 4QM6A 2DT8A 4DWWA 4EATA 2WYOA 4GPD1 3MRXA 3OUUA 4G36A 2QTVB 1T4CA 2EERA 1QAMA 3ZGVA 5JSKA 3VHRA 1BAPA 1QVRA 4R8VA 2O8BB 2H5JA 1B73A 1I7SB 2P2YA 4M4SA 3IAXA 3QVWA 1BD4A 4HFMA 1NBME 2HKIA 4RWZA 3WL8A 3G2KA 3ZI0A 2EGUA 3CVUA 5BOVA 3TLZA 5E2AA 4ZVNA 4O5OA 5LYJA 3RS4A 1GKIA 3ACDA 1Z6AA 3T1QA 2HNKA 4WTOA 4NH4A 1MPTA 1V3UA 4RIIA 4MWBA 1IL0A 1QRAA 3UOWA 4KSBA 3WGLA 2HK8A 4WJLA 3DVSX 1R4MB 4HWPA 3DFIA 1L5LA 4IG4A 1CUEA 3NUZA 1TF2A 4E2WA 5IN4A 1QX3A 1TDJA 3WGGA 5J2UF 2I99A 1UAYA 2P3LA 4JS0A 4LXHA 4GKAA 3H87A 4ZREA 2EX4A 1UEXC 3EIOA 2G5TA 3UYLA 1D2GA 2IVFA 4DQVA 5FJJA 1L1QA 4C0WA 4ZHSA 5KKAA 4ENRA 1F12A 1THTA 5EN4A 1ZXXA 4LZJA 4DKJA 2PZKA 4LF9B 4H7FA 5CB4A 1WZ2A 1ML3A 1QGAA 1U04A 1V1MB 1YULA 2C1EA 1VIMA 3LPNA 5FI3A 3PITA 4B7AA 4LF8B 1AHNA 5DM4A 2ZIGA 4D3FA 2CLFB 2GXQA 1FFYA 4F04A 1I2ZA 3KB1A 1V3TA 3NNNA 3UTDA 1EP2B 3V97A 4IUYA 3UPTA 3MOGA 5IFLA 4LFAB 3W04A 1XEAA 3BIJA 4A2CA 5HWSA 1HEYA 1GPUA 3ZX4A 4CQMB 3DZIA 5CW1A 3BH0A 4YRBA 3KTDA 3HXOA 1XFAA 4HRYA 1A9XA 4L4ZA 2AJBA 4E5DA 3QKUA 2N75A 1FEZA 2QM7A 2Q5QA 1BZYA 2G0AA 3OFSA 3LQ2A 4AZTA 3W34A 4POOA 2VPIA 3AUJB 3EIEA 1RQ7A 3K1AB 2AEMA 1FFWA 1M5UA 1Z08A 3DEAA 2ZYGA 3OFVA 1DTWA 1W25A 4YUYA 1IOZA 4FFRA 4LMBA 2P9CA 2XT6A 1FSPA 2VZ0A 2X42A 1KK0A 4WX2B 5EKUA 3O1HB 5HQJA 4I9UA 4C87A 5DM60 2B8WA 3I32A 3IHTA 3ITNA 3CRZA 1O5TA 5FFMA 4FZ5A 1P31A 4NBUA 5HDQA 2V7UA 1BROA 2V96A 3JQAA 5TPWA 5HOEA 3N8HA 1T4CB 4H4EA 3TJMA 3LYAA 3ZY6A 3MS2A 4W5OA 4W7IA 5IEJA 1I4TD 3QMPA 1RZVA 1H2AS 1JPNA 2EATA 2Q07A 3B89A 4OAPA 1AK1A 4OPMA 4LGYA 1S2MA 2I8LA 3JPYA 4PHGA 5ALKA 3ZVKA 4UCQA 4LNHA 5CT5A 4X7PA 5BMVF 3FTFA 4PGMA 4HNUA 2I8AA 3RAJA 3GEIA 3GQBA 3IALA 4YECA 3IEKA 4ZZ1A 3ZS9A 2JLVA 2B3DA 5A71A 3MRTA 3H65A 3WK5A 5I7FA 1YUNA 1I3NA 1SA0B 2H6EA 5TSDA 2VG8A 1T8UA 2WA2A 3QLVA 4UMEA 4V0OA 3FNRA 4HCJA 5EGNA 5HVNA 1LPOA 1MQ8B 2RCYA 1TZCA 1UK8A 3OFNA 1EWKA 4MI1A 3WDSA 3ZG6A 1P75A 2VNSA 3CZPA 5KWSA 4O1MA 5MFPA 1F6BA 5AP9A 4HFJA 5IH3A 1DLJA 4EG0A 2QAJA 4IJMA 3TOZA 3CX6A 3Q1LA 1QOPB 3JYOA 4QHYA 3YASA 1FVXA 1NTRA 4BGVA 1ZA1A 3MB8A 1U3TA 4PGFA 4WCFA 3FLBA 2ARKA 2ZCUA 2I9PA 3AJAA 2IVZA 4RLHA 2WM2A 3WL6A 4B81A 1Z0DA 2QLNA 3AXSA 3L6RA 4LVOA 3CZCA 5B1SA 4L2IA 2IV7A 3U4QA 3MWYW 4HYYA 4QDJA 1AXRA 3F67A 4BFUA 3BAFA 2QUAA 1E3JA 2E2WA 2Z3WA 2NU9B 3NVMB 1GITA 3PWZA 4LZZA 1HEIA 3W2FA 1K89A 1KI6A 1Z2AA 3ME5A 2BLNA 3WGQA 1VBKA 2OY0A 5CDSA 5J3JA 5K8UA 3E2IA 2WAXA 2AZXA 3I2KA 4P92A 4R3UC 4LNUB 3IIMA 3RKSA 3EQ7A 3Q3HA 1QVWA 5TMPA 2PZJA 3F6BX 1YK0A 2TMGA 3HXLA 1Z62A 1G2IA 3KQQA 3IT0A 3LD9A 3BFKA 4UCXA 5E8JA 1LLDA 1VYUA 4A8JB 4BEWA 4AVYA 2GYYA 3QK7A 2D3TA 2XBLA 1F38A 5T64A 1PYGA 3K1YA 3LWDA 4ZOBA 3G1TA 3DO8A 2IU3A 5JS7A 3GAFA 4ZYYA 2YV5A 2V5VA 1DRVA 4OYRA 4X6LA 4FDLA 2MSEB 3SWWA 2EZ9A 1HI9A 2XZPA 3FLMA 4NC9A 5BQOA 3ZDYB 4CQJA 2PJRA 5F3WB 3JVUA 5GY7A 2F8SA 3D7MA 4UOEA 5D5HA 4D7AA 1C1XB 2CEKA 3L18A 4GBJA 4JSRA 2AT1A 4JCCA 4LBVA 3GDGA 1PS9A 3PXDA 1I7NA 4UJ5A 1JT2A 5EJEA 2JH9A 3LIIA 1JDTA 2I66A 3T7IA 4FS3A 1G7CA 3T7RA 4ESHA 1VE7A 2PCLA 2AFHE 3WWPA 3DHVA 1FDVA 2CB0A 4FDVA 2V7VA 3VSEA 1E9FA 2IPOA 2ET6A 2FWPA 4R5MA 3TQQA 3ZDBA 4ZMRA 2HPHA 2V7PA 3T3GA 1F2UB 2I7XA 3NAMA 3GLSA 1B0UA 3EXG2 3JZIA 2DPHA 2W0MA 4DLUA 1E9EA 1K4YA 2WJJA 3FMVA 4OMFG 3V6MA 3V7FA 5I7VA 1T0IA 1L8XA 2DFLA 3IUEA 1NSYA 2DFNA 5DXAA 5EIWA 3DE4X 4EM6A 1F9AA 1MEOA 1U3DA 2IZZA 2XIJA 3REQA 2G5PA 3U9LA 4KYIB 1PAUA 5E6UA 3DBHA 4DMCA 4ZGGA 4JJAA 5M3BA 4XJVA 2XYVA 5CEEA 3QLVC 4MLPA 1FFBA 4NCBA 1AKYA 1O4WA 2R6HA 4MRAA 5B6PA 2ZP1A 4B3GA 4BB9A 1EE9A 1P0MA 1VHQA 4E31A 2YJTD 2XUHA 3Q15C 4KU4A 1Q0QA 4X6UA 3ZS8A 2HU8A 3I2JA 3B1JA 4G1VA 1C7EA 4PRZA 1HRKA 3EOBI 2DWOA 1U8EA 2RHMA 1GTMA 3H75A 4O8CA 4AZSA 3ST7A 1VI6A 2MU1A 3UJPA 4ZZIA 3QWFA 2MSNA 3P0FA 3QEMA 4H6XA 3TNFA 3WHKA 1UDBA 4YCSA 3CX3A 1PZMA 3EGCA 5JAHA 1WWKA 1IYZA 1WUHS 2FK7A 4MV0A 2Q5HA 1HOTA 3K0CC 3O7MA 1UZNA 3A6ZA 3H5VA 4NULA 1I4OA 5K4HA 1W5EA 4M0LA 1XVAA 1ADJA 3NGXA 3L7AA 5FF9A 2JJYA 2NQ8A 3IBTA 3U56A 3QYFA 5DVZA 5CPBA 2Q3BA 4XDGA 7REQA 5U9CA 1Z25A 2MDTA 1H9CA 2MYNA 2WWFA 1CZNA 3Q4GA 4L5YA 2R0QC 1Z7EA 1MDFA 2Y1EA 2OQIA 1M6NA 2PZGA 1S2GA 2XCUA 3AUUA 4CMCA 1L5KA 1U0JA 1NZFA 4JYMA 2PHZA 5TGTA 1WA5A 4UE6A 3G8AA 3KSMA 4PSKA 4KJZA 3R3JA 2Q7XA 3F98A 1JDBC 3MGAA 4QNRA 1VE1A 4TWAA 3IEIA 3T3PB 3W1VA 1NWHA 1VP3A 4YDSA 1ODSA 3RJTA 3V7YA 2YHUA 3RUFA 3SMVA 1NDHA 4RMGA 4YMVA 1UWVA 1XZLA 4GMDA 5AW8A 4QBHA 1ISMA 4BNLA 2E55A 4WLFA 5B1IA 2DWUA 4BNZA 3WK4A 1W581 3GLIE 1FFSA 4AX4A 5LWHA 2WWHA 2Q0HA 2HO5A 1AH2A 2XXBA 3U3ZA 5DI3A 1R66A 3PSAA 5MGBA 3L0YA 3HSYA 4RANA 4FYHA 2C94A 4B7XA 1A9ZA 2PE5A 4P0QB 2RG1A 3E53A 2CDRA 2IXGA 1SN7A 4DA7A 3QVXA 2FK8A 1U80A 2OZEA 4EVSA 1Q1NA 4MQLA 5ER9A 4AD8A 5JBQA 2B37A 4UM9D 2ZYAA 1L4BA 2C98A 3KB2A 5J1TB 5NLLA 1FP4B 2O7RA 3OPNA 4FEYA 1U5CA 4QDZA 3EPKA 1RPAA 1GNQA 1I2MA 1WY5A 2H0QA 2Z1NA 2Q3EA 4RK0A 2PJUA 4CTKA 4QNMA 3QNWA 2H1LA 4GLJA 4FD3A 1I0IA 1ZEJA 4DILA 3W1WA 2B5WA 2CJWA 4G1FA 1Z0KA 4X63A 5FPSA 3O75A 4NPHA 3IBSA 3A31A 5IVKA 1QE5A 4UVGA 2O2DA 1NGSA 1GARA 1YR3A 1I7LA 1RFGE 2AR9A 2R8PA 1CUWA 4KQJA 2QVGA 1YS4A 4KXYA 1QKJA 4KBYA 3GA5A 3GHHA 3EULA 3OCXA 1FX0B 3HYNA 5JS6A 4NECA 5LZ2A 2C8KA 3H11B 1FUEA 2RAFA 2FN3A 3THYA 2B4TO 4YQZA 3WJ7A 1RHJA 3HY4A 1ND5A 3ASZA 3IP6A 3BFXA 1OH8A 5ED0A 3V7WA 3QUQA 3TSAA 3X1JA 1F6WA 1GGHA 4LDAA 5I6DA 1HNXB 2C88A 1K88A 5ELLA 1E94E 4IF4A 4IEFB 4D0GA 3S7TA 3M1IA 4I1RA 4YMGA 5KMGB 1P91A 1U3VA 2C0PA 2R7AA 1G7SA 1GNSA 4PC6A 2P3QA 2UZIR 3P9IA 4IAOA 3VO8A 4YBRA 5JMPA 2XRYA 5KYUA 4AK9A 1X70A 4WOBA 2DU8A 3DC7A 2G71A 2PN1A 3VOBA 1TEVA 3KT6A 3V4FA 1IFXA 2X4DA 3V33A 1Z9BA 2W48A 3NJRA 4IIJB 4A3SA 4X65B 1JYSA 4BTEA 2EXXA 3E2PA 3N2ZB 4Q1DA 1M1YB 5FWXB 1Z5PA 1OCEA 3WIEA 4X1YA 4ZICA 4PQEA 3GDOA 1M1ZA 5AM2A 4BLSA 2D0OB 4K6FA 4X6XA 2XCRB 2YHIA 3PEWA 3BEDA 4Q1FA 4B6RA 4HFNA 2RHTA 5IZCC 1QWOA 4GM4A 4UDNA 3FUTA 3LGXA 3L7OA 2JFQA 5B4UA 1GGNA 4OHVA 5FTWA 3K71B 2PKXA 3KOYA 5K09A 2KW5A 2WF6A 4MCAA 1X7YB 2XJ9A 4TKUA 3ZGYA 1XHEA 3N2GB 4HAYA 4OJKA 3H8VA 3GFFA 5E1OA 4IUDS 3OTHA 1Y89A 3KU4A 3MVEA 4HAIA 1VSTA 5CP8A 4W1PA 5DT2A 3SHOA 1UJ4A 5DM70 3RT9A 1I6MA 2YC4C 3GD7A 4X8LA 5TQJA 2PXHA 2X23A 5K4GA 3T1HB 2PWPA 1Z35A 3O8LA 5CT9A 4LJRA 4HN2A 2G08A 5G41A 1NDQA 1XTKA 2ON6A 4XVRA 3HO8A 4MGEA 3ZI7A 2A78A 1T2NA 2IWHA 4IDQA 1QH8B 2NO4A 1OB2A 4IFTA 4PLWA 3HJBA 2Q3MA 5L7YA 3PC2A 4EGSA 4AY6A 5BQPA 3IDAA 3OZXA 4DMMA 3GL9A 3I45A 2DQZA 4PC2A 1EUCB 1IBKB 4UHEA 1B74A 1Y6FA 1OFGA 1SOMA 3CR7A 4UTVA 2FXVA 3B5IA 4BN5A 2ZPTX 4R0MA 5GVSA 2ADOA 5JDCC 1HG0A 1Q19A 3EVTA 3EQ6A 4FQ8A 3B6EA 4MYTA 3T5TA 2DKFA 4TS9A 1VZ2A 3V42A 1OH6A 4UQPA 1GAQA 5HKOA 5DSTA 3JQAB 5TPWB 3DZKA 3HKCA 5C8YF 3CLKA 4S2EA 5SY4A 3RGGA 1TZMA 4N3GA 3USCS 2JD2A 1DC5A 1JHDA 2A4KA 2WFLA 4HQ0A 2BT4A 3MJVA 5LOVF 1IXKA 1PJZA 5JCOA 2J6BA 2VDNB 2AA3A 1QFYA 1XF1A 3DO5A 4GPEA 4TS4A 3WLEA 3CWCA 1HEUA 2EX0A 2CYBA 4QUKA 4RELA 5FI5A 1JXQA 2NUTB 1DAIA 1OI2A 5B7PA 5K3FB 1V41E 3IJEB 3B9BA 3ZK9A 3BWDD 2RIRA 4BFTA 4ER5A 4M3NA 2VP9A 4G5QA 1L4KA 3ZK7A 4J07A 2WF8A 5C3MA 4JIMA 1YQUA 2IH2A 2P2LA 3BE6A 3FCSB 3DTVB 4OL9A 5T3YA 3MJDA 3AVUA 2CVOA 1QH0A 3QVVA 4AW9A 5I4IA 4BASA 4Q02A 3U48A 1PJBA 4M86A 4PG5A 4RV4A 1N1GA 2J3MA 3C3JA 3N0WA 4H1HA 1KDZA 2ZSUA 3I37X 3M9LA 4L95C 5KKCA 3QPUA 2D0IA 4QGBA 5HK9A 2QRPA 3OEWA 1V7CA 3L7IA 4D0SA 3L7JA 2VDJA 4FXPA 1REQB 1SURA 1VGRA 1KZ6A 3TOVA 2F7SA 3ZQ6A 1N4DA 2HGSA 2FSGA 2ZBQA 3BJRA 4Q4CA 4HB2A 4U8HA 1J23A 3F74A 3PF8A 2W2KB 1UBCA 2X7XA 2A0KA 4AZWA 3OC6A 4RV5A 5ESWA 3D4PA 4WN9B 4ERXA 5CA0B 1KPHA 2GAAA 2Q21A 2OSVA 3ZY2A 4TVSA 5CM9C 4M7RA 2J48A 1PGNA 4KB5A 4KLNA 1XNRB 3ABRB 4LTMA 3VYUB 4M1OA 3QU7A 1M83A 4DJDC 3TZEA 3RU9A 3WICA 3DUWA 4K0RA 2VUTA 5JXHA 1I7QB 3PGXA 1JHUA 2PIAA 4EVQA 1YR7A 3NBZC 2O5CA 2R4QA 2PWYA 3WWOA 4B3SB 1V16A 1NXSA 1T29A 4GF5A 2O8EA 1H5UA 2IOFK 1PSWA 4TTTS 4LGMA 2AXPA 3RS7A 1QJ4A 3V6LA 1X1TA 3WLIA 1ZN8A 4A0SA 4C4OA 5DGHA 3RW9A 1LBHA 4YT4A 3N75A 4JLSA 3WYFA 2PH7A 1K1EA 4AG3A 1V7ZA 3G17A 4L27A 4R2HA 2P68A 3H3XA 2KWIA 2WSYB 2H1IA 4JHLA 2ZT6A 5G1PA 5K8TA 1RRCA 2C4UA 4RD0A 5I4KA 1BDJA 2WMOB 4QC2A 2VYQA 3PE4A 1L7DA 3QLEA 4PZYA 4X1YB 3TI7A 4YRSA 5K7SA 5KDOA 1T9DA 2PWAA 4PHCA 1IJKA 2ZSDA 4BVBA 3AX6A 1B8UA 4AT1A 1DDIA 5K0FA 2QRHA 2IDZA 5EFZA 2D1YA 1AF4A 1ZM3A 4JNCA 1YZTA 4QJIA 1QAQA 1XZCA 2CFOA 3IVGA 4I55A 4EUHA 4NBSA 1QV9A 4MAMA 2HQBA 2GT1A 1PFGA 2ORVA 1JIKA 3IAM6 4IUCS 2PPVA 1IN5A 5FTJA 3L2OB 2EFJA 5JW6A 3LVBA 1ZKMA 5JNLA 4TVOA 3W9SA 4UTPA 1TM2A 4ZDWA 4LUCA 1IB6A 3SQDA 2OFOA 5EQFA 3K6JA 3GRKA 1SFRA 1ZCJA 5CUQA 4F06A 2GJ4A 1N3LA 3DJYA 2EF1A 3CSSA 2YXPX 3B1KA 2IL1A 4GAEA 3TTYA 3VC1A 4OA8A 1Y3FE 1ZH0A 3ETGA 4IIFA 5GPBA 2Z6VA 1OGYA 2QJFA 2WDZA 1ZOOA 4L8LA 2YYSA 3A1FA 6REQA 3QW2A 2R65A 4DMHA 1BCRB 4Q1CA 2JD1A 3TKAA 3A2KA 1SB8A 1RTKA 3H9EO 4Z54A 3R0XA 4GHWA 4PX5A 2JCSA 4BQQA 4CEJA 4M38A 3WNZA 2BI8A 1GQOA 1LPSA 2G1UA 3TD6A 2GCEA 1KI4A 1ONSA 1MRSA 1PS8A 1A4UA 1QV7A 2QRZA 3H83A 4MGHA 2J9GA 3R5FA 5PGMA 2X86A 4B44A 2OBYA 3U19A 3VNVA 3ROFA 3PRJA 3SBDA 1SCUA 3AR4A 4ZC8A 1M3SA 4NS1A 3AOGA 3LUHA 1XEXA 5ARCA 3M1YA 4DUGA 1HFWA 1U5BB 4H7DA 1TU3A 1HXHA 4ZT4A 2J3JA 4KN9S 5GGXA 3VX3A 3GCDA 4TYNA 3ERCA 3PGVA 1UQTA 3MMXA 3JQCA 1WUTA 2ZI4A 1A4RA 2AI3A 3CKKA 3KKOA 4RGBA 4E5MA 3ML1A 5D8DA 3KQKA 4KQHA 5CVUA 4MCIA 3TLKA 2L42A 3CLUC 2NNWB 1QCYA 2JGDB 1QIEA 2HI0A 5JD4A 4B76A 3I6ZA 5E6SB 1NBMA 3V32A 2VEOA 3AEQA 2NO5A 4E5PA 2IYPA 4NQZA 3QG1A 1O1YA 1BVRA 4LSMA 4XM1A 2B78A 4CKCA 1B2LA 2V74B 1SC1A 1AKRA 4IOJA 4MYUA 4EGJA 3TNJA 1X74A 3FYUB 2CFIA 4XQ9A 4DUZB 4QOIA 5ELXA 1HM5A 3CT4A 1DHRA 3W3ZB 2K2WA 3ZDDA 1BGXT 1AMOA 1E9RA 1QFXA 2HHAA 3KQTA 3G49A 3PFGA 1CJUC 3PX2A 1C41A 1T8SA 3ZJ4A 2VTBA 1PS0A 1O57A 1BWSA 2FP4B 1UWLA 1RYEA 3COVA 3OZDA 4UU7A 3LLMA 4HMOA 2X1HA 3FPLA 5FBHA 1C0PA 4NFHA 1PYOA 2Q0SA 2R6JA 1V45E 1GCAA 4IGEA 3QSYA 2A1UA 1SBTA 3E5HA 2D13A 3ID6C 2XSZD 3KSRA 4D9BA 3CA8A 1ORRA 3DDZX 3II6X 3OT5A 2PX5A 4KC0A 2AK3A 2XECA 4JJ4A 4WZAE 1CUZA 1A82A 3K53A 3O8QA 2A9JA 1A9OA 3PGLA 4TZKA 1ZK1A 4KIFA 4INOA 4CCSA 4F86A 1K0FA 4G85A 1O96A 2H5EA 2O0JA 1M2WA 2BMJA 4N8DA 3KJNA 4E94A 3QVTA 2D2FA 2X40A 4GVXA 2IHTA 5EVCA 3JQFA 3TLCA 4CTNA 3KJGA 3G5UA 1QQAA 2HNAA 4Y1RA 3BRSA 4YRZA 4BNDA 2VC2B 3HBFA 4ZHQB 2JIBA 4HGRA 3AF6A 3AU8A 1JKXA 4AO8A 1EM8A 1O6ZA 1YI1A 2ZUVA 4ZT6A 4JFRA 1SBIA 2B25A 3HCEA 2IYWA 5SZKB 3AHDA 1JSZA 2JRCA 1J06A 1JIQA 1JSXA 4LK3A 5JS2A 5CDUA 3BGIA 3UHJA 3H05A 1PR4A 1QHFA 4ZTBA 4ZT2A 1P2UA 3IPCA 3WGYA 3U1BA 4TKUB 1T6YA 1XTTA 1A9YA 4QARA 2PS0A 3CX8A 1NQTA 2AN1A 1KMQA 1BS1A 1ZYUA 4HQLA 5JJIA 1QZZA 3TUZC 2HSEA 4M8IA 3WOHA 1SO8A 4WASA 4H59A 5ANRB 1V8ZA 4HEHA 4TT3A 2L0XA 5B6JA 1ZN2A 2KLBA 3RK0A 1E7WA 1W5FA 1WCIB 3KXDA 3MTBA 3VZQA 4DFDA 3H2GA 4YMHA 1KVUA 1P1HA 3SICE 2IYOA 2QEQA 3KR2A 3TIIA 2XW6A 2PIDA 1E1QA 5LLTA 4XVUA 2XV1A 4I4IA 2XT0A 2JBWA 5IH7A 3AWDA 4I5IA 4JLKA 1DRKA 1FJHA 4L3VA 4URWR 1ZZGA 3OUTA 4OK6A 1R5JA 3K70D 2GI4A 2AX3A 4P7GA 5DW3A 2XAUA 3MF4A 3AYXB 3GLKA 1M1YA 3NHUA 4PPYA 2OCGA 2QD3A 3F7MA 4Q3BA 3BMNB 4QG7A 1MJ5A 5B1DA 3ZU4A 4D5GA 4JBLA 4Y7DA 1HNNA 4TLEA 4TWBA 5AJZA 1S6YA 4DDVA 1ZDMA 4US2R 1QCDA 1VGVA 3D6HA 3OF5A 4LY6A 4MB6A 2G17A 3VH2A 3ZE7A 5CG1A 4OXQA 5E7JA 3EG9B 1LPBB 1WW8A 4MSUA 4N6GA 2C03A 1YVUA 3L4BA 3ANTA 4IP0A 3T4UA 3ZU3A 3QWIA 4JL8A 5CB4F 3CJQA 3AGQA 2RC5A 4BFLA 4E51A 1GCUA 1KI3A 2PBZA 3KKZA 1CHNA 1JALA 1DAGA 3RU7A 1T9ZA 1T9GS 5E2BA 1JFLA 2PGJA 3DEHA 4X90A 5KYYA 3H17A 2AN5A 2FOXA 2H3HA 3HB1A 3O03A 4HL6A 3U40A 3JTEA 3U81A 4DT1B 3U5ZB 1UJMA 4LOAA 3ISVA 4R2LA 4WFKA 3R3ZA 1XB2A 4MO9A 2IP2A 3L9XA 4FJ0A 4LNAA 4PN7A 1FBNA 5B1YA 4CZ2A 1CKEA 1Z5GA 4LTNA 3PD0A 4XUEA 1Q74A 2QTWB 4YP7A 5CT8A 4AO7A 2DBZA 2NT4A 2VJBA 3MOIA 1P4RA 3B3GA 4Q3EA 5LP6C 3RIEA 3NT4A 1J2UA 1RWNA 4I5FA 2QQ5A 3IOYA 1YD7A 1P0IA 1V25A 4ER0A 4BZZA 4X84A 1O9BA 4EMBA 1ZBQA 4BNTA 5IJZA 2MJLA 4Q39A 5TE9A 3I09A 3W2GA 3U37A 4R1TA 4E2XA 2CE7A 1Z34A 2CK3A 1XR3A 3GJ0A 5JYCA 4NBTA 3QP9A 5G1OA 4E5NA 1Z36A 5A3JA 4C5BA 1JKIA 1RYBA 2J5QA 1U4OA 5B4TA 3FG9A 3T9FA 3ZLTA 2I4LA 3JAWB 4H3KB 2JGFA 3HWX1 4I9GA 1MAHA 4IYRA 1SVIA 4X64B 1MB0A 4QFMA 2IJGX 4DMRA 1HNZB 2WZQA 1GKKA 1BS9A 1XRJA 3CRW1 4IH1A 5B64A 3ZHTA 3EG9A 3VH4A 5AUNB 1U0HC 3EXEB 4YAEA 3KQVA 3INRA 1RQLA 2IYSA 3E22B 4TTAA 3R74A 3V2HA 1N5DA 4NMLA 4BCCA 1TAUA 3IOEA 4B3BA 1KJNA 2XXAA 1E99A 4FBLA 5FNVB 5T6MA 1E7SA 1SQ6A 2OO3A 1OMOA 3OTWA 4Y0VA 4C89A 5K3FA 1U2DA 3QBJA 4KWCA 2FZEA 1C1DA 2QRVB 4KK3A 3DEFA 1Y34E 2P5SA 1N8NA 3OKAA 5JE8A 4CU2A 5BQ3A 1U81A 1XZFA 5K8VA 4G07A 4DSAA 1RPNA 1E3EA 1IDOA 4AURA 4CF3A 1G1MA 3HN7A 3T9CA 3PRKE 1EWTA 4AAYA 2HEIA 1HOXA 4G1MB 5CW2A 5HJ2A 1G8YA 1G8MA 2LPMA 4IHKA 3CZAA 3EF3A 1V5FA 2V6FA 4O5AA 5IN5A 3Q9NA 5JD5A 3BQMB 3EXHB 2O05A 2PH5A 5KJEA 5TRTA 3VPGA 3DBIA 4V2IA 1WB5A 6AT1A 5E9JA 3LVQE 1LKZA 4CKBA 4ZOQI 2REXB 2XVXA 3BA6A 4ALIA 3O4HA 3NXSA 4J0GA 3JR3A 1Q11A 3DAYA 3GCGA 3HJUA 2OESA 4MQ6A 4CF6A 4NXNB 4YI3A 3CR8A 3VZRA 4RW0A 5LU9A 2A2ZA 3V8RA 2ZBDA 4H7HA 1YCHA 1GZ6A 3SZOA 2WSLA 4YJGB 4FX2A 2QTMA 1V1JA 1F8FA 1MJNA 1XYGA 2FFRA 4GQBA 2HCBA 1M5TA 4GLLA 4I8XA 1JJVA 3DE0X 3NTXA 2DVMA 4Y2TA 1Q91A 4YMUA 5B36A 1BEEA 1GPBA 1KZGB 2HXGA 3HE3A 1P2GA 4ZT5A 3G7NA 2CCGA 3I8XA 4C4PA 3IUPA 2OVBA 5JXJA 4PQYA 4OHMA 1RXSA 1UOQA 3A0UA 3CCCA 4RQUA 1E2MA 2HEGA 3MJHA 4AQYB 1T9GR 2W2TA 1OQAA 1PD0A 3BXPA 3OCZA 3G9ZA 4LHXA 1X2EA 2C5EA 3MWDA 3V8EA 2OFFA 4B5KA 2CCKA 1I6WA 1NT2A 3CNLA 3LRPA 3JV7A 4X92A 1W88A 5LQSA 5ALIA 3WMWA 4K86A 5AO9A 4YRAA 1CEYA 3EPJA 2J67A 3OUZA 2VT3A 3OZGA 3K1JA 1XTVA 4HSGA 4US1R 4LYJA 2VYND 5COAA 3DE5X 2RGAA 4N82A 1NYTA 4UHJA 3H5LA 3OMWA 3PC8C 1RWKA 3OOEA 1T3GA 4E2FA 1VBMA 5LB4A 5FUYA 1GT91 1VLVA 4JB0A 4D3SA 1ST3A 3KYJB 4ADSG 3F8WA 2J6HA 2P67A 2XCIA 2AEJA 1O5OA 1O6CA 1V71A 1Y7PA 2RD2A 4LXYA 2G40A 2C04A 4KHZA 4DR6B 3OOJA 4IXTA 3W5BA 5JDIC 2PG3A 1Z5NA 4X3PA 3EUWA 1Q7CA 4B3RB 3P52A 5TXGA 3IMEA 4TT3D 3ASUA 1PK9A 1GADO 4LV6A 2BKAA 2OXRA 1XMSA 3OESA 4DCGA 2GRAA 5L7WA 2AOUA 4MUJA 3DFFA 4AIIA 3AR3A 1C4WA 1P9NA 1NC1A 5BSVA 3S1SA 4WDRA 1UT6A 4YRFA 3VAAA 1ZY2A 1RWPA 1CY1A 3BMQA 3ZW7A 1XD2A 2IE8A 3DMTA 4KO8A 1U9IC 4CCAA 2DKOA 4IIBA 4TKLA 4AJPA 3SQLA 2GJSA 1SH7A 1YGPA 3IMGA 3IQGX 3N0TA 1JJIA 2AN9A 3EBPA 3N6VA 4M99A 4ENWA 3ONFA 4IDCA 4U7PB 3VYVA 4M1YA 1SAYA 3H99A 4KQCA 5GZ3A 1ZRMA 4DEXA 4LI0A 2RJ3A 1E2LA 2O14A 2W2QA 3ANMA 3H1FA 2Y4NA 3M4YA 3TAXA 5DN9A 1Y1SA 5EEGA 1UMDA 1P72A 1WAMA 1R6UA 3RUPA 1ZJZA 2VK4A 1JA9A 2QZ4A 5JH7B 4HN9A 3A4NA 2ZXEA 2AWOA 3A06A 4PCAA 3U4AA 4GRIA 5FRDA 3DT8A 5ECDA 4HH0A 2DHDA 4E88A 3IP1A 3SF8B 1HYGA 2Y27A 4OD0A 5EIBD 5C1PA 3EEYA 1L4EA 4G4IA 2FX5A 2YJ6A 3X44A 4D4HA 5AKJA 4WZ6A 2NQTA 4J76A 4PFKA 1QVVA 4QRIA 3ZZ1A 2GVZC 5HZKA 4HUQA 1KJ9A 4ZTUB 1YU6A 4HXYA 2AOTB 1GTSA 1B7GO 3B1XA 4PFSA 1T1SA 4RVSA 1SZPA 5A5FA 4FYPA 2XUQA 5IK2D 5KU7A 4GOND 2LBPA 3JWJA 1G0NA 3RQSA 1ZUD1 1EFKA 4EAAA 4CUKA 2XVYA 3PDHA 1I0ZA 5HGJA 3HB7A 4EGQA 2HA7A 2QBYB 4D3ZA 2RK6A 3DFZA 3IBGA 3OQBA 4YREA 3BWBA 1H22A 1QSGA 4GD3Q 5DNEA 5HUHA 3BAZA 3MQ4A 2BFBB 3RYFB 1OT3A 1HRDA 1YIOA 2V7EA 3AI2A 1B26A 5E3IA 2FAXA 1B1CA 1HQKA 1X9IA 1PVDA 1YH3A 2Z2YA 3PGJA 4IDOA 4WEQA 3CVYA 3NBAA 1JAXA 3H7AA 5TMEA 1EVZA 4LBZA 2BSXA 3ZDFA 3C98A 4UHBA 5FLXA 4CEIB 2H9IA 1ODIA 2ZUDA 3H7IA 3MT7A 4OYLA 1PTJC 1IEWA 1R4NB 5LP6A 2BI7A 1LSSA 4UBKA 1JEYA 3CS3A 1W29A 2WG0A 1LPAB 1PIWA 2FOLA 1P62B 1N92A 4M98A 4DV7B 4PM4A 3Q7IA 3ILXA 4CFYA 4DA8A 4ZCPA 1SHTX 2B1QA 5IDXA 3KDAA 1E5XA 2BHTA 4B7ZA 1Y9ZA 2WSSD 1M6WA 1ILWA 2WEKA 3ER6A 4GLBA 2BVNA 4L8GA 5FBRB 1DPFA 3JAKB 4C30A 3VR2D 5KQLA 4WK6A 3E4DA 3BEOA 4D0LB 4MHTA 2QP4A 4NONA 1BX0A 3DR5A 4R3NA 3RFXA 1FJXA 1GJRA 4MROA 3FJYA 3OSUA 3VNAA 4RKEA 4EHLA 4IVRA 4EP1A 3DXYA 5DNCA 5IPFA 3L04A 5MN6A 4GSYA 4S05A 5IS2A 4TXMA 1NI4A 1F14A 5GONA 1ZOPA 1Z29A 4MQMA 4JI2B 4E07A 2EZ4A 3BK2A 3ES9A 3U16A 2CBXA 3C3XA 1NLFA 1M33A 3P2KA 2OHHA 4R69A 4I9FA 5IVDA 3KKKA 3LPLA 3RLFA 3D3QA 5B53A 4RKYA 1H8EA 4IDDA 1RE1A 4C6TA 1HT1E 2ZGVA 3EXFB 4CU5A 4D56A 4X45A 1JKJB 1IH8A 2R9VA 3ZUGA 1L7RA 3H5AA 4ND8B 2BRUC 1T2EA 3MRSA 4TVKA 3GAZA 1VMKA 1PNVA 4PX2A 5IC5A 1VJ5A 3ZKWA 1E2KA 1ETHA 1MIOA 1XD8A 2IA5A 3O3OB 4CKEA 4ZMBA 3FMFA 1MO2A 2OCPA 4JLUA 5B6IA 3FYTA 3IMFA 3MGBA 1SUWA 3T7AA 2IFTA 5LUAA 4B3TB 4LYDA 1MIHA 4WOJA 3QI7A 3SBEA 4CTMA 1GGJA 1JHPA 3UM9A 3V1LA 1U02A 3KSDO 1SEVA 1H2XA 4OSOA 3RS0A 3KU1A 5LZ4A 2Q3HA 3P9KA 1WXHA 2XQKA 4FW9A 4ZAYA 3OAAD 3RPEA 3PTAA 2LZ0A 5DEOA 3MEQA 1SR8A 3RWBA 4TYQA 3ZD6A 2PZ8A 4ZV4A 1KXZA 1LJLA 3PQDA 2IEBA 2ZUCA 3L93A 2R8YA 2AXNA 4RV9A 3IP3A 1AZTA 3CKYA 1ICEA 2QROA 1NKTA 4AWXA 2DFDA 13PKA 3CG0A 1UMCA 3L8GA 4G1CA 2JGMA 3GVIA 1TLLA 4BATA 4CG2A 2N3ZA 2O8NA 1QGED 5ADVA 1RWVA 3A14A 3IXQA 5DCLA 2OCKA 2WZCA 1MNAA 3R1IA 3WQSB 3CUVA 2CDCA 5CXXA 2XNKA 3D6VA 4WGGA 5DHPA 4PICA 2FHSA 3HCOA 4J2TA 1X1EA 4BLRA 1ZW1A 4DB4A 3BSWA 1W30A 4EAQA 4JEMA 1Y6JA 1KFEB 4P7BA 4PG8A 2HZBA 1NJ8A 1PVVA 5TC4A 1UBUS 5DO9A 5JNTA 4FYMA 4BNXA 3VFDA 2JLXA 4NYIQ 1WXXA 4RKFA 1U2TA 2HW8A 4KDEA 3COSA 3GFBA 1YZYA 2WMDA 1Z0SA 2WK1A 4N7BA 4E30A 1A69A 3HLTA 1CUGA 1NF8A 3BGSA 1NOKA 3KWMA 3R6LA 1QGZA 1N5IA 5IBRA 1CRZA 2RONA 2WHPB 1GRQA 2HQOA 3OQHA 4UREA 4ZD6A 2H5IA 1X9GA 3R6WA 3ZW8A 1SKUA 5JCJD 2EFDB 1KO7A 5DYGA 2PMWB 2D2XA 5B3AA 4Z9AA 1L1RA 1HPLA 1E8NA 4LRSB 3VKVA 4CCYB 2WQ6A 1NUSA 3K7EA 3B2QA 1XHFA 1PDOA 1E79A 1P2BA 1YB2A 1PYDA 2F67A 2HUNA 1Z2OX 2NN3C 4L1KA 1C0EA 2GAOA 3B53X 2VDKB 4F21A 3AFNA 2FCRA 3HXTA 4AI6A 2C96A 3OQPA 1KEWA 1JWAB 3P9XA 3K70B 2QZ9A 1T2DA 3W5IA 5F23A 5J9FA 4QOHA 1Z88A 3D2LA 2QT0A 3DMNA 5F2KA 1VMIA 5BY2A 3T1OA 2GPNA 1INLA 1IY2A 1JU4A 2ASEA 1SNYA 2B61A 2VKTA 3CO0S 3LZDA 2VHVA 3QTLA 3D4BA 1ESEA 5GWXA 4NARA 4AKSA 1P1BA 2B2XA 3N8DA 4TYMA 1JDSA 4D3XA 4HDAA 1PG2A 3MFQA 3PL1A 3U39A 3CLTC 1B2RA 3QKRA 1DO0A 4DV3B 2GO7A 3JD0A 8LDHA 1UC9A 1KOGA 4QEZA 4HWKA 1P8JA 4NCIA 2WNIA 2WWXA 2Q0XA 3FR8A 1Q1GA 4DT1A 4O4HA 3N9IA 3ROEA 2YWBA 1ECPA 3KR9A 4MW7A 5G4LA 3F3SA 3RTCA 2O3JA 3AEKB 3FPEA 1S4QA 4ZO6A 3EIFA 3OJCA 4EPXA 1ZJ4A 4R2MA 3EA0A 5AM5A 1T3ZA 4KVGA 3VDRA 1CP2A 2GBGA 5EXXA 3OT1B 5HFAA 3M4ZA 4QL3A 2PD4A 2WIGA 1ZESA 3TD9A 1TQDA 1EIZA 3E5MA 3HUTA 3UQYS 4F9EA 1HDGO 5EUQB 3TNYA 1CUDA 5DMHA 4FCTA 2RK3A 5IHXA 2B0JA 4HAXA 2H54A 3ROPA 2W8ZA 2VR1A 3UFXA 4UUMA 4BX0A 3THWA 2CFCA 3W3AA 5K51A 3TCXB 3N53A 3IQZA 1GUYA 4K88A 1E6KA 2OLKA 5BW6B 2BGNA 3FKJA 4O0LA 2NO1A 5FULA 3ZJYA 3STYA 2JLWA 2FMIA 4M8SA 4JJGA 2F1RA 1ATZA 5DJ5A 3UK0A 1M34E 2NTEA 1OR8A 2CMDA 3DD1A 2BMVA 4ZAFA 1TW2A 2BM1A 2HSZA 1A2KC 4UC0A 5H4HA 4DV0B 4XVCA 1OV4A 2GK3A 2IBSA 1OX4B 2ZZNA 7MHTA 1EDDA 1MHPA 4H31A 1R16A 1F3OA 4MIKA 1EHCA 4DXDA 1KOLA 1K92A 5INTA 4I4CA 3FGOA 2J85A 1S4MA 5JADA 5DTJA 3I9LA 3CLTD 2CDAA 3PXAA 2JFVA 4MUKA 4CR7A 3VR6H 3A1TA 4J7UA 1N5JA 1WMEA 2VYFA 2EOAA 3LX4A 4H6PA 4TUYF 4ZQBA 3DOHA 5IJWA 3A3KA 1RJ9A 5ES4B 5BWLA 4DSUA 3B1WA 4BQFA 3DS8A 4EHDA 5DRYA 1OFUA 2BDUA 3GNLA 3WYEA 3OLVA 6YASA 2R1TA 3DULA 1OLXB 2F9LA 1Z38A 1EHIA 4NPAA 4TYPA 2DHCA 3IAS6 4WBXC 4WCVA 7MDHA 4XWOA 1BYIA 1IVNA 1I0LA 1S01A 1UC5B 2V9ZA 5FO1A 3ADCA 3RUCA 1L9XA 2BFFB 2O2ZA 2P4EA 4HUTA 2PH1A 1A2OA 1HWYA 4ATNA 2OMEA 3DMRA 4ALMA 1NR1A 3R3VA 2G04A 1GDDA 2I4NA 2CHQA 5IARA 4QBKA 4F5WA 1PW5A 1T1IA 4XFDA 1W5SA 1UR5A 3DE1X 3O3NB 4S1TA 1KEEB 5KTTA 5AJXA 5ENZA 1VHTA 2ZRKA 4YJ3F 4BNVA 5CVTA 4BN0A 5C53B 3OECA 2DETA 3H9JA 3DT6A 4G65A 4G5FA 1QIGA 2AX4A 1GCGA 4F4JA 4AY5A 4JYAB 3C6BA 1EBFA 2CT8A 1U0GA 2J3IA 2MSLA 3KPYA 4W8HA 5L45A 2FJPA 4K9PA 4RBNA 3U7IA 1KQGA 3IB3A 4AS1A 5JWOA 2OKGA 4FMPA 4MUGA 5F5NA 1SK9A 1OPRA 3NB0A 1TGYA 3T9DA 1W8DA 4GVLA 3RHSA 2O59A 1OX4A 1N3BA 2G7ZA 2ZRHA 3C16C 2HJWA 5KYXB 5FTKA 2IHZA 2M1ZA 3EGXA 3LUJA 4RTNA 1C4XA 2GPYA 1YS9A 3EC1A 2V0NA 3LF2A 3OH8A 1TEXA 5D3QA 4BB5A 4ENPA 1SC6A 2BZSA 3FM9A 3B12A 1T9HA 3B5EA 3ANYB 4GR5A 1GNLA 3HLKA 1GNTA 1QM5A 5LA6B 4CFZA 1YVDA 3SHFA 3U4MA 4P4UA 3A36A 4Y2YA 2CLOB 3T35A 3AEQB 5JAOA 2X14A 4LHSA 4HV4A 1IMJA 2YHBA 4HDOB 3ZV3A 3I53A 1VLJA 1UDAA 1M0WA 1OBOA 3BSSA 4OREX 4A03A 1T35A 1NW7A 3JWGA 4MWTA 3DXZA 2H51A 2BP7B 4LOJA 4MJ7A 4O4LB 4QFCA 4Q0MA 4UD2A 4X7BA 1QV6A 4ND5A 2R2AA 3MG9A 3OKPA 4C0XA 4H7EA 5GZ6A 1QHHA 3MGCA 2W5UA 4EB3A 2VSQA 5LKAA 3IJRA 4LF7B 3ZHOA 4AJ4A 5JCOC 2JEOA 3B2EA 2C1ZA 2DZDA 3GEBA 2F3PA 2MTBA 5FWNA 1ZC3A 2W9XA 4XAQA 2E7ZA 5GONB 2KLHA 4U9UA 1NQWA 1FRVA 3ECAA 1X42A 2VPYA 3BB4A 2JFYA 4Q3NA 4DDKA 5LQKA 2RGNC 2XPCA 1S2DA 3IAAA 2VRCA 1ENYA 4HK4A 5HTKA 4XUDA 1XU9A 3DCJA 3SJ7A 4DWOA 2Z6UA 2GETA 2YMMA 3O9VA 1NKVA 3GXOA 1A5SB 2NX2A 2VJAA 2K4MA 4FFPA 1OTXA 1QLJA 3GLHB 5CLHA 5HS4A 1DOAA 4P7KA 5KC8A 1QRSA 1G21A 1TA0A 2W8BB 5REQA 3QE0A 1Y7TA 1E63A 5EZ6B 4RUKA 1WSBA 5D6OA 4DPMA 3O8CA 4JJZA 1GZHB 5F35A 1ND6A 1XVLA 2VJPA 3O8NA 2EJCA 2G83A 2Z1DA 1XJCA 2NMVA 3UKOA 2AJCA 4DCUA 1JIJA 1EM6A 3M6UA 3RVOA 4D2IA 1VMDA 4X1IB 5KWVA 4IY1A 4E22A 4B7CA 2H4YA 4UCWA 1JFFA 4EG7A 3PQEA 1D6SA 1IVYA 4QVIA 5A4FS 5AXDA 2BEVB 2EQAA 2WIJA 3NYQA 3A70A 4J9VA 4L7QA 1W36D 3W5DA 1YVEI 3OIUA 3KTOA 1I24A 3RQIA 2DFPA 2JL1A 3DHWC 2F00A 4UZEA 4A26A 4ER3A 4YV2A 3PKIA 4S1WA 5JFTA 1GYQA 4GH5A 1AMNA 5IAEA 1H94A 3K2QA 4BN4A 2XUZA 2YWFA 3OE7D 4PX3A 5LXTB 2NP7A 1J0DA 5C1OA 1OOEA 1XK6A 2O8VA 1TVMA 2PUWA 2YH2A 4KOAA 4PLPA 5EE1A 3KJHA 3RM3A 1QU3A 4TKMA 3PR1A 1ZNQO 2XUPA 2FSVA 4LHEA 5CLIA 1E1QD 5IBCA 2IYZA 1W5AA 5ILQA 3ROKA 4BNKA 4JJ8A 4XM2A 3OZTA 3GB9A 2OV4A 1SUFA 4KUEA 3UO8B 1E0AA 5A5VA 4D1YA 3HR8A 4DPLA 2ZJ5A 3FFTA 5J4HA 4IIHA 4RX1A 3A26A 5KNCA 4PYRA 3W3AH 1H5QA 1PNTA 1TUGA 3L1HA 2Q5JA 3IERA 2OAQ1 2V0CA 2W6CX 2ZUFA 2WD7B 3JALB 2HRDA 2QLJA 2G9UA 3N5CA 4DXHA 5KPJA 4Z4QA 3FTNA 4ZOEA 4BX8A 4I50F 4B8YA 2JH3A 5ILGA 4CV3A 1PSDA 3B7PA 3E15A 3QQ5A 4ILKA 4OGGA 5L6MB 2FN7A 1EK0A 2RDMA 4DV5B 2JKZA 4MRMA 1K7EB 1JDZA 3CT6A 2GN8A 4HPWA 4ZPJA 5A7HA 1XDZA 3HS3A 5LM3A 4K9NA 4C7OA 1K7CA 1ZLXA 5CJ2A 4B40A 1QBKC 1NFQA 1US8A 1WW2A 3UA4A 2R97A 4B6GA 2O2HA 2OHGA 3I5XA 4XDHA 5ARDA 3AFOA 2G9VA 1JBQA 2AVDA 2XNDA 2H11A 3DEIA 3K0CA 4Q4JB 2QTHA 2VNIA 5C3UA 2M6LA 3BC1A 3UBMA 4XPIA 3PRHA 2D5LA 4BBPA 1NT4A 3TLEA 3KTAB 3H0KA 2CV2A 1RD4A 1GTRA 2ZDGA 5A03A 2BIFA 4RSRA 2ZTHA 4HXFB 1N2GA 3QKTA 4MVJD 4F2PA 1DAHA 3ZDEA 4A0GA 4BVKA 1E1CB 2ZAMA 4BP8A 4FFBA 3H1BA 5EJFA 3I62A 2B21A 3DG9A 1EAYA 1NY6A 3HBLA 1QNLA 3U31A 5TS3A 4KUHA 2F1KA 2CN1A 3GJ4A 2HDNB 4FU0A 4GC5A 2VJDA 2PRZA 2AF4C 3CUSA 4EDHA 2P4QA 1ZUHA 3CSUA 3DBVO 2H1CA 3AY6A 3MIIA 4KI0A 1SBQA 4JUIA 4PTLA 2BI4A 3X0DA 3RC7A 221PA 4L4YA 2BFCA 3O1IC 1PQYA 5JS1A 1B93A 3DR3A 1MQ9A 2QL9A 2XWSA 1KR2A 3VR4D 4BAUA 3WA7A 4ZYUA 4YJFA 1XTSA 1R4MA 3CFYA 2NSJA 3OLQA 4HEA1 4S0XA 2GPSA 4BQEA 2C7RA 3OZEA 3I4LA 3O92A 4WK0B 4NYJQ 1ZONA 3LCUA 3QVGB 1A8UA 4GU5A 2B35A 2RH8A 4KN6A 5A3RA 3T4XA 4D4MA 5ICGA 4F4IA 3TW4A 1WJGA 4PZUA 4GE3A 1NP7A 4N54A 1SCQA 3N0RA 2O0LA 4DRXA 1D8AA 2G82A 2NYUA 1LD3A 3AY7A 1KYXA 3HB5X 4K8OA 1HLPA 2QX9A 4WNCA 1TVCA 3ADBA 3FHCB 1EFCA 2YR0A 1DARA 1B6GA 1P6QA 3THWB 1AGYA 1DXHA 1TYBE 2ECOA 2JCYA 2ZSKA 4HTFB 2ECFA 3HZHA 1V8BA 1QDEA 2Q2VA 2ZRQA 3I2IA 3CTPA 3IESA 1SCIA 1NVEA 4JVMA 4P3OA 4X41A 1PL7A 1VHDA 3GJZA 1D1TA 4P82A 4QSMA 5KTNA 1ADBA 4TL9A 2QORA 4G23A 4RK4A 2FDRA 3STWA 4L6IA 1Y8ZA 1H3EA 1QIHA 1C80A 3L40A 2OBXA 1ESNA 4N01A 4JUFA 4RGQA 2J09A 1OLUA 1ZITA 2H2GA 1MMFB 2LIVA 4D9EA 1NMXA 1ONPA 3U7RA 4BS9A 5IZ4A 1YI0A 1IZZA 2I2FA 1JP7A 1TQHA 3PQCA 3R5KA 5HR5A 4I9NA 1XCBA 3EF1A 4O4JB 4P5EA 4RIGA 4REQB 4S2UA 5A4AA 1EB9A 1NLYA 4BJ6A 4WADA 3LC7O 3AHCA 1QO0A 3N86A 4UUPA 2ATEA 3Q6NA 5KOJB 1QZUA 1ZVVA 1X14A 1KJ8A 1YBMA 3FA2A 4EMUA 4IDNA 1BCRA 4MS3B 2PZBA 1NUPA 1E9BA 2FEXA 2GCGA 4BBAA 4N3AA 3QF4A 1DBSA 3K9CA 4OUDB 5T8KC 1SCDA 2IXBA 3EZNA 2IXFA 1A72A 4K1XA 3DE3X 5KSPA 1IBMB 1IC6A 4Z9BA 3DE6X 3R4CA 4XX0B 4A0RA 4CCWA 5ENVA 4ZCMA 5CLFA 1IM8A 1WXFA 4CXMA 2D7DA 2VDMB 2W6IA 4FR0A 3GO4A 4NFSA 2XTMA 2VJKA 1DG3A 1LTKA 2HJHA 2OCDA 4MR7A 1EYZA 2GBCA 3LGSA 1F20A 1L5QA 4G5YA 5A3SA 4DL9A 2PUEA 1M8KA 3AKDA 3ELYA 2CDBA 1Y9EA 4CUZA 3GLVA 3SD7A 1D5WA 2GPAA 1SQ5A 4K05A 5HMLA 4ZZ0A 1GTZA 3QITA 3HV2A 1C29B 5JCPA 1GRCA 4F3KA 3ESQA 2IU6A 3NHWA 5GJCA 5CEJA 4F2DA 1YSCA 3K05A 2W0SA 3M6XA 1K7YA 2BFDA 4B74A 1CIVA 4PS0A 5SYMA 4F4DA 4JU9A 1ONOA 1R88A 5FPQA 5GJWC 4GPBA 4GRAA 2I55A 1CZOA 3P94A 1DPGA 2ODWA 5BSMA 4B0OA 1FUIA 3Q9SA 3KLPX 2YBEA 1FIUA 2XHZA 1M1XB 2JIZD 1KOFA 2FEOA 5FA5A 1G42A 1J22A 1W76A 4DA6A 2ESRA 4LWPA 1G20B 3G82C 4RSMA 3WJAA 4W1SA 4Z9XA 1U4SA 1P39A 2GEKA 4D4KA 3UTCA 1UXGA 3VBEA 4M9XA 5CLGA 4G67A 2BGIA 3I73A 5HZGA 3HU1A 3MYRA 2Y0CA 3BRWA 5DDIP 1D7AA 3T0FA 1MQSA 3AUFA 5AVJA 3TFQA 4IHQA 1EH5A 1CZLA 4E32A 5CFLA 3MS4A 3G0DA 1DFIA 1PJTA 4MW4A 1JFVA 4OH1A 1U2GC 1RI2A 4LI3X 2G70A 2OZLA 1TA9A 1YJXA 2OGUA 2YDXA 3H16A 3K9LA 3K9WA 3OKCA 3SN6A 3KJFA 2F43B 3BD6A 1DTWB 3DLPX 4Q4LA 3DNPA 4DVGA 3K9FC 1JVBA 1E3SA 1QIJA 2HCTA 2V6IA 4WIAA 3AK4A 3VI4B 5BMVA 4L28A 1Y3CE 2WKSA 2JDIA 4WA8A 2ZRDA 3PPYA 4MQFA 2IH4A 1DIBA 4BUCA 4Q3CA 1WBJB 4KQ1A 3S2YA 4FNOA 4A2PA 3G2PA 2FVYA 1C7QA 2ZBEA 4BO0A 1CFJA 2OAEA 2QUHA 2WHPA 3SJCA 1NOJA 1WIWA 3ADOA 5ITZB 4BDSA 1A3CA 3E05A 4B82A 2VP5A 3JD2A 1CP3A 2XYGA 5CNMA 1H6AA 4Z0NA 4AKHA 3VTFA 3FXAA 4UNQA 2HSGA 1TK2A 3KE8A 2G1AA 2DLCX 1RXIA 1R10A 4Y1FA 4HHEA 4MDEA 4O08A 1Y3BE 3MS7A 1JIUA 2O1XA 2XTZA 3B6ZA 1PV1A 4U4AA 3T7SA 4Z4HA 5CFPA 3ZD7A 4OJNA 2OBLA 4YRJA 4N65A 3C5EA 2B69A 1KVRA 4QYIA 5JV5A 4PPGA 4DF3A 1WXQA 4UMVA 1W0CA 2R11A 1NF9A 2NYRA 3OQ6A 1HE8B 4LBWA 1ZI6A 4D9NA 3NDBB 2DTDA 3BIWA 4WKCA 4GYWA 1A7UA 2FPPA 4KQ9A 4O2AF 4DR4B 1M2OB 1AO0A 1RCFA 4FQ7A 3A1WA 5I7RA 3CPEA 1CW2B 3WNCA 3ZVLA 5A2QA 4NJEB 1NVGA 4O1IA 3JYLA 3DFKA 4V1CB 4JL5A 3DF7A 2OYRA 3KPVA 1RMQA 3EFBA 1C9MA 3NOXA 5AIAA 3VR6D 5C5DA 3OZWA 3DD5A 5F7OA 1XQYA 4J1NA 4KPUB 2WP8J 2AFVA 5KQSA 2VDWB 1Z37A 1II9A 4YAOA 3TQOA 1APBA 4FFBB 4QATA 1WMDA 4IKEA 1I2AA 4QO7A 5AIBA 3EH2A 2VUIB 2DCUA 1EGMB 4Q7EA 3DONA 4NJOA 2V4MA 4BV2A 4RF5A 3SI7A 4NK5A 1EQUA 4NYMR 2RBGA 3IUSA 1SD2A 3OIWA 1QG2A 4HQ6A 4N0MA 1HQDA 4V0MA 4C05A 5A5GA 1HZZC 3EXEA 1P6XA 4QULA 4WACA 1KZ4A 3NZEA 1WQ4A 3R3XA 2NM0A 1EWRA 3HVHA 2RIPA 4I99A 4M1EA 4H1TA 3KLBA 2WINI 3HDQA 1SCUB 4IOLA 2BGKA 2LV8A 4MVJM 4CLOA 1GNPA 3Q8MA 3PUVA 2REBA 3EZFA 5BWBA 2UVQA 3IEPA 3O26A 1N6HA 3WDKA 4YMTA 3DMHA 1CK4A 3U61B 4ZZ3A 3PT5A 2UZ3A 4PINA 1P5ZB 2GX6A 3BWCA 2AXQA 1A5BB 5AKKA 1CF4A 4EPVA 4HUJA 4HAOA 4B4KA 1BXRB 4YHBA 2FN9A 4RMIA 3VHXA 1PUXA 2H2FA 3RANA 1VPTA 3FY4A 2PRJA 2HX1A 4E14A 1I2BA 3NOQA 1Z4OA 3LPMA 3FWHA 2ALJA 4TTQA 1FUYB 1XMJA 5LQMA 2P69A 3IEVA 4INZA 1GQFA 4MRRA 5FTMA 1ELOA 3F3YA 4NOKA 2XVZA 1PQPA 2PV7A 5CIYA 1NVWQ 2HADA 3H6HA 2O1SA 3T3MB 2O7SA 1QFZA 3EQ8A 5JNSA 1YS1X 5KQGA 1G55A 1SXJD 3T5CA 1CBUA 1POXA 4JBHA 2PFSA 3CE6A 1X6VA 3UPUA 2AW3A 2AIRA 3GUCA 3KPUA 5UKDA 1BDMA 3OP4A 3VSBA 5TGZA 4FYXA 5A0VA 1W9MA 5C37A 3AM4A 2G5GX 1DTSA 3G9XA 2NU8B 3WC4A 4H0FA 1RZRA 1G38A 4N7RA 2IZOA 1QJCA 2J32A 3ZBUA 3BXOA 3COZA 4KRYA 1QPBA 4RVFA 5BRNA 1Q6ZA 4EFDA 5DOVA 4CLRB 2PZAA 2IY7A 1GM5A 4GZMA 2DR2A 1XE3A 5ES3A 1OBHA 2Q0QA 2R8EA 4W4TA 1IONA 3TSZA 3WGHA 1ZRSA 1JXAA 1VI5A 1VXOA 1N9GB 5AM4A 4UAJA 3PC6A 1LDBA 2C20A 4EB0A 3IRVA 4JKYA 4K9RA 4U2KA 2VPTA 4NENB 3RVPA 1YE8A 2JI7A 1N1MA 3COYA 5U4QA 4PBRA 3I6BA 3DZHA 1JV2B 1E1YA 1C8VB 1ZISA 3DVAB 5C4GB 1XPRA 3EISA 1P0FA 4UEOA 4DRZA 5AT1A 3GOHA 4P53A 2DXIA 2P3OA 2HF2A 4E7OA 3QLUA 4YONB 4EW6A 3U9SA 2A3RA 1U11A 3BHMA 2I65A 4I1VA 3UHOA 4W9RA 4ZU1X 1MAWA 5EL0A 1T36B 5IBPA 1PT7A 3H5RA 3QV1A 2ZE5A 4MAAA 4OA5A 4NLLA 1R3UA 2OP1A 4JLWA 4LW8A 5JC1A 1YBHA 4TV9B 3FTQA 3I05A 2IC5A 3E0XA 2VH1A 4EECA 3FAZA 3UMBA 4IEEA 3RF6A 1Q14A 1E9CA 1F9EA 2OOKA 2XWBF 5J58A 4TMKA 2B2NA 2YW9A 4Y6SA 4XIGS 1JMYA 3EQ2A 4AG5A 3D59A 1R6AA 3LFTA 3NH9A 2D54A 1HBJA 1N7HA 4JVOA 1ECGA 2JLQA 5C8ZA 3OA2A 3L8HA 1UKVY 1VSUA 2AL7A 4CV2A 2SNIE 3RUIA 4A6XA 4LGCA 1K8YB 2B30A 2I67A 4AN1A 4DQUA 3TIGA 1SBCA 1H0KA 1R8XA 1EJBA 3PFWO 4P7FA 3UEOA 3ZWYA 3TG2A 4UDXX 3E58A 3MHTA 3AF3A 4HNVA 1ZNYA 3L1UA 1ZC4A 3ITKA 3LHSA 2JNWA 1K6IA 3PPVA 2YY5A 4GOJA 5EE9A 3UWPA 1AF7A 5KBYA 1OROA 1WQ1R 3H2SA 3IXMA 2CXQA 5H3LA 1VB5A 3TM4A 3CH7A 4DV2B 1E60A 4QODA 1XPOA 1O96B 2HCRA 1GPWB 1JSLA 3HCBA 4XVHA 3NBYC 3OE4A 5AWFC 3VKWA 4Y2VA 1ADYA 1CY7A 2VUHB 1EU1A 1XIVA 2VP4A 2VSOA 1J20A 4XUCA 5BSGA 4JIGA 2HNBA 3GRZA 3RT1A 3HDHA 4W5TA 2CLCX 4G09A 4ZJYA 2QVYX 1V8DA 3DMGA 4A0HA 4URXR 3F7TA 3IV9A 2GNPA 1UBEA 2Z8XA 3DMPA 3DGFC 1YA8A 1XDSA 2GDZA 4AJOA 5FH9A 2A57A 3OMLA 1XP5A 4GEKA 3CVXA 4NZNA 2BW0A 4HGZA 2B9VA 3FJOA 4OQEA 5B1EA 1J7JA 3CF6R 2IPLA 2N9UA 3I0NA 1PDWA 2RAPA 3RSQA 2C8JA 1LUAA 1O2DA 1SU6A 2BC9A 3AEUB 3QXSA 4AJLA 4S0ZA 4NNOA 1AKUA 1DLIA 2BPOA 1AA9A 2VYVA 2PM8A 1GU0A 2P79A 3HFGA 1PK7A 2ZQZA 3QPCA 1K08A 3T99A 3WZMA 4DIEA 2VP0A 1KO5A 2ISSD 3BKXA 1AY0A 4O4JA 4FGWA 1E3LA 3EVEA 4RH1A 2XCTB 2XTAA 1NMQA 4YASA 4WZZA 1ZBDA 2ODEA 2G5CA 1EFLA 4L9AA 4ESVA 2H0RA 3I4CA 5IANA 2JAPA 4LK2A 1Q0UA 1G8FA 2D5CA 3DF9A 4HEQA 3KLNA 5PNTA 3TW6A 3K6SB 1Q5PA 1J2TA 4H7JA 4JT8A 5GM1A 4DUGD 1ZNWA 2IYUA 4E4YA 4GECA 1FMLA 5J59A 2GKOA 1L5FA 1OLXA 3FUXA 3L0ZA 3DKPA 5EWMA 5H82A 4DLBA 3CLSC 4H77A 3DMFA 4IL5A 4Y2QA 2IX3A 1ZR2A 2WOOA 5K8CA 4OI0A 1OT5A 4Y2XA 1M6HA 3M2TA 3WMEA 1Y5NA 5TS2A 1T13A 4N0EA 1G7RA 3T52A 4CR8A 2I6TA 4NATA 4Q9JA 2YVQA 3ANNA 2QSJA 4WK2B 1X7WA 2R4UA 4C07A 1VE3A 1E9VA 5FUWA 1L1FA 4CL8A 1X1AA 1UK6A 4RH3A 1TC1A 2ERYA 2QRKA 4JYPA 4XDYA 3T4PA 1UBMS 1QB8A 2Z1MA 4RA9B 5CGZA 4PNHA 3RSSA 4IS2A 1BOOA 1AE1A 1TAHA 1T43A 2ZTVA 2LD4A 2VP2A 3AHJA 2WMYA 4PNZA 2BSAA 1E2PA 3JRWA 4MR8A 5FP0A 2PRIA 3LT2A 3EC7A 1XCOA 3A1CA 4UU0A 2J08A 5JANA 4JL6A 4P32A 3STTA 1GL7A 3G9QA 4KFUA 4F5EA 2UKDA 1L4MA 1R18A 3M6AA 1Z0IA 5EE5B 3CW9A 4FMBB 2VI5A 3VZSA 1J8QA 1PNQA 1RC1A 1X0VA 1DQPA 5F9FA 3I0ZA 4RF2A 4IFBA 4CTJA 4WUVA 4PLFA 2FRDC 2QMHA 1QH9A 2VCEA 4F0JA 1FSGA 3HCRA 4EUSA 3IB6A 2J5RA 4Z7QB 2RGGA 2ZKLA 3TQIA 4N5IX 5FBWB 5JQWA 1ZIOA 4B6EA 3I9V1 5D3KA 2GTHA 4YMIA 1VP9A 3OT1A 3O9MA 4JLVA 2QVZX 3D0QA 5EKXA 1IUKA 2FKAA 5SZIA 1CY2A 1U4NA 1OFTA 3A9TA 4KE8A 1JWLA 5FPKA 2X15A 1UPUA 2E87A 3P5SA 4C4RA 3AKZA 3TSYA 4CMKA 2KPOA 4BWVA 3TW8B 1OX6A 3DA8A 1PWYE 4C4XA 3U4GA 2CMKA 2G9NA 3U17A 4YACA 1C3VA 5FR1A 5EJ8A 5CIQA 2FQYA 2OKCA 2WHYA 3K8YA 3I1JA 3KBBA 2O23A 2VXBA 1IXYA 3JQ7B 4RLQA 4JSYA 4HVLA 4KVFA 1TCAA 2H00A 5CXUA 1Z7BA 2AC4A 1OI7A 2OORA 1EZ4A 3ELBA 1KBZA 2XNHA 3PUWA 1Q1BA 2IYEA 4MTCA 5EC8A 2JHFA 3MHPA 1JU3A 3U44A 4UEQA 1DBPA 4GL4A 1L5RA 3W5SA 1DWUA 2OAP1 3L4EA 1F6DA 1A5TA 1H2WA 3FZYA 3X43A 2H7VA 3NTUA 4FLEA 2EW2A 3IR5A