2PZEA

Minimal human cftr first nucleotide binding domain as a head-to-tail dimer
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
228
structure length
226
Chain Sequence
SLTTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLDFSSKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 76
structure length 226
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pzeA00
3IILA 3HU1A 5JFGA 3BFXA 5FL3A 5KDDA 5CK4A 1XWIA 1KKMA 2G6BA 2RGNC 3K0CC 3I8XA 2XZOA 3VKGA 1YZNA 1BMFA 2CCJA 2VA8A 1FZQA 3EZ7A 4UXIA 4HLDA 1KTVA 1GSIA 2EWWA 2FX3A 4PO1A 2VRWA 2KBEA 5GJVC 4GP6A 4Q21A 4DT1B 4V0MA 5FTKA 3WBJA 2ZS8A 1SKYE 3GJ0A 5FOTA 2CL7X 3FVQA 4BLTA 2BOVA 3GP8A 3ONWA 4MRNA 3IHWA 1E96A 1UKYA 4UNPA 2QGNA 4QM7A 4IHQA 1YJ5A 4BQSA 2REOA 1ZMXA 5E95A 4GRAA 3SHFA 2O8DB 2A5FA 4B47A 3I62A 1F2TB 1XXHE 2VP2A 3FHCB 5DHAA 3SFZA 4LJ9A 4DB2A 3EARA 3IBGA 1W36D 1G64A 2RAPA 4TT3D 2EU8A 1AJEA 1J8YF 1ZM3A 1ZD8A 2CHGA 4LUCA 3AP1A 4A0HA 2IYLD 3BAFA 4ARZB 2WKQA 3E5HA 5H8WA 3SQXA 1CR0A 4PC6A 4V0ME 2ZRPA 4DLRA 4HAYA 2O8FA 1UPTA 2WWWA 2CE7A 2PCLA 4O2RA 3AP3A 3CH5A 3E1SA 1S3GA 1NJGA 4LJ7A 4QGAA 1P60A 2IEZA 4OBEA 3EIEA 4ZKDA 4D4JA 1XRJA 1OSNA 3IUYA 1ELOA 3TIFA 4RFSB 4M9ZA 1HTWA 4FWTA 4B44A 1SVMA 2RGNA 3K0CA 4HB2A 1ZUIA 1E0SA 2VSXA 4OQMA 1Q44A 3GQBA 4FMDF 1GFIA 4NYMQ 1MO4A 1R4AA 5JLJA 1E2PA 2QE7A 3LD9A 2VHJA 1NIPA 3RYTC 2JLZA 3ZIAA 3T1VA 3CB4A 2YV5A 4EIWA 1HQCA 1OB5A 2QP3A 4Q1EA 2ANBA 4MKHA 5FI0B 4GL2A 3V4FA 4CDGA 3W90A 2LWIA 1D6JA 1SKYB 1XD2B 4DZZA 4EQ6A 2O8FB 3VR4A 5BWMA 3NBFA 3C41J 4JJKA 2WIAA 2WZQA 2XZPA 4RD0A 4TQUS 2ZU6A 1P2UA 5HE9A 1IY0A 4MKFA 1E9EA 3QXSA 4FMCF 2FPLA 3BIFA 4FXPA 3VHXA 1T3LA 3LLMA 3NTUA 2HUPA 3A1UA 3SQWA 5FL7A 1HEIA 1BO6A 1SGWA 421PA 2F3TA 1W49A 5KSYA 4OL0A 2ZVPX 1G16A 2EYQA 2BHRA 4LSGA 3QBTA 4JSTA 1Q3TA 1HE8B 1Q3HA 4KFUA 4CEHB 2YOGA 4ESHA 1HE1C 4FIDA 4JJZA 4BLSA 2D74A 1PUIA 4URWR 4JLAA 4OQLA 1F2UA 1PJRA 2WM9B 2QQ0A 3TNFA 3X1YA 1Z83A 1W44A 1JEDA 1CEEA 1M2OB 1KDRA 1G5PA 1Z0JA 3A4NA 3B1XA 3ZQJA 4PC2A 1VTKA 1NG9A 4S35A 3AM1A 2IYVA 3UMSA 2B8WA 2V4ZA 3Q7QA 3TE6A 4E03A 2B6HA 4Q5IA 1XPOA 1G19A 4IFEA 1A2BA 2CHVA 1G7SA 2QMEA 4DDVA 3ZD6A 2IS2A 2NGRA 3A1TA 1QZXA 3IKJA 4BFYA 2B8TA 3SZRA 4BLPA 3QSYA 2GKSA 1E0AA 2R44A 4JKIA 4LYFA 1YKSA 2K5UA 1B23P 1XTIA 3AF4A 3BFVA 2I1QA 5FTNA 3VU9A 3LLUA 1GZSA 3VTKA 4A2QA 1PUJA 1EFUA 4YC7A 5CLLA 1OKKD 4IOJA 1WCV1 2HCJB 1XEWY 3B1ZA 3FTQA 4G0NA 4M1TA 2ZR0A 4FMCB 3UG6A 1KI4A 1J7KA 1COWD 1UM8A 2XAUA 5B58C 4HYYA 4JMPA 5BQ5A 4YDHB 4B32A 4F91B 3SBEA 4BFXA 4JBWA 3L0SA 4C0AC 4JS0A 1Z2AA 1LTQA 4MYCA 2RGBA 1GIAA 3JZAA 3QXCA 4DCNA 2ZYUX 2QP9X 4LHYA 4A6PA 3J81k 2NQ2C 3SNHA 1GOTA 3IO3A 2NG1A 3THYA 3FFAA 2IXFA 2ZYVX 1QBKC 1Z3IX 1Z28A 3K53A 1W47A 4HUQB 4UQOA 4YXWA 1OXSC 3K0FA 2ZRJA 3IDQA 4JLOA 2JJ2D 4U7DA 4BFVA 4MQBA 3O8CA 4R9UC 3TR5A 1I4DD 4B75A 3W8NA 3PUXA 4EPYA 2J0UB 2F43B 3FHOA 4Q02A 3I4LA 2KJQA 1SXJB 3ECCA 3KDSE 4UXJA 4DWJA 2WJIA 2YJTD 2NTYC 2RMKA 4QOSA 4RZ2A 4B43A 1N2CE 2H17A 2J87A 2E87A 2QM8A 2XTMA 2ORVA 1BIFA 3RNLA 2Q21A 3QIAA 1E6CA 4JLBA 2QSYA 4CVNA 2AD1A 2D3WA 1P62B 3T35A 3NWJA 3QPVA 2BWJA 2WJHA 3R8FA 2J45A 5K8UA 3CO5A 1OIWA 2FSIA 3MWLA 2DB3A 5CDFA 5D3QA 4UXHA 2OT3B 2PZGA 3GLFB 3TLXA 2B7BA 2CE2X 3UPUA 5F9HA 4QBIA 1MT0A 3A8TA 4L9SA 4LWZA 4LV8B 3SJCA 5EQTA 4DEXA 3NBXX 5FI1B 2FN4A 2W83A 3VU9B 3SR0A 3P4YA 4D0GA 4DLVA 3RRMA 5KYKA 1K5GA 5HR5A 2FWRA 5B57C 2OUKA 5F2EA 1CJMA 1NMXA 2O8CA 1TUIA 5FBLB 1TL7C 1T8TA 5L3RA 1E2LA 5FOWA 3WNCA 5FOVA 1E2GA 4PTLA 2F9MA 2VP9A 1M8PA 1F5NA 1Q21A 2B21A 4AKGA 5DO9A 1ZCAA 3N70A 3CPEA 3DL0A 1XCGB 4P31A 1PLJA 4LHXA 4B2IA 2WJYA 1ZIOA 1YZUA 1XCMA 1C9KA 5G40A 3AB3A 1GNRA 3C8UA 1NY5A 4JYBA 4M8NE 3WXMA 3RC8A 4TSFD 2JLSA 2UKDA 1E9DA 3RRNA 2CCKA 3FKSD 1GG2A 1QF9A 4Z8YA 3X1ZA 2A5DA 2BVNA 2RGCA 4HAZA 3AKEA 5B64A 5FR2A 4IJMA 4AC9A 4Q03A 2RKOA 4AG6A 1VCNA 1GILA 1R7RA 3KQKA 121PA 3GJ6A 3V9PA 1P9NA 4QC2A 4QJ4A 1AS2A 3TAHA 1G3MA 1HUQA 2X77A 5J4VA 2FJUA 4P33A 4KBFA 4URUR 3A6PC 4NDZA 4RD1A 3BERA 4A92A 5KHOC 4AKHA 4TMKA 1KI8A 2Q3MA 4M1SA 2MSDB 3MUFA 4LI0A 2HLDA 2ZUDA 5JZVA 4POAA 3SI7A 4OHXA 2ZRCA 3AH8A 4NYJQ 3CBQA 4PAOA 2YOFA 4G5RA 4QJ3A 3SDZA 3AVUA 2H92A 1P3JA 4Q4HB 4BWYA 3ZS9A 2KBFA 2AKAB 3LNCA 2FGKA 3KX2A 4HUTA 2ZXUA 2ZSEA 3SYNA 2J5XA 3H86A 1JXOA 1FP6A 1ZC3A 3U61B 5AR1A 1XXHB 3SS8A 5DGXA 2ECKA 3UK6A 1CS4C 5B2ZA 5FR1A 3KL4A 1NMZA 3LH5A 1Z6AA 3PVSA 1GTVA 5EE9A 2VO1A 5JS8A 2OCBA 2Z5FA 1ZCBA 2BV3A 4K46A 3HYTA 3G82C 5J5CA 2XXAB 3SJBA 1A82A 1FQKA 1XX6A 3A1SA 4EFNA 1DAGA 1BYIA 1KI1A 3GD7A 4P4UA 3BD9A 5HCIA 1ZINA 3H0KA 2CDNA 1GVNB 1XTKA 3FMIA 4PR0A 5TV2A 3AVTA 1ZRHA 2ZPTX 4Q1BA 1E9AA 4B2PA 4IKEA 2CJWA 4TL7A 1YR9A 4ZIRB 4QHYA 2F9LA 1NN1A 2FV8A 4TMVA 2N42A 5JBQA 1ZU4A 2ZRMA 5JJLA 4BE7B 2P0EA 4M1KA 3R7WB 2NZ8A 3BFKA 4JBYA 2IXEA 1Z08A 3Q9LA 1FFHA 4V02A 1XNJA 5ANRB 4BEBA 4JLNA 2A9KA 2Z43A 3BJIC 3EASA 4PC7A 2ATXA 1RKBA 1H8EA 4QGFA 1NJFA 1FUUA 1L8QA 4IDQA 5EXXA 4E07A 2R6CA 2D4HA 2R9VA 1Z6YA 3QENA 4HLCA 4I1UA 3WNDA 2HCBA 2AD5A 2J7KA 1KSFX 2W6JA 2Q6TA 5DYIA 4BFSA 1AM4D 2YHSA 4DLUA 3RWOA 3TGPA 1WBDA 3BOSA 5JECA 3VAAA 4DHEA 1NBMD 1Z22A 1OXUA 1N0UA 3KXLA 1XU4A 3RABA 3U7HB 4TQAA 3VR6A 4D0NA 2JGNA 8OHMA 3LA6A 2QN6A 2OCPA 4JVNA 4A15A 1P61B 3QEOA 2A2ZA 4TLDA 1GL6A 4B6FA 2IHBA 3PQCA 2ZR7A 1KDTA 2H57A 3DM9B 3L0IB 1I2MA 2ZTSA 1TTTA 4KSBA 2OAQ1 2MSCB 3WBKA 2BIFA 3CPJB 1NVWQ 1F6BA 2C9YA 4EFMA 3AKDA 5EP1A 3LBHA 1N0WA 3VR2A 4DSOA 4XWKA 5JI3E 2X1VA 2IA5A 3TUZC 3B5JA 5DNYB 5FFMA 2Z6VA 2QT0A 4Q4AA 4DVGA 4LPKA 3PUZA 4X8LA 5EE0A 4C2TA 2GA8A 5C2JB 2BBOA 3QUSA 4RVCA 2NO1A 2V8OA 1VIAA 4B3FX 4C0JA 2FDCA 5E4FA 4NE2A 3T1QA 1GRQA 1CJKC 3U4QA 1ZVQA 4M9SA 1G4AE 1DBSA 2NMVA 4TL8A 3KJIA 4TLBA 2GEVA 1A1VA 4Y0AA 5DE3A 2GJ9A 4LBVA 1NLYA 3BWDD 3ZZTA 2OSBA 1RFLA 5KU1A 1XD9A 3S1AB 4OI1A 4M1YA 4KLNA 4JL6A 2IYQA 4MYUA 2WWIA 4C0BA 1T8UA 2HF9A 3B6EA 5CITA 3GCGA 1G6HA 1KNQA 3B1WA 1E2DA 4IDHA 1LVGA 1T4GA 1VCIA 3IHLA 2OV2A 1R5NA 2WVJA 3TSWA 2ZS9A 3IGFA 2QY9A 3LVRE 4CEJB 1E79A 2XITA 2JJ1D 2QG6A 4KLZA 1MABA 4JYCA 4IOKA 2CHQA 2FFAA 2VP5A 3CF0A 3LWNA 3PR1A 221PA 3OF5A 1YZGA 5ELXA 3AQ4A 5C46F 1DAMA 2P5TB 3IBYA 2GWHA 1EX6A 4MGIR 4V03A 4AIIA 3LAWA 1S4QA 2O0HA 4HDCA 3SYLA 2J0QA 4A2WA 3LX5A 5BYKA 4MDFA 1U0LA 5D3MB 4IDPA 1MO5A 2FFHA 2PX0A 1GKIA 2GXSA 2V6JA 3EZ9A 4QBFA 4H1VA 4Q9JA 5SZKB 3CWQA 5CJPA 3L0OA 1G8GA 2CBZA 1PLLA 3UXMA 4EFLA 4FCVA 4E09A 4YMVA 1W4BA 2AFHE 2GJAA 3A4MA 3EWAA 3R7WA 4F7WA 4PHGA 2NO7A 4BPBA 4QBGB 1HV8A 2ASEA 2AN9A 2O52A 5KOYA 4LZZA 4KYUA 3SFVA 4DUGD 1VHTA 4OI0A 1DVRA 3TRFA 3VNVA 1R5BA 3NH6A 1OFUX 1D2NA 1W5TA 2GF9A 4GZLA 5JWRA 5L3SB 3BB4A 4MUBA 3R8CA 3AVWA 2J0UA 3QXJA 4MRVA 5JS7A 3RSLA 5JHGB 5H1YA 2GEDA 2EFDB 1P5ZB 5KSPA 1AGPA 2JEOA 2ZRHA 4KAXA 4D80A 4RFVA 2QP4A 1RZ3A 1W5SA 1XXHA 1WQ1R 1NN3A 4HUQA 5KDLA 5LBIA 4YMUA 1OE0A 4N1AA 4TTQA 3RRYA 4FW9A 4BRWA 2BM1A 3OEEA 4A0FA 4GOKA 4F38A 3OEHD 4JIMA 2PL3A 4Q9LA 2CNWD 1KNXA 1NVVR 5HCNA 1Y63A 3HJNA 1E0KA 1KAOA 2FMXA 4QBHA 2BKUA 1DG1G 4JVLA 3PCRB 2A5JA 4DSTA 4NP6A 1RRGA 3W3AA 4HEJA 4IOMA 1N0VC 1WDTA 4KVAA 4EDHA 1L7VC 3AF0A 1FX0B 3CRQA 4A4DA 5AJVB 2OXCA 3IEUA 4DLTA 2WSSD 3K09C 1FW6A 3ICEA 2ZJ8A 2CVHA 1UDWA 1E79D 3OIYA 2JASA 2W6JD 3SJZA 1ODFA 3GLGA 2HJGA 3TAUA 5K8TA 4M2LA 1M74A 1A7JA 1QG2A 3CX8A 4P0TA 4LGMA 1KI7A 1VIYA 1NBME 3MCAA 4UJ3A 4HB3A 4EPRA 4PHFA 4DDWA 1N6NA 5H70A 2WMNB 2P6UA 3B78A 3VFDA 5BW8A 4XWOA 1LFDB 4XVUA 2QA5A 2QZ4A 1ZNWA 3IPXA 4OI2A 2GBLC 2R6FA 3W5IA 1OHHA 2QAJA 3SN6A 3KQNA 1II9A 2KWIA 1OH6A 1AQYA 2YVUA 1IXSB 3NXSA 2VL7A 2HT6A 3QF7A 3TQCA 1JR3A 3VR3A 3SE0A 3T5GA 1IM2A 1IONA 4ESVA 5FPSA 2V54A 4X8MA 5FBVB 1G3QA 1F2UB 4KV9A 1G8HA 1G7RA 5LD2C 5GVSA 3MG9A 3KUDA 2OFWA 3GLGE 1E4YA 1W4AA 1W7AA 1R0YA 1XTRA 1S8FA 3C5HA 4NZYA 1CJUC 4B76A 4NCIA 1N6IA 1NBMA 4QFMA 5EJEA 5EP3A 1XTSA 3AVQA 1X8LA 1GL9B 4LDJA 2W6ID 1G1MA 2J0VA 4PO8A 4Z51A 3G0HA 1IOZA 4F92B 3PUYA 4W7SA 2ZS7A 1LW7A 4M1MA 1OIXA 2EFCB 1NIJA 1US8B 4MA4A 5EZ5A 1SQ5A 3U7FB 1JR3E 4GNKA 3RVBA 1NY6A 3UIEA 3CRMA 2A30A 4DLWA 2VTKA 1XJCA 1R0WA 3KJEA 1S96A 4JLDA 5FH9A 4DCTA 3QG1A 1XMSA 1ZW6A 4TMTA 2VLIA 4K8OA 4XTCS 3ZZ0A 1GWNA 1YHNA 4BRUA 3CX6A 3KJHA 4NKRA 1HY3A 2YWFA 2P5SA 3RS4A 1OH8A 1YR7A 3AVOA 3W6OA 1R8QA 1KMHA 3DHWC 3CRW1 3GLFA 1W0KA 3ZVNA 5JHHB 4HAUA 1U0JA 2PZFA 2WJVA 2F1IA 1QVAA 2QQEA 3CH4B 4G1UC 2AFIE 1LB1B 4R71A 1Z5ZA 2BMEA 3SJAA 2QTVB 5L3VA 3U3KA 1N6PA 2H1LA 2WHXA 1GP2A 3C4JA 3AVVA 1TQ6A 2D7CA 4BLOA 1NKSA 1S9DA 2JLVA 3AEZA 2VHTA 2AXNA 3WY9A 1MRSA 1E98A 4LYAA 1QRAA 3WYFA 4DSUA 2XNDA 3QI2A 3R20A 4LYHA 3CZPA 2ZITA 4LC1A 4CIDA 3KKOA 3K0FB 1FTNA 2W2VA 3PFIA 1UBEA 3BORA 4PHTA 3K8YA 2YWEA 1EFCA 1LS6A 2F43A 3EPLA 4KVGA 5TVKA 2IS6A 3JVVA 2UZIR 1X1RA 5CM8B 4NCKA 4EPVA 3PENA 5EE1A 1DADA 2FG5A 3LVQE 3HU2A 4LHZA 2QAGA 2CEAA 1NVVQ 4V0KA 4AYTA 3A37A 1TF5A 3I32A 2VP0A 4AURA 1E1QD 2PJZA 3CKLA 2JLYA 2JA1A 5FPHA 3CR8A 2NO0A 1WA5A 2QENA 1EG7A 3S1AA 1KI9A 3U3JA 2AWNA 4QG7A 5KPDA 4AD8A 4KJZA 1D9XA 2RHMA 3U6KA 4ZCMA 1TQ2A 3FWYA 3UG7A 3AKYA 4KU4A 4CT5A 1S9HA 1VPLA 2ODWA 2PLFA 3I72A 1JBKA 1EWRA 4HDOB 5H68A 3KTAA 4CRWB 5AWFC 1Q1ZA 1XBTA 2Y8EA 1G41A 2ONJA 1YVDA 4PZZA 4FWIB 1T6NA 2WIBA 2QPOA 4KITB 3OIVA 4PX9A 1CXZA 1E99A 4WW0A 1LS1A 2GAOA 4DB4A 2EWVA 5L3QA 5TMPA 3TSZA 1G4UR 1Q0UA 5CB6A 1TADA 2DFKB 2XJ9A 3QKRB 2CCGA 1O87A 2DFLA 3QVVA 3PXGA 3W3ZB 2KB0A 3AUXA 1MOZA 1SXJD 1N5KA 3NHBA 2IF0A 1N6KA 3U3MA 2ZR9A 4IEIA 1M7HA 4PSAA 4DBLC 1AQUA 2ZJ2A 4MITA 1ZM9A 3D31A 2R62A 2QRNA 3A58B 4TZ0A 4LCBA 5TB5A 4GDFA 1KZGB 3M0EA 1OFHA 3DDCA 4U00A 1FMLA 4EPWA 1N6OA 4IEEA 4ABYA 4C0QC 5AJZA 2N1BA 1KJYA 2ZRAA 3BC1A 4TTPA 4Q9KA 2H5EA 3CIOA 4AYXA 4C0KA 1HURA 5AUQA 3QPUA 4A82A 4IDOA 4AYWA 4M1WA 3LQQA 4XOIA 1E9CA 2BC9A 1SVSA 4A8JA 4AY2A 2CMKA 2HXYA 1W4CA 1ETUA 1AS0A 1G8PA 1TU4A 3RRZA 1SZPA 1NRJB 2B92A 1FP7A 5A4JA 3LW7A 1FUKA 4ZI3A 5FUXA 5C18A 1Z0KA 3MJRA 2DWPA 4TWZA 4DSNA 4DLSA 4N3NA 4FI3C 2JJ8A 4PSKA 4TYQA 3B60A 1V43A 2GJSA 1T91A 2JLXA 3B1VA 2BMJA 1II0A 1QDEA 2IYWA 4TYPA 1AK2A 2V6IA 2NPIA 1GKUB 3B9QA 4ZDJA 4LJYA 2OBNA 1OXVA 2R8RA 4TQ9A 5CIQA 1ZNYA 1ZNXA 4JSYA 1MR3F 2D06A 4WXRA 2LKCA 4II7A 5LD2B 3HR8A 1YR8A 2OHFA 2YINC 5CLQA 1LF0A 3NDBB 3VR5A 2OLJA 4TYYA 3T06B 2ZSAA 2WWYA 1R2QA 2VQSA 2ZVQX 1WMSA 5FOSA 3OHMA 4OHWA 1G3UA 2ZAOA 4C7OA 1I2DA 4OHZA 3NEJA 3REGA 4OKSA 2ZI4A 2DR3A 2ZRBA 3C7KA 2F1JA 5B30A 4OHYA 4FCTA 1Z0DA 3DKPA 3THWA 1E69A 1OW3B 4MH0R 3LV8A 2ZQ5A 1UEIA 2BJVA 2W58A 4NYJR 4ZI2A 4HLUA 1E2KA 1RW4A 1G3IA 1SULA 1XP8A 1UKZA 5CB8A 3FMFA 1HA3A 4LX0A 1N6RA 5AUPB 2OESA 4CF7A 1E9FA 4HZUB 1M34E 2UZ3A 5BXQC 2J0SA 4BGDA 3PUVA 3AGPA 2BMFA 6Q21A 1D8TA 5J4LA 2ZRFA 4XIGS 3B13B 3EPJA 5FBWB 2ZJOA 2OBMA 3RWMB 2YWHA 4K81B 4YMWA 5FUYA 4Q4LA 1SXJC 4MYHA 5EP4A 3ZLJA 1RRPA 5J40A 4HAXA 3RANA 3HYRA 1EWQA 4GZMA 4LJ6A 3OZXA 5CJ2A 4XVQA 4Z1MD 3D7MA 2A5YB 5G53C 2QMOA 3L43A 4PQYA 1L4YA 1UBGA 3OIWA 1WXQA 1ZNZA 3KKPA 3Q85A 5EZ6B 3K9LA 3CNLA 3R9WA 4TMZA 4NHOA 1IN5A 4OK3A 1JEEA 1EX7A 3K0AA 3IIMA 2C5LA 2QAGB 1TMKA 3PV0A 3PUWA 5KSOA 1G3RA 1G8YA 1QHIA 4QM6A 3PIRA 1WE2A 3U44B 4HZUA 4HLQB 1CR1A 3NHAA 1CP2A 2WWXA 4GMXA 1L4UA 2RGGA 2PZEA 4NCHA 4G01B 2CK3A 3WMGA 1U98A 3CRVA 2CNWA 4DXAA 1D2MA 2FFQA 1RE0A 4UNRA 1OH5A 5E3HA 1NI3A 4HB0A 1GM5A 2QORA 3F8TA 1YZLA 1KMHB 1AGRA 2OM2A 3BGWA 3D6TB 4KYIB 2GZDA 2W00A 4L15A 2CK3D 4OJKA 4JVMA 1G6OA 5JWOA 2ANCA 1EXMA 2P6RA 1EFTA 2IYYA 2YYZA 2Q3HA 4BLQA 4QNRA 2C9CA 4RD2A 1JAIA 5IDVA 5JWHA 4LBZA 5HKKA 1X8KA 4PO9A 1IY2A 3CPHA 2FSGA 4UNNA 2XB4A 1VYTA 1J8MF 2FGJA 4TMXA 4EJSA 3W6NA 4ZDIA 3CLVA 3QF4B 4QHTA 2OCAA 5JSZA 2ZJ5A 3BBPA 1IAQA 4OQXA 4ZO4A 3T34A 1JQJC 4DCUA 4A0GA 2FZLA 4HDQB 2OO7A 4JBXA 3PEVA 1RC8A 3RSOA 2ZI6A 2WWGA 1UBFA 2DFTA 2GCPA 3H2YA 3I8SA 1M7GA 5HZKA 2CVFA 4B35A 3KXKA 3GPLA 1DAKA 2OILA 3AVPA 3R9IA 2J7PD 1R5OA 3H4MA 4Q7JB 4PC3A 3F5FA 1G17A 1VG0B 1U90A 2W2XA 3CONA 4ZCLA 3HR7A 3I1FA 4A6XA 1AZTA 1CU1A 3DOFA 3VQTA 1NN5A 1XF9A 2CLCX 2O8BA 3MJHA 4KODA 3QKTA 4KFTA 3X1DA 2NOAA 2RB4A 2B7CA 4M21A 1TUEA 4URZR 1RYHA 4C0HA 3NVAA 4W5WA 2X2FA 3BH7A 1C1YA 5KNBA 3I61A 3ZVMA 2RGDA 2VH5R 1KJWA 4GMDA 2GXQA 1LNZA 2G3YA 1W1WA 2XSZD 3NH9A 4D2IA 1KO5A 2V1UA 4JVSB 1P2TA 3KXIA 1KK3A 3FB4A 5AK0A 3WHLA 1UKEA 2PMDA 4HATA 1JALA 4JLJA 3DO6A 3OEHA 3HP1A 5AJYA 4A36A 4KSCA 1T5LA 1YZQA 2F7SA 1Z47A 3TR0A 3P4XA 3TW8B 1LF5A 3DM5A 2GZHA 3LQRA 4TN1A 4TYWA 3UMFA 2DCUA 1XMIA 1ZJ6A 1IXZA 1Q20A 2ERXA 5GJWC 2H7VA 3E70C 3QG5A 4LHWA 1N5IA 2I4IA 1N5JA 1Q1BA 3KB1A 2GXAA 3OFNA 3NEYA 2V9PA 2AWOA 1AIPA 3A1VA 1T0JB 2IYTA 3BXZA 4TT3A 1VHLA 4B3XA 4XD7D 1U94A 4MGZR 3MMPA 5G41A 5GJBA 4DLXA 2P6NA 1P9RA 4EJSC 3K9NA 2C95A 4G5OA 2DHRA 2IYSA 1WB9A 1OT3A 2FU5C 2ZROA 3U7EB 4G5QA 2AX4A 2IHYA 1C4OA 2GCNA 2IYUA 4LV5B 1GNPA 3EIHA 1SVWA 2ZRKA 3K9HA 2JJ1A 3D8BA 3B9PA 4PPNA 1UBCA 3EZFA 4LJ5A 4NTZA 3TQFA 1T3HA 3U5ZB 5AUNB 1RIFA 1OV4A 3EXAA 3O8BA 1DOAA 1JPNA 1CR2A 4LYJA 4Y0VA 3KTAB 2IK8A 2GNOA 5JJIA 1VG9B 2VBCA 1E1RA 1NN0A 1E9RA 3PEUA 1IXRC 2FF7A 5E7MA 3RDPA 4D25A 3GFPA 1U8AA 1KIMA 2YNMA 4EUNA 4XJXA 1LY1A 4TLAA 1D9ZA 4D4KA 4B6EA 1YRBA 3RHFA 5GJCA 1UDXA 2G1KA 1W0JA 4X8OA 4A9AA 4I81A 1M6NA 3IIKA 1E2NA 2ZANA 2A3RA 5HE8A 1IY1A 2FNAA 3GEHA 3LFUA 4C3ZA 4I1OA 621PA 4E22A 1DO0A 2XX3A 2WAYA 3CNOA 3NBYC 1JR6A 3DMNA 5TXGA 2RH5A 3GJ5A 4IW3B 1HYQA 4HB4A 2GHIA 2YC4C 1EESA 1E0JA 4Q01A 1J2JA 1D5CA 2QGZA 2IYRA 3CF2A 1RRCA 1VKJA 4US2R 2VSOA 4B34A 4Q9HA 2ZRGA 1XZPA 3GLHB 3Q5EA 2X19A 1ZUHA 1DPFA 2G0NA 4R98A 2WWHA 4Q1CA 1G291 1XEXA 3ZS8A 5DYGA 1S2MA 4Q4JB 2JLUA 4O2LA 3DZ8A 4CT4B 2NZJA 1OH7A 5J4HA 2WV9A 1ZBDA 4HSEA 3EIQA 1IJEA 2GK6A 1U81A 5FTJA 4GBMA 1XPRA 4HLUC 2WKPA 2ZIAA 2ZE8A 4P4TA 1J90A 2AK3A 3VKWA 1CR4A 2PMKA 4RZUA 2Q9CA 1E2MA 1OPXA 4EPTA 2O0KA 2C99A 3MFYA 4YDSA 2IC5A 2IF2A 2ZRNA 1MKYA 2XEXA 5JEDA 3GJ3A 1GL7A 4RFSA 2QBYA 1NG1A 2AXPA 1M7BA 3EA5A 1Q1EA 3ADKA 1I4TD 5EUMA 1VCOA 4B73A 1DEKA 2ZAMA 1OFIA 3QKSB 4LBWA 3W6PA 5AUOB 1G18A 2QL6A 1XTQA 1NVUQ 3PITA 1JECA 2F1RA 4QXAA 5DHFA 2OZEA 2QSZA 4JT4A 2YKGA 1E2EA 1U9IC 2GXUA 2WWFA 2R2AA 3BK7A 2HF8A 5HPYB 3ADDA 4WA7A 3W34A 2ONKA 5DN6A 4PHHA 3QBVA 3T5DA 4IFBA 2WOOA 1P4SA 5FOXA 4NONA 2DYKA 1NLZA 3MSXA 2XTNA 4AWXA 2CXXA 3SBDA 1FMJA 1PZNA 2JLRA 3KKMA 4L8GA 2VP6A 3U44A 3TH5A 3NG1A 2WMOB 3Q5DA 4DRZA 5JEEA 1SVLA 4M22A 4ERNA 1S0UA 1ANKA 3GLFE 4OI4A 3T1OA 1W0KD 1E32A 1JNYA 2FPKA 4KHZA 1MO3A 3W8RA 1Q57A 1SVIA 1MV5A 3K0SA 1RYFA 5HTKA 5EXSA 2V1XA 4BZXA 1TEXA 2Q9AA 4HAVA 2R6GA 3O47A 3EZ6A 1XD8A 2D2EA 4PQFA 4URYR 3GLHE 4JLKA 3FKQA 2J9RA 4OJQA 4XTRA 4LHVA 4A8JB 3QQ5A 1GUAA 3MRSA 3W9YA 2IWRA 1KI3A 4JLMA 4JZKA 3QKSA 1P73A 3FOZA 2LKDA 4CEIA 1X86B 3GEEA 4W5HA 5L3QB 2WJGA 1KGDA 4P4SA 1GNQA 2MSEB 3OESA 3KKNA 3IQWA 2ZRIA 1TAGA 4LOAA 4TL6A 2QMHA 2ZEJA 5KNDA 5GADl 2XXAA 1KDOA 3GJ7A 1KI2A 3VNUA 4JKYA 1QG4A 1G9XA 3ND9A 4NBSA 3JVUA 1DAFA 2DBYA 3IPYA 5GVRA 4B3BA 2OFOA 5EXPA 2XTZA 3P1JA 2HV8A 3IQXA 1UEJA 1GITA 2JJ2A 3NIBA 1H8ED 3VHLB 4DCSA 2J3EA 4I99A 3GLGB 1ZM7A 2BEJA 2FZ4A 1M1YE 2I1VB 3B1YA 3FMOB 1DAHA 4JL5A 2VHQA 1SVKA 3GLHA 4PPFA 3ZQ6A 4KXFB 5DIFA 1G7TA 1S3SA 4A1FA 3EZ2A 4KCGA 2C8VA 3DKVA 4J0QA 3P27A 3U2QA 3WP0A 2C78A 1QHXA 2WAXA 3MD0A 4R7ZA 4M9QA 2G1JA 4C7OB 4A2PA 3KB2A 3RC3A 1DO2A 3AF2A 1H8HA 1W48A 5DN6D 5FTLA 3P20A 5K8LA 4CZ2A 3THWB 3H84A 1K8RA 3WYAA 1D2EA 3K0EA 4LV6A 2GETA 5JJKA 1ZU5A 2IYXA 4OYHA 3TK1A 3QVUA 1Z07A 1JI0A 3N2IA 4Q48A 4NH0A 1S1MA 2QUZA 2WOJA 3FGNA 1TF2A 3FPAA 3IEVA 1G5TA 2F6RA 1P72A 1NMYA 1E4VA 4B3CA 1QHSA 1DTSA 4XWAA 2QAGC 1G21E 4IDNA 4Q4HA 3FHTA 4WOPA 2HXSA 2A5GA 3W5JA 1XJ0A 1Z63A 1SXJA 1UKVY 2XNSA 3AV0B 2SHKA 2GJ8A 2OXRA 3THYB 5CYOA 3K70D 5IHPA 4DDUA 3GJ8A 2ODNA 2D2FA 2H16A 3QY0A 4BFWA 1CRQA 3LX8A 4RY2A 1N25A 2BDTA 1GAJA 2G88A 5IK2D 1YU9A 3ZD7A 1KI6B 2GF0A 4CYMA 1U9IA 3U6BA 1A2KC 2OFXA 1E3MA 1Z0IA 1AZSC 1KYIA 2WPDA 5DI3A 1UAAA 1VCMA 1EFRA 4L5BA 4F4CA 2KSQA 4QKQA 3EW9A 4URXR 2WKRA 2KI5A 2ZETA 3MWYW 3BRWD 1JXMA 1IN8A 1T0HB 2VP4A 1U0HC 5CIWA 2GVZC 4US0R 3TKLA 3DEFA 3SEAA 1E2QA 3UANA 2GK7A 1CRPA 3GFTA 4LBYA 3I92A 2WBLC 4DUGA 2WJJA 3KFXA 1N5LA 3QJYA 5BN5A 4BFUA 1ZIPA 4WIAA 2BJWA 3LO5A 2R65A 4BZPA 1CULC 1X6VA 3RAPR 3TMKA 3K9GA 1W2GA 1JR3D 3WMFA 2IYZA 2JAQA 4KO8A 1J99A 1KDPA 3B2EA 3UWOA 5FPKA 4M9XA 1X8JA 3PG5A 1QHNA 5FUWA 1PLKA 3PEWA 4PANA 4Z8XA 4QL3A 4MGYR 4P32A 4BEJA 2C96A 3HWSA 5JCZA 1KI6A 3MAAC 1CKEA 3T12A 5JRZA 4MDEA 1GRNA 3THOA 1O3YA 3OAAA 2LCFA 2FH5B 2HEIA 2AKYA 2PLRA 3QEJA 3RLFA 5DI3B 1ZM4A 2QMUA 3RS0A 2V3CC 1MO6A 1DAEA 4XSGA 2Z4RA 3ZIAD 4M0LA 1JAHA 2NO6A 4RD6A 1TX4B 4URVR 4MKIA 2Z0MA 4TLCA 2QE7D 4RKEA 3WRYC 4D6PA 1FL9A 5KUTA 4O0MA 4Q00A 3CR7A 3Q3JB 4BASA 2IX3A 1KK2A 4R2IA 2JLQA 1VMAA 1L2TA 4DLZA 2HYIC 2XOKD 4RZXA 1BOFA 5DH9A 3UMRA 1IHUA 5IRCD 4A8JC 4WZAE 4L9WA 5SZHB 4YMTA 4ZIRA 3GLIE 4TLEA 3KQUA 4GPTA 4ILEA 2P3SA 1GRRA 3ZDQA 4DKXA 3A4LA 4QHSA 4X8HA 2ZE7A 3Q8XB 4BECA 2HT1A 4UNSA 2FEOA 4BUJA 1ZAKA 1SHKA 2V7QD 3BE4A 2JATA 3LBIA 1KY3A 2ZI3A 2OAP1 1OB2A 1QHYA 3FMPB 5J4YA 3P26A 4L16A 2JDIA 3HDTA 1ZD1A 2BKEA 4Q47A 3HU3A 1XPUA 2QNRA 3MLEA 2C03A 1AS3A 1SKQA 5E7IA 3T15A 1B0UA 2ZI5A 4R2HA 1TQDA 1TEVA 3BH0A 2QI9C 2DWOA 2ZRLA 2P2LA 1U99A 4G5SA 3QF4A 3I5XA 2JCSA 4U02A 3B7GA 1BH2A 2GJKA 2VHUA 1W46A 1ESMA 1OXXK 2PEZA 3ADBA 3ZVRA 5IT5A 3KQLA 4V0NA 1GKYA 2VF8A 4ZDWA 2IUTA 2XGJA 4BZQA 3BB1A 2FA9A 4MRSA 1W0JD 3HPRA 3F0TA 1E9SA 1Q1QA 1RJ9A 4IXNA 3R9XA 4RJLA 4I4LA 1XB2A 1XCPA 3GJXC 3X2SA 2ZREA 4PQRA 3TSOA 1YE8A 2XNDD 3KJGA 4KI0A 1OHHD 2IUUA 2QTFA 3ASYA 5A5GA 2FEMA 2ZYTX 4FMBB 2ZJZA 2CL6X 1YRAA 4TTRA 1NSTA 2C77A 3F3YA 3WP1B 2QPTA 1BMFD 3UWKA 1OYWA 4LJ4A 1KMQA 2FE4A 2P67A 2FFBA 2I3BA 3CW2A 1IN7A 3VR1A 1N6HA 1IN6A 1KK1A 4ASUD 2E9SA 2WICA 4TZ6A 1VDZA 4WBSA 2QM7A 5F9FA 2GZAA 4BLRA 1WP9A 2ODEA 1COWA 2IWHA 1KHTA 1E1RD 2GILA 5IF9A 2ORIA 1KKLA 4NCNA 1KY2A 2ATVA 4F4IA 3EPHA 3QOFA 3PEYA 5HKKD 5A0FA 1BS1A 2EYUA 1P75A 3X1XA 1OKKA 1ZP6A 2N46A 1T5IA 2ZYWX 3D3QA 2VYFA 1IN4A 3TUJC 1U8YA 5BN4A 2EFGA 2V55B 3DVLA 1K5DA 4IVQA 4IRUB 5KDOA 4CEIB 4P4SB 1CJTC 2WTUA 3DPUA 3LRPA 2WSSA 2FPMA 3L82B 2ZSDA 3OE7D 3CM0A 1VYVA 4B71A 3DMDA 4Q7MB 5JI2E 1KZ7B 2O8BB 5KO2A 1NL3A 2GRJA 5C4MA 4RD3A 2G9NA 1DELA 2PT7A 4CGZA 2J46A 4W9MC 3L8ZA 2O8DA 4FD2A 1Q22A 2IL1A 3B85A 2QBYB 2MMGA 2WSMA 4F93B 2JLWA 4XD7A 2QEQA 4PZLA 4KFSA 2O8CB 2QTHA 4PAQA 4Q18A 4P3YA 4LK2A 4F4JA 4C30A 1KOFA 2QRZA 3OFND 2EFHB 2AR7A 4JL8A 2JIZA 3KQHA 3CF6R 1Z0AA 2Z83A 4DCVA 2JDID 3EC2A 4MRRA 1BYUA 4PSVA 4ITRC 1T9HA 5EP2A 2D62A 5TARA 3ZGXA 3RS5A 5AJWA 4NYIQ 1QHHA 1P9WA 4H1UA 3UKDA 3VKHA 3LW8A 1XJQA 5DSZA 1XD2A 4EQ6B 3FDIA 4E5UA 4C0LA 3N2EA 1FNNA 1TU3A 4RCZA 1XFAA 2VEDA 2NIPA 3BS4A 3E2IA 1HQYE 2O5VA 5FPTA 2J41A 2ZE5A 1XEXB 2PH1A 4QGHA 2EVWX 1II8A 3EC1A 1UJ2A 2XOKA 3EG5A 2PX3A 1KO8A 3AVYA 4I1SA 4B3DA 4DEYA 3AF1A 4Q4AB 1I4LD 1QHHB 2PCJA 3DZDA 2ZSFA 821PA 4PZYA 1X1SA 4AKIA 4RCYA 3U3OA 4ASUA 4C4PA 4C9BA 1FTSA 4Z1MA 1JQLB 2DY1A 1Y3AA 2IBMA 1Z29A 1ZYUA 1NKTA 1NF3A 3G5UA 4M4SA 2PT5A 5BYJA 4U5XA 1IBRA 1K6MA 4NYMR 3FYHA 3LY5A 1W2HA 2YC2C 2ZJAA 2AHOA 2C2HA 5C1BA 4ZV4A 5D3MA 4L4UA 3RS3A 3QXXA 4N0DA 1CIPA 3BH6A 4IVPA 3OEED 4WAUA 3EX7C 3MWKA 1OJLA 3C15C 3DOEA 4OK5A 2F1HA 2ORWA 4HZIA 3TW4A 4ZDKA 2VPPA 5L8VA 4HAWA 1A4RA 1E2HA 3QPWA 1CTQA 1MABB 2VHCA 2OLKA 4CEJA 2ODBA 2WPDD 3I73A 2PBRA 1UFQA 3EPKA 4A0RA 1NSFA 5DLQC 1HH4A 3SC3A 4DDTA 2V7QA 5CM9C 1YR6A 1OXTA 4FCWA 4GSYA 5IK2A 2GDJA 2E1RA 4C0SA 4EKDA 3K09A 4NCJA 1Z2CA 2CL0X 1XTJA 3ZH9B 4YMSA 5C4GB 3AUYA 2YZ2A 1F3OA 1N6LA 1FOEB 3BB3A 3ETLA 3L8YA 4AK9A 1WRBA 2FOLA 2VIIA 4BFTA 1G20E 4US1R 2UVQA 3QKUA 3V00A 3K70C 5F3WB 1W36C 3NBZC 3RS2A 3TVTA 4RD4A 2ZU0C 5EE3A 4PPGA 4DT1A 4FN5A 1OF1A 4MUAA 4S2EA 2HLDD 5FOUA 2BCGY 4UKDA 1CF4A 4ON9A 1U2RA 4XSHA 4TYNA 1CLUA 1ZUNB 1MRNA 4MGKR 2J7PA 3I3SR 4ZCIA 2DPXA 2XJ4A 3OIUA 4LJAA 4PAMA 3FE2A 2FSHA 4NU0A 5E7JA 2X8AA 4EPXA 3GLIB 4B3GA 4DC9A 1Z6XA 1F60A 1XMVA 4DIEA 1JJVA 3SU8A 3THXB 1E2FA 3EAQA 3CNNA 2G0TA 3WHKA 1KO1A 4D4MA 3QNUA 3TBKA 1PV4A 4O3MA 1NP6A 4WVFA 2REXB 3M1IA 1KSHA 3HPQA 3SYKA 2W0MA 5FUVA 3ZZUA 2RGXA 3AP2A 3CRRA 4TSFA 5CDFE 3T61A 4QGGA 2GESA 4GFDA 2O0JA 2W2TA 5SZJA 1XZQA 3AF3A 2ZUCA 3WMEA 1G5RA 2ZI7A 5J47A 1XMJA 1U8ZA 3NC0C 4D0LB 1TF7A 3AGQA 1DARA 4UJ5A 1DAIA 3QE0A 1QVRA 3AKCA 3EWSA 1E2IA 3CUEF 4WXPA 3N5CA 2QROA 1CBUA 4Q1AA 2NPFA 1VG1A 1KJZA 1EFRD 4ACBA 5LB4A 1E94E 4MYTA 4GOJA 4AG5A 2J59A 1JPJA 3AVXA 1HT2E 4JLPA 1JJ7A 2HDNB 3L0PA 3SHWA 1RJ9B 5EUQB 1ESNA 4Q9IA 2RCNA 1XDBA 2W0SA 3M4YA 4RKFA 2EW1A 4D26A 2REBA 4NMMA 4LJ8A 1OFTA 5G3YA 2ERYA 4Z54A 2BMDA 2H18A 2O8EA 3CWZA 1FQJA 5KSZA 3FKSA 5G3ZA 4B74A 4JLVA 2F3RA 3NC1C 5AJXA 1ONBA 3K70B 2L0XA 1AN0A 1W36B 4LPSA 5BN3A 2YOHA 4EJSB 2BEKA 1VG8A 4GP7A 5EXTA 1ZC4A 3KKQA 2NO9A 1US8A 2P65A 1H8HD 1WF3A 2IS1A 5JCPA 1AKEA 1E1QA 3H1TA 4JT2A 5M04A 1EFHA 1YZTA 3K1JA 1A5TA 5P21A 1SVOA 3OAAD 3WRXC 1YQTA 1FPMA 1H65A 3B82A 4UNQA 2J1LA 5K8IA 2Z4SA 4KFRA 1V5WA 3K0AB 1Z6TA 3Q72A 3VX4A 1PVOA 2ZJYA 1P2VA 521PA 1YZKA 3O8DA 5LPNA 4CEHA 2DFNA 1E9BA 2OCYC 3LDAA 5J4KA 3L2OB 2G83A 1CJVC 2AK2A 3ZVLA 2F55A 4I1VA 1T3SA 1W4RA 1R0ZA 2BBSA 4WZBE 3MWJA 4RZ3A 1KAGA 721PA 2GCOA 4OQFA 2PJRA 4WZ6A 3B8HA 4G3XA 3GMTA 5SZIA 5FPYA 1XEFA 3GJ4A 4TL9A 3IO5A 2G77B 4BFZA 2CLSA 2OBLA 1KO7A 3REFA 1G7CA 1KSJA 2A78A 3GFOA 4GOXA 5KPJA 1FX0A 3LXXA 4FMDB 4Q66C 3WYGA 5JRJA 2R6AA 4PPQA 5LDDC 1EK0A 4XH9B 3KZ1E 1P2SA 1Z0FA 2EQBA 3A36A 4NPHA 2BBWA 2XZLA 3NDPA 1AKYA 1OLOA 4M1OA 4D82A 2CLDX 4GT1A 1MH1A 4DJTA 3SOPA 2H8KA 3VX3A 1RRFA 4NYIR 4C2UA 2EFEB 1IQPA 2GVDC 4ACAA 4NL4H 4IVRA 4LY6A 4QRHA 2OG2A 2C9OA 1DG3A 4KBGA 4Q7KA 3ND8A 1X3SA 1F48A 4HI0E 1VECA 4RSGA 2BM0A 1N3BA 2TMKA 4D4LA 2YWGA 2Q0HA 4G5GA 4AKEA 1WBBA 3RS7A 1SXJE 2ZM5A 2RGAA 2GAAA 2ZJBA 2IW3A 4YLGA 2IS4A 4LRWA 5EE5B 1FNMA 1TQ4A 2C04A 3ADCA 1OYYA 2W6IA 1ZM2A 2PEYA 4PXAA 2CJWB 1DE0A 4PC1A 2IXGA 2Q3FA 2HJVA 1R10A 3QKRA 3OE7A 4YQFA 2D7DA 1NVXQ 4XVRA 1LV7A 2IUSA 2VF7A 4M53A 1EGAA 4Q4JA 4O25A 3LBNA 3ICQB 1J70A 4MKGA 4PFSA 2GTPA 5L3SA 1JB1A 1UF9A 3WNBA 1Q12A 2O8EB 2XB2A 3TVDA 3P32A 1RPZA 1NNEA 1ZD9A 2QT1A 1P7CA 2BCJQ 5LB2A 4ZKEA 4DIDA 3PJRA 4Q7LA 5FTMA 1XEWX 2KE5A 3LXRA 4IOLA 4YXWD 3EA0A 4QNMA 3KFVA 3ZYCA 2FSFA 5HZHA 5TDHA 4B48A 1KO4A 4B2LA 1R6BX 2DWQA 4N0EA 1NLFA 2QU8A 5CYPA 1Z8FA 4H9GA 1Z06A 2ZE6A 4CW7A 5FL7D 2MMCA 5F98A 4Q1DA 4QJ5A 2QPAA 1G8FA 3T1TA 1VYUA 1F2TA 3ZJYA 3C16C 2ZSBA 4ZPXA 2GEUA 4D81A 3U7GA 1KK0A 3Q7PA 1BKDR 2GCOB 3ASZA 1IJFA 1RVDA 3JZMA 1HT1E 5UKDA 1AA9A 2RHDA 3CX7A 4ARZA 1OIVA 2X2EA 1TNDA 3GEIA 4OHVA 2AL7A 2GBLA 5JMTA 4Q19A 4TMWA 4DLYA 2C98A 3A1WA 2HYDA 1II8B 4LC0A 3I5YA 3O8RA 3U60B 3IIJA 2OEPA 4YONB 4W5JA 3U3RA 1S1CA 3VMFA 2Q9BA 2VSFA 4Q1FA 4V0LA 5TY0A 1GDDA 3V4RA 5DISB 2JIZD 5FBQB 4B33A 3UATA 3NKVA 5DI9A 3MGCA 2ZI9A 1UADA 4FINA 2A7QA 1KSGA 5JSZB 3TJZA 5CK5A 4OK6A 3C5CA 1E2JA 4OQNA 2RGEA 2IT1A 5KNCA 2R6DA 3GLIA 3KUCA 5KTYA 1DS6A 1QHGA 1R0XA 1Z6GA 3M6AA 1R8SA 2BBTA 2ZUBA 3CZQA 3QXHA 3X1WA 3U4QB 1SHZA 2OE2A 4V0OA 4EAQA 4IXMA 2IEYA 2XSZA 5FBRB 4MRPA 3THXA 1P6XA 1TPZA 2ZRDA 4GI7A 4AI6A 3C14C 3FFBA 3TUIC
chains in the Genus database with same CATH superfamily
1U7OA 3BG5A 3O31A 4ID3A 3SXPA 1KKMA 1WUIS 3G85A 4HQRA 2RGNC 3K0CC 1C7FA 1FP2A 1QYVA 1SY7A 3I8XA 3R44A 1GGKA 4DIFA 5LZ2A 2XZOA 2JGDB 2AFHA 4PEVA 1HFKA 3I2IA 2GAFA 1U5BA 4RC9A 4WJZA 4YAFA 5DTMA 3O3CA 1GSIA 1ZVJA 5TQJA 2WINI 1DZ3A 1G0OA 1GVHA 2QX9A 2X5OA 2YQZA 2YDYA 1F4PA 3PC6A 1EQUA 4UBMA 2P1DA 4Q21A 4JOQA 4F5ZA 5FTKA 2GPYA 3HR4A 4FS8A 1JDUA 5CPBA 5LYJA 1SKYE 3GJ0A 3WBJA 3Q8WA 4HS4A 3REQB 1AX9A 4A16A 5FOTA 5GAJA 3ZW7A 3OCVA 3FVQA 1PFQA 3TTVA 4B31A 4QZVA 2Q7DA 1UKYA 1NV8A 4YRGA 2QGNA 1KZ6A 2OV1A 4QM7A 2EL7A 3HRHA 5KU7A 3B48A 5HQTA 4BQSA 2REOA 2CVQA 3H0CA 5CT9A 2YX1A 3AXSA 5DCLA 1KJQA 3G02A 2MTBA 3OQVA 4PQEA 1H0RA 4B47A 1LVUA 1QUEA 2PRKA 4UBNA 4F2PA 3FHCB 3MXTA 5DHAA 2FMUA 1KFJB 4XQ9A 2XWJI 3EARA 3EFBA 3IBGA 2IITA 5BSFA 2UAGA 4RV4A 4R8LA 3H9QA 1YS1X 3N8HA 2CHGA 2RONA 3WGIA 1R0LA 4OGWA 5DK6A 4NDNE 2AUNA 2WKQA 3E5HA 3OCZA 4UUNA 1H0KA 4NENB 4O4HF 3U39A 5H8WA 1JAYA 4V0ME 3WFJA 4C89A 4F2GA 5TGTA 1MAAA 1Y3BE 1I2CA 2HU2A 3T52A 1YFLA 2CE7A 1P0FA 2P77A 3EPRA 1I1QB 4D7AA 1EB9A 5M5BA 4QGAA 2KM1A 4MS1A 1RR6A 2Y0EA 1LPNA 4WBNA 5JDCC 1SBHA 2FRXA 3L6CA 4G2NA 9ATCA 3OD5A 5J2UB 4JX8A 3SDBA 3KCNA 3BGIA 1RJWA 3M5DA 4RTLA 7AT1A 1LFAA 4PG6A 3UV3A 1T29A 4Z4CA 1ELOA 3TIFA 1A9OA 1TLLA 4M38A 4P3NA 1ZWLA 3KTFA 4C14A 4FZRA 3OLVA 1ZUIA 1A7KA 3CLUD 3KWLA 4OQMA 1JH9A 5H80A 1RWMA 4NI5A 4G5YA 4NYMQ 4J2OA 1C7QA 1T2VA 3LD9A 2L82A 1V5IA 2ENWA 2VHJA 1NIPA 3WWZA 4D43A 3EOZA 1RT9A 5BR1A 1F8UA 1M6VA 5IASA 3VKFA 3ECSA 2JLZA 2IXAA 1AE1A 4G9GA 3SHQA 1XXLA 1Y81A 2ADMA 3D4OA 1DL5A 3E82A 3GNTA 3LGXA 4O33A 4GSLA 4PFKA 5IBRA 3S5JA 3ZTTA 5AIBA 1HQCA 1OT5A 2H6EA 2QP3A 5JASA 2Z6UA 1JXAA 3W90A 2JF0A 1D6JA 1SKYB 4EQ6A 3K6KA 3PHGA 3PXAA 4F5YA 5BWMA 3C41J 3EWIA 2WIAA 1KR5A 2WZQA 3AM3A 4Q9DA 1PNTA 3E9MA 2CUNA 1JWBB 2NZXA 3HFJA 5ESDA 3E6AA 5K51A 3X44A 2XODA 3QW2A 4FMCF 2FPLA 4FXPA 3ZWWA 4KAJA 1A7UA 4G5XA 3NTUA 4S12A 3E4CA 2GD1O 4K6HA 3L1KA 4V1CA 1SGWA 1VSBA 2F3TA 3E7WA 2QM3A 3HV0A 3ICVA 4R0NA 5KSYA 5DYWA 1SIBE 1V9SA 2PSHA 4QTZA 3PP8A 4RHYA 1PWYE 2JL1A 1UINA 3G2KA 1C7ZA 1LLUA 2A33A 2VZ9A 2EDCA 4OJYA 5AOAA 4ZZ2A 4OAOA 3UJHA 1ZKMA 1WW2A 1W52X 3OLYA 5LZ8A 1HE1C 3SX4A 3JX9A 1PS9A 1G98A 2AT1A 5C35A 1IY9A 3A7DA 3MTAA 1CS0A 4L0MA 1A76A 3ZHZA 1GPJA 3GNQA 4FBGA 4DMMA 4R4JA 1PJRA 1C9MA 3FZYA 3OIDA 1S2NA 2RBEA 5DHSA 3PPVA 3QLUA 1TVKA 1W44A 4LXUA 3ZW8A 2HIHA 1JEDA 1AH2A 3RFCA 1H2YA 1UWCA 1IHPA 4RSRA 5ALKA 1C7RA 5IK2D 2DQ4A 1T2AA 3IV9A 3UJBA 1CDDA 3I9NA 4GVLA 3L4EA 4TYMA 1O58A 1UPUA 2YMLA 1PE0A 4D3XA 3AERA 4OIFA 2B8WA 3Q7QA 4YRZA 3DV0A 5K3BA 5ICEA 4E4YA 3EA4A 3MZ0A 4QGSA 1XPOA 3ZD6A 1GPDG 1A2BA 2CHVA 1DX9A 1OTXA 3R76A 4XIYA 2NGRA 2HRCA 4ETWA 4RVNA 5IULC 1QIKA 2B8TA 3V4VB 4B4KA 2ZYIA 5L6LB 2YJZA 1TTHA 4UVEA 3DE2X 2YZGA 4F1JA 4LYFA 4ZJPA 1E0AA 1NXXA 1KYTA 2P3QA 2O06A 2UUOA 2ZKIA 2VEOA 3LECA 1Q15A 1YIOA 2OVBA 3I9V1 4RMIA 5K0NA 5B3KA 1EVKA 3GFGA 3NYRA 3AF4A 1RAFA 5CVJA 2I1QA 3VU9A 5BPFA 2O20A 3I6YA 1GZSA 3LLUA 5L7TA 4WADA 5TF0A 2VPQA 3GFFA 1MFZA 3GIDA 3R3JA 4HDRA 1J0AA 1TXGA 1JQAA 3WYEA 4OMDA 1FBNA 1XEWY 2IXDA 2PBFA 3B1ZA 3IBTA 4KN8A 4G0NA 4BRSA 2UUCB 1KQOA 3HKCA 3LOPA 2ZR0A 3RBVA 3TZEA 1GV0A 2R4UA 3UG6A 5DNCA 1HWYA 1KI4A 2FSUA 5B58C 1RRVA 1L7XA 2GHTA 4YDHB 5EEHA 2FAXA 3DVAB 4ZYZA 3F6YA 3ZWQA 4FDLA 4F91B 3VHQA 3BJZA 4X65B 3SQLA 3F97A 3PWTA 4JBWA 3L0SA 4JS0A 2FLKA 2RGBA 3JZAA 3ER6A 1RHQA 3X1MA 2ZYUX 4YCMA 4OO3A 2QP9X 3WK4A 2PQ0A 5BOVA 4A6PA 5I9IA 5LLTA 2AS0A 1ADBA 3HB1A 1T10A 4G8CA 1GOTA 1VRCA 3E8SA 4LWPA 1GG8A 2AEJA 1EFAA 4P86A 1NFFA 2X0JA 3FFAA 3PT5A 2EP7A 2ZYVX 2V45A 4F5WA 1XAJA 4HUQB 4J0GA 1KRHA 3SIPA 1VI5A 2D2IA 2K87A 4RHTA 3RB8A 3SFTA 4JLOA 4NNJA 2XUAA 4DQXA 1VDMA 4F11A 3RBAA 1VKRA 1QH0A 5JNLA 1PL7A 1U2QA 3G5TA 4L22A 4B8YA 3H8SA 2P9ZA 3A3NA 3W8NA 2ARKA 2GN2A 1IH8A 3KOUA 5G0WA 2ZOSA 3I4LA 3F5MA 2X0IA 2XQVA 2CB9A 5F2KA 1PGNA 2A4MA 3MILA 2VSQA 4MSUA 3IT0A 4QOSA 4NRDA 4CL3A 2IYNA 4JP1A 3U37A 3QLVC 4E4TA 2J87A 4CMGA 3F73A 1CF9A 3L7LA 2P75A 3HL0A 3WGTA 1L5FA 2DBZA 1VLVA 2ORVA 3NUQA 4MR7A 1GNTA 2Q21A 1AVTA 4JCOA 1E6CA 1FE8A 5FWDA 1NX9A 3AIKA 4CVNA 1X1CA 2AD1A 4RV9A 4LG1A 1M2KA 3TZCA 3NWJA 1A9ZA 3HDGA 4GGMX 3WLSA 1V6AA 4I19A 1RWNA 4OCZA 2H3EA 4DA0A 4CQLA 5C53B 3HKEA 3W2TA 4BFCA 5CDFA 3H2SA 1TB4A 5D3QA 4DUZB 1CY8A 2WZCA 1NW6A 1PJLA 5REQB 2OT3B 3UMYA 4REQA 1DC5A 5E0OA 1UMBB 1QUFA 2QN2A 3AHIA 4J43A 1TOAA 1SD1A 5ETJA 1F51E 3ZDRA 4IJ6A 1F17A 3QV2A 4DEXA 3EJWA 2IU4A 3D2CA 2W2KA 3KRTA 4FBLA 2FN4A 5JLAA 3OA0A 3HGQA 3P4YA 4UBOA 3TRDA 2B35A 5HR5A 5B57C 2A0XA 2OUKA 3IELA 1ONOA 4C3VA 3WHPA 2I3GA 1YMUA 4RVSA 4LZWA 5D3ZA 2Y4OA 3TOVA 2O8CA 2D1YA 3IPAA 4RNDB 3WNCA 4DABA 1B0AA 5FOVA 5BNTA 4PTLA 3CLHA 4U7FA 4RXMA 4AF6A 3M5PA 3OMWA 1FLAA 2SCUA 2ID7A 3PNSA 1M8PA 2B21A 4U3JA 4AKGA 5DO9A 3AY0A 3RYHA 1ZCAA 4RHFA 2CMHA 3UTDA 3N70A 5HKBA 4P31A 1ZFNA 1VRWA 5M2QA 1RI1A 3ZI4A 2HFKA 4CV3A 1EP1B 3R3ZA 2VJLA 4BBAA 2ISCA 5ABPA 1ST3A 1NY5A 4G0ZA 3RC8A 1GPLA 2AZ4A 3V8NA 1I6LA 4QLAA 1YQXA 1LBHA 2JLSA 3RYIB 4DDMA 5BV0A 4JN6B 1N2GA 1Z5UA 1XN4A 3M82A 4NF2A 3UW1A 3AOEA 4UZEA 3OPVA 4IDEA 1SKMA 4E94A 1KEEB 1Q19A 2UXCB 3N58A 2AG8A 4KTVE 4MAMA 2QW8A 2JK1A 2XVYA 4PYMA 3V6MA 3IALA 2XMBA 1SPXA 2ODPA 3V42A 3EFOA 3OWOA 4M8KA 4YCLA 1P9NA 4DBVO 4DWOA 4P0QB 3EW7A 1H1DA 2VJYA 1MGPA 2IY7A 3FMGA 1PL0A 4HX5A 2QWXA 5JH7A 5ESXA 3ZE0B 4OATA 4P33A 1I13A 1XZJA 4WPGA 4KBFA 5K0TA 3ANTA 4IIFA 4OHCA 4URUR 4A92A 1I6WA 1SG0A 4IS3A 4LS3A 4XFJA 5E6SB 1NA5A 3JWEA 4Q3DA 4YCDA 5C1PA 1I4WA 4FKZA 4G36A 4RSMA 3VPFA 3SI7A 3T5MA 5JZVA 2HUNA 2YY5A 2ZRCA 1J09A 3ITEA 3PDCA 2NT3A 3LY9A 4KXMA 4ZOLF 5JO9A 4BIIA 3AVUA 4P7BA 4BWYA 5BNWA 3ZS9A 2YVKA 2AKAB 4CDRA 3L4JA 5EUBA 4JR1A 5B6PA 1CFZA 2J5XA 4D6YA 1ZC3A 1W19A 4QWMA 4MA0A 5KWEA 2MYNA 1XXHB 1P0PA 1A5ZA 3EVEA 3SS8A 4DJ5X 5KQPA 4KIUA 1RJEA 4ZVQA 2XDAA 1B6SA 4O8CA 1B0PA 1B26A 3N3AC 4WTOA 1QGUB 5JAOA 1Z6AA 3PVSA 5EE9A 4CM5A 4GMHA 3CF4A 4L28A 5JS8A 1XP5A 4BWVA 5CFOA 3HYTA 5J5CA 4KPFC 1MJFA 2OC4A 1A82A 3SF0A 3I5AA 1XX6A 1U1DA 5JNUA 1I7LA 4PGGA 1BYIA 4ER5A 3GD7A 3BD9A 5A5EA 1XNHA 1ZINA 1OXBB 1KQ3A 3H0KA 4N76A 1XTPA 2CDNA 3NETA 3H5RA 1HSZA 2XUJA 3NI2A 4DQKA 3UBTA 4LOJA 1XTKA 3FMIA 4RY8A 1ZRHA 3GHYA 3Q6MA 4D99A 1E9AA 1GPYA 3JCZA 4IKEA 4D5EA 1YR9A 4HF7A 1SC1A 5HF9A 2Z95A 4WOKA 5CT8A 4CM4B 5A6SA 2RHGB 1C2YA 2QUBA 2FV8A 5KC9A 2N42A 1ZU4A 5JJLA 4R0VA 4L07A 2GASA 4MZDA 4PLCA 4JI1B 4BE7B 2WG1A 3LTNC 4LVOA 3ECAA 4DG9A 4G63A 2QLTA 2VK2A 1O7JA 3Q9LA 5E6UB 3GLVA 5DRYA 3G9ZA 5JAZA 4JLNA 2E82A 3FW1A 2Z43A 4NV1A 1ENOA 2DRIA 3H65A 4D42A 2Q5IA 1L6IA 1V3QE 2V0NA 3D6FA 4RMHA 4QVIA 5EXXA 3HN6A 5JD6A 1GUYA 2G5CA 2QOEA 4I1UA 3WNDA 2IYFA 1UXHA 3OY7A 1Y4ZA 2W6JA 2X58A 3AB8A 3K35A 4G0MA 5DYIA 3RS8A 4CMBA 1MX3A 2CUTA 2YHSA 2QV0A 3TGPA 5JUWA 2FYTA 3WL8A 4DHEA 2GYWA 2P69A 1BX1A 1MX5A 1NBMD 1DJNA 2XNHA 2QZSA 1UJ5A 4PNEA 3GR6A 5E6UA 1AO3A 1XU4A 5EVCA 5IT9A 2AX3A 2AF4C 1PX0A 5T41A 3GA7A 2FP4B 3VR6A 1PTJA 2Z6QA 2JGNA 4LXTA 4JVNA 1QB8A 3KQMA 4KR2A 1FFYA 2G72A 2A2ZA 4D9IA 3ZV6A 1YJ8A 2MHCA 1GL6A 1BN6A 2IHBA 4YPVA 2ZR7A 2H57A 3L0IB 4JR2A 4RL4A 4LWOA 4ND7A 1OBVA 3OM1A 1OGYA 1C9DB 3E0XA 3H8JA 5CFRA 5IJ0A 3FDJA 1SOUA 1PV1A 3M6XA 4YCBA 4EFMA 5JROA 1H5NA 4YROA 1Z36A 1N0WA 4RS3A 2APJA 5JI3E 2F67A 3TUZC 1K89A 2B6NA 3PTLA 3SXUA 4X45A 4RM3A 3IB3A 4PRKA 1XTBA 1J49A 1FFDA 5EE0A 2GA8A 4D8TA 3QUSA 4RVCA 1YH3A 2OHOA 4UDYX 3I2KA 4EYSA 5AW7A 4B2YA 2FDCA 5AHWA 3ZE7A 3LPAA 4RUKA 1TM3E 1PBNA 2C2ZA 1ZVQA 3G1TA 4MQMA 1U1GA 4I7EA 1DBSA 4MKXA 4Q4DA 2NMVA 4TL8A 3RUPA 3IKVA 4TLBA 4YCCA 1KOGA 2GJ9A 5K09A 1C41A 1NLYA 3BWDD 4OMUA 5FWNA 2OSBA 1OGJA 3E9QA 4M49A 3TFWA 2AOTB 3A7EA 1MT3A 4N9WA 3ZE2B 4CV2A 3WMWA 1G42A 5IKPA 1FJXA 3UMVA 1GTSA 1ZITA 1SBTA 2EJWA 3PQ2A 4DIBA 2D1FA 4PZ0A 4DLLA 2O4UX 4JL6A 4TXMA 1CQPA 3C1TA 2FK8A 4MEBA 1T1IA 5JDCA 5EQJB 3H3JA 2HF9A 4YPOA 4KR7A 3GCGA 1G6HA 1KNQA 1RP1A 2YJ6A 3B1WA 3N1UA 3O1JC 4MTCA 4CLHA 4IDHA 1LVGA 2DECA 3D7RA 2WVJA 3NAMA 4MWBA 2QVGA 4D02A 2C7RA 3LVRE 1PJ3A 4C0WA 3FAKA 2DT8A 5AW5A 3RVOA 3HNOA 3WGJA 5B53A 1JE0A 1HOXA 3IS3A 3ZHOA 2XDQA 2OBFA 1MAHA 5KTOA 1V7ZA 1YACA 1YZGA 2EEZA 4WDQA 5AKLA 5G4LA 3C48A 4R83A 5JYDA 1DJMA 3U19A 1CJBA 3EXEA 1MRZA 1UIRA 3IXQA 4V03A 3LAWA 3SYLA 2O0HA 3LL7A 1PKXA 3BF7A 3LX5A 3LUCA 4MWSA 4DGSA 3LPCA 5D3MB 2JLBA 2WIDA 5IBCA 2X3UA 1XL1A 4GKJB 4MYSA 3FPEA 5SZKB 4PTYA 3TNLA 1OCEA 3CMCO 1O57A 3L0OA 1UDBA 4ESEA 1FUIA 3I6IA 4E09A 4YMVA 4MRAA 4W82A 2BFCB 4PHGA 4N6OA 3HJGA 2W48A 1S8AA 5AM1A 1HQDA 2G8NA 1DLJA 4P34A 5AW6A 3FZGA 3SFVA 4RZSA 3C3MA 1WVMA 4OI0A 1LDGA 3TRFA 2YIDA 1R5BA 3UHOA 4YJ3A 1EX1A 1D2NA 5JWRA 3VAZA 5L3SB 3C3XA 2XMDA 4MUBA 3TR6A 2R00C 1Z2DA 4HVCA 1RACA 4GL4A 3KNZA 3EVDA 1S3IA 2TSYB 3MWEB 4HS9A 1YJAA 4L8YA 3RV4A 2EBFX 2JEOA 2ZRHA 4J0CA 3G8YA 1UBKS 3C4QA 16PKA 4YRSA 2ON6A 3EVAA 4HFRA 2JBHA 1Y4AE 3IUQA 1CG6A 3LM8A 4HTFA 4M54A 4NDAA 3OG9A 4IIDA 1KERA 1XXHA 1J1UA 4F5DA 2QSJA 1NN3A 3ESYA 2IGBA 1BXGA 2PGAA 2YZKA 2PRJA 2BM1A 3HI4A 2CKDA 4WK4B 3ODGA 1GADO 1H2EA 3C6QA 3VGJA 2UYQA 1KNXA 1NVVR 1JLLB 1Z8DA 1YKGA 4B6PA 1Y63A 3HJNA 4C7XA 1O95A 1JVNA 3NP7A 2BKUA 4L1KA 4CTOA 1AHHA 3IQZA 1J07A 4WZBB 4CLEA 5IJ9A 2HNBA 5JATA 4NP6A 2XOXA 4HEJA 3JASA 4NFSA 1XZBA 1JSLA 4ZU1X 2FQ1A 3RHTA 3AF0A 3CCFA 3G9QA 4DLTA 2WSSD 5E2IA 4YP6A 1FXWA 3LKDA 4IIXA 1H2FA 2HEGA 3FZQA 3ZJ5A 2ZJ8A 3R7AA 1UFRA 3OIYA 2W6JD 3SJZA 3ESXA 2JFZA 3R6WA 4DARA 4DV5B 3LIIA 3WGOA 4A23A 4OHOA 2G7ZA 3TB4A 4M2LA 1FK8A 1QQTA 2RHRA 3CX8A 3FOCA 3L7IA 4EUFA 2DHQA 2W2OA 1VIYA 5EFZA 1NBME 4JJ8A 5ES4B 4HB3A 2BUBA 3GJTA 2LDBA 4GRDA 1M5TA 5H70A 2BE9A 1ECPA 1OBHA 2I76A 3NC4A 4XVUA 5ENVA 3ZBUA 1X80B 4YASA 2Q2NA 3W5IA 1OHHA 4KE7A 3SN6A 3KQNA 3STTA 1KBZA 1R3UA 1OH6A 1RQPA 1ZOOA 2DPLA 3RCBA 2YFYA 2YVUA 2SICE 2VL7A 3N2LA 1JLRA 4HVTA 5KYYB 2NVUA 1ES9A 1PIWA 4UASA 1IVSA 5FA6A 5FIUA 2VAMA 1UC8A 4YXFA 3LP6A 5FBVB 5CDYA 3F6PA 4KV9A 5LU9A 1G8HA 1RXVA 1G7RA 2VAWA 3FNEA 3ZK9A 2Q07A 1YB7A 1DTWA 1VOTA 2VWQA 3DV9A 5ARBA 3GLGE 1E4YA 4WCVA 1OAKA 3RAGA 1DC4A 4C4YA 4I5DA 1Z4PX 4DNPA 4NZYA 5DIZA 2CXPA 1W85B 2GI4A 4NCIA 3WRYA 1XYVA 1MENA 3T4PA 5EP3A 3DLHA 3HJFA 1F8XA 4KQ2A 1X8LA 2VN8A 2D7JA 1GL9B 3A9WA 4MR9B 4D0RA 1L4LA 2QTVA 2J0VA 4G86A 2A8YA 1SCKA 4F92B 3T9CA 4OBXA 3G0HA 1T24A 4PXSA 5G02A 1OIXA 4XQ0A 3G6KA 2YHIA 3MS7A 2XRFA 3MF4A 1Z7WA 2VATA 3D6JA 1SQ5A 3TMYA 1UDCA 4K6KA 4EG0A 1YOVB 2IODA 3CINA 4JYMA 4IIJA 5SYAA 2R2GA 4FE4A 2AIRA 4LXQA 2VDQB 3UIEA 1HNZB 1MA3A 1M83A 1V47A 3GEBA 3K8OE 3I2YX 4O1MA 3ETCA 1S96A 5AXBA 1RHRA 1TCBA 1QH1B 3CH6A 4H0NA 1ECFA 3QG1A 3EYAA 4GZ5A 1ZW6A 4I1YA 1ZIDA 3QW4B 4WY8A 5A71A 7REQB 4A3SA 3QE2A 1YHNA 3RG8A 1TW2A 4B4DA 4AX4A 1OH8A 4Q7EA 4EL0A 2BLLA 1KMHA 2L18A 4YP7A 4YRDA 3A25A 4AAYA 5KQSA 2IZ5A 1GFZA 2AR0A 5KVQA 2ZB3A 5JHHB 4Y8VA 2WJVA 3LYUA 4MW6A 2ZJ7A 5DP2A 4G1UC 1QYWA 1B8PA 1MG0A 2XYQA 5C8YB 2I7XA 3RFXA 1O9GA 2FMIA 2XUZA 3PFGA 3GCXA 1M0SA 1VM6A 2Z8YA 3PFHA 3U4GA 4F1WA 4R71A 1XZDA 4KNYA 3ROQA 1S4MA 3UJ3X 2QTVB 4L75A 4UE6A 1SQFA 4L50A 4J16C 4RF3A 3C4JA 4FK8A 1TQ6A 5ELMA 4D41A 3AVVA 1S9DA 3AEZA 3JQRA 1CQIB 1U6KA 4GOLD 3WY9A 1QRAA 4E1BA 2HDOA 2FVXA 2XNDA 1Q1AA 4RWEA 1CHNA 5JDIC 4N5NA 1U2GA 1N2ZA 3ICWA 3BQNB 1UBMS 5FV4A 3O4HA 1FTNA 2P9TA 3QYPA 1ECJA 4DGQA 1ZGJA 1N1MA 4MW1A 3K8YA 1TK3A 2PAFA 2ZPUA 4NCAA 1LS6A 1TMGE 2F43A 5KYTA 5IN5A 1B41A 5M7EA 2IS6A 2QVYX 2UZIR 3EH2A 1XZNA 1X1RA 4ALLA 1F9EA 1GXSA 4PLYA 2NVUB 3GL9A 3DMGA 2WHQA 4J0FA 3B53X 3LVQE 2AFIA 2WJWA 4O63O 3STYA 3A37A 4AURA 3S7TA 1E1QD 2JA1A 3CR8A 3NHUA 4BL5A 3GJZA 2C3MA 2NO0A 4IV8A 2O3TA 1WA5A 1YK1A 2AVDA 2QENA 2UVPB 5CLIA 4AUMA 2QK4A 3GZNA 3S1AA 4HUJA 3NQ41 2YYSA 3KHSA 3KWMA 1Y1KE 2HTFA 2Y0DA 3U6KA 4ZCMA 1RWOA 2FP3A 3FWYA 3UG7A 1AQNA 3AILA 5EIAA 2XQKA 4RLFA 1GAQA 1S9HA 1UKBA 2YRXA 4J3NA 2QRUA 3I72A 1JBKA 5CEJA 1QLJA 3KOWA 3KTAA 4CRWB 2I9PA 2ISSD 3WS7A 1ISSA 1U3CA 3KVNA 4OHFA 3OUTA 3BMQA 1GN8A 1NULA 2JLAA 5A5FA 1LI7A 2W90A 1ABFA 2QPOA 3PA8A 2V3WA 4IIBA 3UPTA 2W93A 1DWUA 1PV2A 1RXCA 2HMYB 3HGTA 3MIZA 4EL5A 2Q6OA 4KPEC 1L5KA 1LS1A 5BW4A 1HZZA 4DB4A 1OI4A 1EJ6A 1TRKA 3R3UA 3BRCA 5U4QA 3JTEA 2QHXA 2XJ9A 2Q3EA 3FYCA 3H9CA 3QKRB 4K3UA 4XPZA 2ET6A 1KEKA 4OX9B 1VJRA 2OK7A 4N5IX 1O87A 2QN8A 1QFJA 1YI1A 3FOWA 2DFLA 2YJ5A 3PXGA 3CG4A 1CY6A 4O2AF 3UAGA 9ABPA 3CURA 1BOOA 4CN8A 2KB0A 4XX1A 1GG9A 2QRHA 3SSOA 3ERCA 3WLQA 5TS3A 1D0VA 2ZR9A 4IEIA 3U3MA 1T35A 1ZM9A 3FUTA 4UAUA 2F2TA 3HEBA 2YRFA 4LOKA 2JFQA 3QU4A 3T94A 4TZ0A 2YV3A 4LCBA 5AKGA 5TB5A 1KZGB 2IHVA 1L5HA 3SX2A 4LF8B 1I33A 1QO0D 3UAOA 4NK5A 2PUGA 1FMLA 1SQ0A 1R74A 2C0QA 4UHFA 3RR2A 4EPWA 5IZ4A 4ARIA 3QBDA 4DLBA 1QWSA 2GK4A 4ABYA 4BP9A 1LPPA 1KJYA 1LJUA 1R0CA 2FEPA 2FW1A 5GONF 5CB4A 4C0KA 3UAWA 5AUQA 2HQOA 5IVKA 4IDOA 2GWRA 4O2BA 2G17A 2JI4A 3T7SA 1KFBB 1S2IA 2BSAA 3I39X 3LQQA 3MK31 4L08A 5B1SA 2BC9A 4A8JA 4LHEA 2CMKA 2V9ZA 2HXYA 1A3CA 4G09A 4PY2A 3NDRA 1AS0A 1G8PA 3B38A 1CK4A 3G2PA 4XE5A 3QV1A 4YR9A 1HDYA 1E59A 1N1DA 2BFNA 2W6PA 3LOUA 5G1NA 1JSRA 1T9GR 3TRHA 3LW7A 1BROA 3VV3A 3ABIA 3MJRA 2QLJA 2DWPA 4EGCB 1WETA 5JSHA 4DLSA 4JODA 4N3NA 1HT0A 1E6EA 4HGZA 3RVJA 4LMRA 5LDDC 2CN1A 4PSKA 4IG4A 2JAXA 3L7CA 4IQGA 5B3LA 1ORVA 4AJOA 4U6NA 2H65A 3BXHA 1W25A 3T5TA 2JFHA 3ZGVA 2BMJA 2W98A 1H9AA 2PL5A 4L27A 4AKSA 4TYPA 3IL2A 2JIBA 2C3OA 2WSIA 4DLKA 3B9QA 4ZDJA 3OURA 4LJYA 2R8RA 1PCXA 2YZMA 1GGJA 3L0CA 3ZWDA 1GTMA 5I5EA 4OLAA 1NM5C 3WO1A 2QXTA 4Y2TA 4PNPA 4II7A 4ND8A 4RACA 4AZTA 3K9CA 5C5CA 2YINC 4I46A 4JB3A 4IIVA 1E18A 1VBMA 4GLJA 5I5GA 1I2ZA 3VR5A 1QZ3A 1SHUX 5KS2A 3LT1A 4LEIA 4XB2A 1WXHA 3T06B 5J3JA 2WWYA 5LQAA 1R2QA 2VQSA 4HDNA 3RK4A 3OHMA 3A14A 2SKCA 3O7WA 1K88A 1U3WA 4OHZA 1EVLA 4IFIA 1R3DA 4HX2A 4IQ8A 1WUJS 1ULSA 3I53A 4PCVA 1GZ4A 2DR3A 4R68A 2ZRBA 5DW0A 2F1JA 4CLRB 2FPPB 1E4EA 4OHYA 5IDYA 3ED5A 1Z0DA 1MBZA 1JIUA 1JLKA 3AUKA 3KOMA 5AM3A 5F23A 1KR2A 4CE6A 4ZVMA 4BE4A 4ZI2A 4HLUA 1TRHA 1G3IA 1N2BA 2JFNA 4AVYA 4BAZA 2HQSA 2I6SA 1MXFA 3BKWA 3FCSB 4LX0A 5AUPB 2OESA 1E9FA 9LDTA 1A9PA 1MOPA 1R0BA 1A9XB 3GCWA 3IAEA 1G66A 1E77A 2JI7A 3EDRA 1T3ZA 3PUVA 3DW1X 2H7YA 2G0AA 4MIEA 3RU9A 4OA8A 3ABSB 5I51A 3RIHA 6Q21A 3GGCA 1R37A 4XIGS 3RRJA 9LDBA 3PXUA 2ONZA 3VZBA 3ZLVA 1YA4A 2H2IA 4AJHA 2YWHA 4K81B 1E6LA 1QQAA 3O73A 4JZYA 1YRQA 4O6VA 1M2EA 1P7PA 3SZUA 3D1LA 2I91A 1SOAA 4QQKA 5J40A 4HAXA 3HNPA 3EGDB 4D9MA 2V6FA 1A7AA 2Y27A 1IE3A 1EZZA 1G1AA 1PVVA 5G53C 4PQYA 5TT0A 1P2DA 1L4YA 4G4SP 1UBGA 3Q85A 1ZNZA 1ZSVA 1ZWKA 4O3FA 4RVGA 3CVWA 2BFDB 3RAFC 1I3KA 2FG7C 4FGSA 4OTZA 4YAOA 3CX4A 1JEEA 4OK3A 5IAKA 2FWIA 3NS7A 2C5LA 2QAGB 1TMKA 4HMPA 4TUYA 4AQ7A 1X7GA 2RJNA 1JFVA 2OGTA 3PUWA 2WHPB 1G3RA 5JG7A 2XA1A 1SBCA 3GP3A 4F6RA 1SURA 2FRDC 2HMSA 3R3WA 4GWLA 3P0HA 3Q7IA 4QO7A 1WE2A 3U44B 1KJNA 4HLQB 3VNQA 2O05A 4BV2A 4NCHA 4X00A 3HXOA 3MS2A 3WMGA 1ZEJA 1QG6A 5L51A 2FFQA 4IXDA 1ZL2A 3QWFA 1CUJA 5E7QA 1NXOA 4JBHA 4KPYA 4HB0A 4G0QA 1GM5A 1QFZA 1EDDA 1KMHB 4WD3A 1AGRA 3D0RA 4WXEA 4BV9A 3FNIA 4CF3A 4YJFA 5DLYA 3WGYA 5LDHA 4IIHA 2W00A 3IDFA 4L15A 1KYWA 1G6OA 1Z8NA 4XLTA 1KA9H 5IZCA 2IYYA 2CFRA 1JHMA 2E4AA 2Z5VA 2ZTVA 5TPWA 4DJDC 4GQAA 5T5QA 1TVMA 1UC4B 5KTNA 1QQ6A 1YO6A 2K6GA 2OYSA 2FSGA 4XLLA 2NSLA 2W6CX 3G5AA 4CLRA 4JJGA 4TMXA 5KC8A 3W5CA 3W6NA 1PO7A 3CLVA 3LLVA 2ZB4A 1PG0A 2ZJ5A 3BBPA 1H9CA 4MPTA 3T34A 2GN9A 4DCUA 2NU9A 1EFPA 2UUAB 4HDQB 2H2HA 3RT1A 3ZWBA 5ELLA 2OTCA 4JBXA 3PEVA 5CAEB 4LF5B 3C97A 3QNWA 3UUEA 1LGYA 2FPPA 3HM2A 4FOPA 2E5FA 4UM8B 1QOZA 4MJLA 5H82A 3GPLA 5BV1A 4DR4B 4JT9A 2RG1A 4MUFA 1G2IA 4FHEA 3R9IA 4ZO9A 4Q7JB 5A9SA 2GKOA 2Q0XA 4BJ6A 2QN7A 2W2XA 3CONA 3V2GA 3VXKA 2JCGA 3HR7A 1CIJA 1AZTA 3TDNA 2CKMA 2IY8A 2VK8A 2VTEA 3EEQA 1XF9A 3RJZA 1EWVA 3QKTA 4KFTA 2NOAA 4LA4A 1PJQA 4HX9A 2FUNB 4MCIA 4DV1B 4C0HA 4EYEA 1HLDA 1U63A 4UFNA 2VXYA 3WYDA 3GGDA 2FWBA 1RIIA 4K03A 3INGA 4ALIA 3E9EA 2P0YA 4FJ0A 1VHWA 4WJLA 2RC6A 3AEYA 4MW0A 4RYLA 2XNCA 4QYSA 2G3YA 2I4MA 5I7EA 4FJ1A 2XSZD 3NH9A 4NY1A 2W42A 2V1UA 5F12A 4MO9A 1DFHA 1L7NA 3KSDO 3GH3A 1ODJA 4E1VA 4RYDA 3F3KA 5TEWA 3FB4A 4HBZA 2OP1A 2Y6UA 3S2YA 3U9LA 1Q74A 4C03A 4BFSA 1CUSA 1Q3KA 4JD5A 2EGUA 4YVFA 4DQ0A 5K6AC 1SVNA 1Z35A 4YJGB 5LVAA 3DO6A 4AMVA 3OEHA 4LRYA 4EX7A 1R18A 1W5FA 5BSGA 3F7TA 1MC5A 4ID9A 3KVVA 2F7SA 2XUKA 2BFWA 4AULA 1QC5A 4NV0A 3P4XA 1S3FA 3TR0A 4OBBA 3TW8B 1LF5A 3DM5A 3HUDA 3P5SA 2PX6A 1OLSB 1VI2A 1QGYA 5FLEX 4TYWA 2WR8A 5HMMA 1XMIA 3N6XA 3UUGA 1WDMA 3V97A 2ERXA 5GJWC 3GMDA 1MX9A 5AJTA 1J0XO 3KP1A 4L8WB 3QG5A 4WH0A 5EESA 3TNDA 3NTXA 1N5JA 3ILYA 1Z62A 3KB1A 3KDAA 3MT9A 5FHRA 2O8VA 1G21B 1TMYA 3R9KA 2AWOA 4AWAA 3EEOA 3HDHA 3G2IA 2PZLA 4F2WA 5KEIA 3GH1A 3OJCA 3TTUA 4ZCPA 3AJRA 4G1FA 5AM2A 1FYDA 1U94A 3CUSA 3DBLA 2F59A 3FJ1A 4QDXA 4KOEC 1ZN2A 2P6NA 2XT6A 4JJIA 4IFTA 1DCFA 2A1TR 4MB2A 2C95A 4C7JA 3I0NA 3HBAA 3WFIA 4M60A 4XDYA 1OLSA 3L8GA 4RIHA 5CT5A 3U7EB 1Z6QA 2J3DA 1FLDA 1S8NA 1C4OA 4RHUA 4W5QA 3HCNA 2R0QC 2E4XA 2GPBA 4DCCA 3DBIA 1GNPA 5J59A 4DQUA 1TKBA 3JQPA 2ZRKA 3UHFA 4YJGA 2CBGA 3K9HA 2JJMA 2UZ0A 4KQ6A 3BWXA 3M6FA 1RHUA 4GD3Q 2O2ZA 3V8EA 2AOVA 1DU4A 4C88A 3U5ZB 2WB4A 2Q45A 4LJ5A 1PD1A 1RIFA 2IDZA 4TV9A 1FXSA 2JI6A 3M49A 1N3YA 1WO8A 1AMOA 4TTTS 2P9GA 1YWGO 2IK8A 3K1ZA 4J91A 1XR3A 3SIWA 1LD3A 4B45A 1E9RA 1PQUA 5E7MA 3RSSA 3RDPA 3USZA 4DEVA 1B74A 1DV1A 2GARA 1U0TA 3QPAA 1LY1A 2NP6A 2V7BA 3BTUA 1Y6GA 4HTAA 4XQGA 2G1AA 4Y2GA 5ALWA 3DOOA 5EJAA 2C57A 1V8FA 3LBFA 5GJCA 2ZWMA 4HPWA 1C8BA 1QCDA 1W0JA 4ZXFA 4KQKA 4I81A 5CFLA 2BP7B 4C3ZA 3EGXB 4JY7A 4DA7A 1IY1A 1VJCA 4NS4A 3O93A 2AQKA 4LY3A 3ENWA 1PEAA 3WJ1A 1A96A 1VIVA 2WAYA 3CNOA 5ECWA 5CA1F 2B25A 4LK3A 4BMOB 3BHMA 3EDYA 3DMNA 4N3CA 1NW8A 1XQ9A 3KO8A 4KH0A 5A3QA 4X91A 4EKEA 3UNXA 4C6SA 1D5CA 2XGGA 1E1MA 2QGZA 3ANMA 3DFFA 2XECA 3ZX4A 1E1LA 1VKJA 1UP4A 1WKBA 1BQ4A 4L4YA 1JSXA 3F4BA 1K2WA 1LZLA 1ZN7A 3Q5EA 3CNHA 3UN1A 4IDAA 2O50A 3TB6A 2VZLA 1DPFA 4O4HB 4X71A 2BW0A 2WWHA 4Q1CA 4DMKA 1Z9BA 1XEXA 4MHTA 4G0OA 3T3HA 1WVIA 1BA3A 3JPYA 1FLNA 1QS0B 3DZ8A 4BC1A 5F3RA 4AXXA 4CT4B 2AKEA 2WV9A 4GXTA 3Q98A 4ZEOA 3BZUA 1T13A 4EI8A 2C4MA 3HP4A 4NARA 2CWDA 4UU7A 4HLUC 2WKPA 1PN3A 4ZREA 4RJKA 3U48A 2ZE8A 1R66A 3VDRA 4ZTUB 2AK3A 5TNXA