2Q1TA

Crystal structure of the bordetella bronchiseptica enzyme wbmf in complex with nad+ and udp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
350
structure length
332
Chain Sequence
NASKLANTNVMVVGGAGFVGSNLVKRLLELGVNQVHVVDNLLSAEKINVPDHPAVRFSETSITDDALLASLQDEYDYVFHLATYHGNQSSIHDPLADHENNTLTTLKLYERLKHFKRLKKVVYSAAGEETDIVSLHNNDSPYSMSKIFGEFYSVYYHKQHQLPTVRARFQNVYGPGEILGAGRWRGTPATVWRNVTPTFIYKALKGMPLPLENGGVATRDFIFVEDVANGLIACAADGTPGGVYNIASGKETSIADLATKINEITGNNTELDRLPKRPWDNFGSPEKARRELGFSADVSIDDGLRKTIEWTKANLAVIEQIMRKHDSALATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
total genus 126
structure length 332
sequence length 350
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q1tA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2q1tA02
4MP8A 1H9BA 1Q1NA 1U28A 4E2ZA 1SO8A 1E1MA 4ALIA 2OBYA 1AHIA 4JBIA 1TLTA 3MJ4A 2UDPA 3P19A 1TXGA 4E13A 1WW8A 3PHGA 4NJMB 1KYQA 3WLFA 2J6IA 4Z9YA 4CM1A 4I5DA 3TQHA 1U3UA 4YJHA 1BSVA 4LSWA 1NWHA 2VZ0A 1VPDA 2NQTA 5FI5A 1H6DA 1ADBA 2WDZA 3H2SA 1EK5A 1LI4A 4KZPA 4NFHA 2Y1GA 3ZU3A 1YS4A 3KM0A 1YGYA 3W8DA 4J43A 1PGNA 5KNLA 1DPGA 3EHEA 5COBA 2X0IA 2PGJA 2JHFA 1DJQA 1Z74A 1RKXA 4EEXA 2GSDA 1ZK0A 3DONA 1IB6A 2OORA 4OM8A 4Z9XA 4K6CA 3F9IA 2HK9A 2Q99A 2IZ0A 4R41A 4TRRA 4L9RA 1DXYA 2PGDA 1ZCJA 1I5RA 5L95A 2HMUA 3L6DA 4XYGA 5LDGA 3PZBA 4W7IA 3DQPA 4FQ8A 2X9GA 5JMPA 4ZGWA 2BFOA 2UUOA 1TT7A 3KSZO 6ADHA 4U7WA 3PHJA 3D64A 4YRDA 3JQ7A 2QYTA 1DBVO 4E31A 3D3WB 4O59O 5J23A 1PS8A 1GUZA 2FZWA 4RVUA 1DC6A 3WIEA 3F46A 3L6OO 3CTMA 2OXIA 2O7QA 4M86A 3SEFA 4ND4A 2IEBA 3GGGA 2YFHA 3DMTA 3NEPX 1OAAA 4BNTA 1MUUA 3WYCA 1GEEA 1VLLA 4PRLA 1YB5A 3PI7A 2A94A 2R6JA 4OAQA 4FOOA 4UVIA 1H93A 1ISMA 3VDRA 3SBOA 3H3FA 1NAHA 3GK3A 1MV8A 1HZZA 2H5LA 4IY1A 4MVJD 5F5LA 2IDZA 1XHLA 4JBHA 3WGHA 1Z7BA 4WGGA 4B7CA 1V9LA 1X7HA 2A4KA 3IOYA 4CM7A 4I08A 3PJDA 2AQ8A 1H9AA 1Q7BA 4M87A 3U09A 3I23A 3TFOA 2X0JA 1MGOA 1R6DA 5C7OO 3KETA 2I66A 3DBRA 4BO7A 4CR7A 4WJZA 2Y68A 3C24A 4CMJA 4LMRA 1X0XA 3SLKA 4CM9D 3FF4A 1LDEA 3RFTA 5DZSA 3FNFA 2VQ3A 3BMQB 3DOCA 2ZTVA 1NYTA 4CMEC 5C7IO 4UVDA 4O6VA 4NBTA 2A35A 3JQAA 2O3JA 5ADHA 2PD6A 1QP8A 1GFSA 3AWDA 3ZV5A 3ZU4A 3OQ1A 5K9ZA 2BF7A 3WQSB 2GZ1A 3FPLA 3VKUA 1A4UA 3FBTA 4JIGA 1L1FA 4UEOA 3NV9A 3ICCA 2ZB4A 1RM3A 3C7DB 1E1LA 3KUXA 3VPFA 5G0SA 4YJDA 3RKRA 2NU6A 4RPLA 4K9DA 2B5VA 1YB4A 1GV1A 1ISFA 2DPGA 3PHIA 4XR4A 1P9LA 3A14A 4D46A 3DHYA 2PY6A 4DQXA 4EDFA 1LRJA 1HDOA 4NI5A 3FBGA 4TZTA 1EVIA 5A3VA 3GGPA 3E03A 4QT0A 4PG6A 5G2OA 2I99A 4RGBA 2F1KA 4J1TA 2YY7A 1NR1A 2PKQO 3C7AA 5DCYA 4AJNA 1A5ZA 4K6FA 5JS6A 1NHWA 4LCEA 3JV7A 4WE3A 3B20A 3JQFA 4CM8A 3OIFA 2FY8A 4DC0A 3DEYX 2ILTA 3HN7A 1YVEI 4RORA 3WYEA 4A27A 2HK7A 4CM9A 1P1IA 1SZJG 3LZ6A 2GR9A 2OMEA 4JGBA 3V5NA 1R0KA 4HADA 1GD1O 5JXWA 3VC7A 2JFFA 3B1KA 1WAMA 3ST7A 1J4AA 3AY7A 4IJWA 3I9OA 4IDCA 4ZQEA 1UAYA 3MJEA 1NQ5A 3BTUA 2IRWA 2XXJA 4M1QA 5L53A 4MKZA 1ONNA 1FMCA 3NJ4A 4BS9A 4IQ8A 2JD1A 4HWKA 4KQXA 1Q7CA 4LVUA 3E18A 4XQ9A 2RCYA 3STHA 1FXSA 3W4JA 1LLDA 1HLDA 1DSSG 1HDGO 1WNTA 3DZKA 1K3TA 1QV6A 3SC4A 4A0SA 5TF4A 2GO1A 4J9UE 2X8LA 3SJUA 3K73O 1D1TA 2FR0A 1N5DA 3BA1A 5G0UA 3WR5A 2DFDA 5IXYA 4FFNA 5IDQA 4D42A 3GC6A 1J6UA 3PQFA 3QLJA 5TJHA 3JD4A 4JP2A 1B3RA 2J3JA 2Y1FA 1DDOA 4CLDA 2RH8A 4JCOA 1YRLA 3ANMA 3ADOA 4PGFA 1N2SA 2H63A 2RHCA 3ZWAA 1WXDA 4HNHA 3K2BA 3U4CA 4EUHA 3U4IA 1KY5A 9LDBA 1P1FA 2DTDA 1MA0A 3HDJA 3NGLA 1IE3A 1VSVA 2V6BA 4KWIA 5HA5A 3H9QA 1L7DA 1X13A 3RUIA 1F0YA 1PWZA 4ALMA 2YYYA 4YJGB 2X5JO 2WJPA 5IG2A 3N74A 5EJ2A 2YV2A 5A5FA 4KDEA 3RUFA 4PLVA 3M1AA 3I1JA 5ITWA 2UUPA 4UAGA 1HXHA 1KC3A 3WTCA 1ISJA 2B4TO 5AYVA 3KO8A 4AJJA 2QRJA 3KBOA 4NQZA 2C20A 4WCFB 1ZK2A 3WXBA 1RM0A 8LDHA 3ZU2A 5JY1A 2V6MA 1RPNA 1R4MB 4R54A 2DBRA 1MC5A 4FBGA 1VKOA 2Q1SA 4RZIA 4GKBA 1GZ4A 1T1RA 1Y8QB 5AOVA 3VH4A 5BNIA 3G0OA 4RVDA 3U5TA 2BMAA 1H94A 3MOIA 2ZJ0A 1B3BA 2JKVA 3OEWA 3OIDA 3AUAA 1R15A 4OGWA 4D3FA 4DLLA 5BSHA 2EJWA 3PHLA 2XXBA 1BHSA 1YXMA 1GDHA 2FN7A 3JD3A 4UEJA 5AXAA 4BO5A 5IDWA 2CF5A 1DRUA 5A4DA 1ISHA 2X0NA 1HE4A 1T26A 1Y6JA 4J3FA 3RIHA 3GDGA 1EE2A 4RVGA 4XKJA 1Q0HA 1HT0A 2EXXA 4YDRA 4DXHA 2ET6A 3GEGA 4KWHA 3W4KA 3ZWWA 5TIIA 4BNNA 1AE1A 4KUGA 3VPXA 3ZWVA 3WGQA 2HRZA 1I01A 2BELA 4R16A 3L9WA 4XB2A 4CMKA 4ZU3A 1P31A 4FFLA 4I9NA 2A92A 4KDFA 3V1TC 1M6HA 2X58A 1I36A 2CVQA 4XYLA 9LDTA 3B70A 2RBEA 2LDBA 3T7EA 1BDBA 1FF9A 2GN9A 3UGKA 3MCVA 2DVMA 1KIFA 3RI3A 2NADA 2VHYA 3HHPA 3MOGA 4B4WA 3HB4X 2YW9A 3K6JA 2QRLA 4IJKA 3QSGA 3PQDA 1H6CA 3D3EA 3EY4A 1FDSA 1NM5A 3KYDA 3GEDA 1K6IA 1EUDA 4DIBA 4FJ1A 2O7SA 4NDNE 1GZ3A 4R3WA 4U5QA 5BNTA 3DFZA 3D7LA 2NM0A 2SCUA 1ZVMA 3TWOA 1KEPA 3WG9A 4HV4A 3PIIA 3KHUA 4Z6KA 1QYVA 2CDCA 5JMWA 2HMTA 4BKUA 5L45A 4XDYA 1AHHA 5F5NA 4U6QA 4W6ZA 4F6LA 1H5QA 1R66A 5JAQA 5CAEA 1SEVA 1N92A 4QXMA 2NVWA 1O9BA 1Z7EA 1ZKMA 4O63O 3U4DA 1E3LA 1I8TA 1ZK4A 3FHLA 2GUGA 1IPFA 4FN4A 3WBBA 4E6PA 3DBLB 2VOEA 2QHXA 2B4QA 3O03A 3VPGA 2ZB7A 3RC9A 5A5EA 3M2PA 1X1EA 1UDBA 1DLIA 1BVRA 3AFMA 2FOIA 4DPLA 2HJSA 1BW9A 3RUAA 3WNVA 2YUTA 4ALJA 3NTQA 1ZEMA 2P9CA 3AUUA 1P44A 5KVQA 2GDZA 1R4MA 2VHXA 3OHSX 1YL6A 4XYBA 1EQUA 1NFFA 2H6EA 1TB4A 5JC1A 3I9JA 3R0IA 3F4BA 1F14A 3KRTA 3IJRA 2EW8A 5IAAA 2EERA 1GPJA 1FK8A 1U4OA 4Y67A 5JY6A 1ZO8A 4OXKA 4FJ0A 1GPDG 2BGKA 2Q46A 1JN0A 5ES3A 2QW8A 3QWFA 1XWFA 4YTEA 3OMLA 4PZEA 4OO3A 1I10A 1HEUA 1A7KA 1NTOA 1PZGA 3NDRA 2FWMX 2WTBA 3JQBC 1PGJA 1PGOA 3PYXA 4NR0A 5ILOA 3R1IA 2Y0DA 4UVHA 1K0UA 4YAGA 5I7EA 2O3TA 2EGGA 5TRTA 3GVXA 3Q9NA 3EYWA 4E5PA 4P4LA 1QKIA 4R1UA 1S7CA 5IFLA 4RJTA 1N7GA 3WQRA 5A9RA 4IXTA 1HSZA 1U3TA 3JTMA 3GOHA 4JJFA 4MIYA 5ENVA 4IPTA 4FFRA 4ZQBA 3DO5A 3WJ7A 1NR7A 1T4DA 4KOAA 1E7RA 1VC2A 3IAHA 4WLEA 1AXEA 3TFQA 2EG9A 1EMDA 3NGXA 3W8FA 1LLQA 4WASA 4M49A 4Z0TA 4BUCA 1Y81A 4JX8A 4B8ZA 2HJRA 3AM3A 3MZ0A 3LT1A 4W9NA 3WLEA 2WYVA 4NK5A 1JLLA 2Z1MA 3LT0A 4RPKA 1ID1A 4WCFC 3DBHB 3CE6A 4UVGA 5G0TA 3T4EA 1B16A 1ISIA 2X7HA 4XZ3A 1KEUA 3GVCA 3WJAA 1ZUD1 4ZRNA 2YQ4A 2FPPA 1C0PA 1JAXA 2ZCUA 4D3DA 2PTGA 1SPXA 4TZKA 1Z73A 3GPIA 4MVJI 5IZ4A 4FS3A 5AQ1A 4B7XA 3FNEA 3WGYA 3I4FA 2O3SA 3MWDB 4DRYA 1EVYA 3DOJA 1HYHA 2XOXA 3PJGA 4ZD6A 1C1XB 2V6FA 4RV9A 1XEAA 1A9ZA 1W8DA 4P4NA 1H2BA 3I83A 1Y7TA 2FSSA 1PR3A 3QHAA 3GAZA 5LC1A 2C7GA 3RD5A 2HQ1A 1SNYA 4TRNA 1B14A 5JCJA 4DBVO 3F47A 1CF2O 3EUWA 4CMIB 2GN6A 4NU6A 1SOWA 3HFGA 1SOVA 2BI7A 5JO0A 2JAHA 3O26A 2VYVA 2D4AA 2VUTA 4OKIA 2Y1DA 4ZRMA 4YAEA 5CPBA 1U5AA 4BGUA 4OYRA 2OUIA 4MJLA 4RZHA 4II2A 5CEJA 4IQGA 4YYZA 1ZSNA 1XR3A 2D5CA 3RBZA 2X23A 2IZ1A 2GZ2A 3KOUA 2OL4A 1J0XO 1E7MA 4LVCA 5EINA 3WQQA 1DIGA 4A5OA 5KVVA 5HTOA 1R16A 3GUCA 1BTOA 1D4FA 3DHNA 1ZMOA 4DGSA 4RDHA 1GQ2A 1HYEA 3P2OA 5L7YA 3JQCA 1PJSA 1SB9A 1PQPA 3EDMA 4L74A 2Q50A 5DN9A 1LC0A 2BD0A 2NVBA 3PFWO 1ZXLA 1BRMA 3H9UA 3LSYA 3ETDA 3DAFA 1L7EA 5JNLA 4CV0A 1U4SA 5FF9A 5AXCA 1HL3A 1LJ8A 2JCXA 4BQPA 1R0SA 3S8MA 4O0LA 1JWAB 1GU7A 1K89A 2WMDA 3INTA 3AUSA 2Q3EA 3C7CB 3QV1A 3DHEA 5CG2A 4PFJA 1ENOA 3VKVA 1P74A 3E48A 3PZRA 1M66A 2IXBA 3WICA 1EVJA 4NFSA 1HYGA 3IKVA 2J3HA 3OA2A 3GMSA 4II3A 3JQ8B 3FCOA 1PU2A 4F6CA 1UP4A 1NWCA 3GDOA 4NIMA 1Z82A 2P2SA 3W6UA 2BGLA 1DEHA 5IF3A 4IQ0A 1NNUA 2VZ8A 1ZSVA 2W8ZA 3PWZA 4MP3A 3HWRA 5JYEA 1HE3A 1PZFA 3TRIA 2OP0A 2V7PA 4HY3A 3EZLA 4J7XA 1U5CA 2E4AA 3KYCA 3DZJA 1EVZA 1XIVA 4H7PA 1GYQA 4Z3DA 4C4OA 4HFJA 1DIRA 3DC2A 4MKXA 2X5OA 4CM6A 5JDCA 3SXPA 5U9CA 3AI2A 3N7UA 1MXHA 2B83A 1PJ3A 3D0OA 2Y66A 1UP7A 3ZW9A 1DRWA 4E0BA 2O2YA 1LQTA 2DBZA 4NHEA 2DUUA 2IODA 3X2FA 2O23A 4WK6A 3TZ6A 3MTJA 3K9QO 4BO4A 5TX7A 4WOKA 3TN7A 5T64A 2X6TA 2G5CA 2EIHA 3ZHZA 1V8BA 3NDIA 1H6BA 4PCVA 4XB1A 3LLSA 1HZJA 4PRKA 2VYNA 2WWRA 1QXSA 4JJGA 1UDAA 3PXXA 3QVTA 4B3HA 3E9MA 3GN2A 1OFGA 4RF3A 1PSDA 1Q2XA 5JO9A 1E77A 3E5MA 5HS6A 2WE8A 1JDJA 2WD8A 3GVPA 1U2GA 3AU8A 4EITA 1VL6A 3KVOA 3AY6A 5G0WA 3CEAA 3HZZA 4R68A 1EBFA 2JD2A 1DAPA 2VRCA 3VH3A 1NX6A 1ISGA 3UAGA 4AG3A 3HFSA 4L4RA 4WCDA 3P2YA 4E33A 1NPTO 5HS4A 5IN4A 4E2WA 5FEUA 1FJHA 2VWGA 1D1SA 3QWHA 2C54A 1V3VA 5EPOA 1O0SA 4NNJA 3WYBA 4GX2A 2YQ5A 4RL6A 5G4KB 2VT3A 4PVDA 2W98A 1ZK1A 3WGIA 4MVJH 3HN2A 3V1YA 4ZICA 2LDXA 2G0TA 2YHIB 1SAYA 3GZNB 2NLOA 1M75A 4KUEA 1ZXBA 1PJCA 5DCUA 1BW9B 3SJ7A 4Y6PA 1JKIA 2HMVA 3NYWA 1NPDA 4OJNA 5JSFA 4CM5A 2DBQA 3ASVA 4FR5A 3CIFA 4BO3A 1CWUA 1ULUA 2B37A 3C1OA 1A72A 3F1KA 3GPDG 4YB8A 5H83A 3GR6A 4RPJA 3OSUA 2FHSA 1GADO 3UW3A 2I3GA 3ORFA 2AEJA 5ENDA 3TSCA 2AW5A 2HMWA 4FJ2A 4OSPA 3ZHXA 2VHVA 1ZH8A 2HO5A 1U3WA 1NP3A 1JQBA 2HCTA 1C14A 4R5HA 3K8ZA 1VKNA 2NU9A 3V8BA 2BFPA 5G0VA 4XQEA 4C7JA 1Z6ZA 4BV8A 4MVJA 2IZZA 5FYDA 1OOEA 4IZIA 4YWJA 4R01A 4HUJA 3PYMA 1E92A 3QA9A 4XYEA 2C07A 1NVTA 3VH2A 1GAEO 4XDZA 2Y1EA 5JLAA 2E37A 3JQ6A 3OJ0A 3O4RA 4BKRA 4BNXA 3VTZA 1Y9AA 4DREA 3C3XA 3DR3A 4GLOA 4RPGA 5I8WA 1NPYA 4QEDA 3H5NA 4Z0PA 1ARZA 5CDYA 3PRJA 1GCOA 5G4LA 1DIAA 4J49A 1LLCA 3DWFA 4RQTA 3VTFA 3HQ4O 3P7MA 4QQRA 4IUYA 1XU7A 2VWQA 2B0JA 1DHTA 2VNSA 4NBWA 3OECA 4OL9A 5A9TA 4AJ2A 4B3IA 1AUPA 5JDIA 2Q49A 3DMYA 1BXKA 2FP4A 4ZQGA 4MOWA 3QVSA 5EMHA 4CMCA 3MJCA 1GR0A 1JKFA 4WOJA 2B5WA 1PWXA 1ZSYA 1DRVA 3Q2IA 3V2GA 4J7UA 5F1OA 2O4UX 4Z0HO 4MO2A 4G65A 4IMPA 3EZYA 4JK3A 4B79A 2DAPA 3WOHA 1AGNA 4C7KA 4YAJA 1Y9EA 1NXQA 4U0JA 1WVGA 4L4XA 3QIVA 1UXHA 3ROMA 1GUFA 3WB9A 2QZZA 4GGPA 1LUAA 4AJIA 5DBGA 1TA4A 1IY8A 3I6IA 4GGOA 4CM8B 1GL3A 1XLTA 3PLNA 2VRBA 1U3VA 4R5MA 1OI7A 3CZRA 3FN4A 3OM9A 3E9NA 4BL5A 4MIOA 4IS3A 2CY0A 2VHZA 3NT2A 1ZW1A 3GNSA 4OXNA 4AL4A 2ZYDA 3CMMA 3INGA 1P1JA 2E6UX 4QX6A 3UN1A 3UF0A 4RF5A 2NVUA 5CDGA 2B35A 3LT2A 3OA0A 5H81A 5T67A 1DFIA 1NFRA 2EW2A 3HDQA 3RROA 3WGTA 1X14A 2CFCA 3S2FA 3WWZA 4YXFA 3LK7A 2ZJ1A 1PIWA 4BHTA 4YRBA 1Y8RA 2DT5A 1UXGA 2I65A 3KTDA 4MP6A 4RLHA 3V2HA 1A71A 4M8SA 3B1JA 4QUKA 3ZHBA 1LDYA 4NU5A 4BV9A 3WSVA 1DB3A 1M2WA 1UP6A 2W2LA 1RYDA 1ZIDA 2P4HX 1Q7GA 4PVCA 1HRDA 4GX5A 2PFGA 4DUPA 3IJPA 1QORA 4PLGA 3G49A 4R51A 4BNYA 4D45A 4Q3DA 1X7DA 3CSDA 2CZCA 3AUTA 3UKOA 1HDYA 4A73A 4BKPA 4IINA 4E3ZA 1IUKA 1YQXA 4I9HA 4XEHA 4RDIA 1UDCA 2EF1A 1UZMA 4ZA2A 4JBGA 1WMBA 3PJFA 4GWKA 3MTGA 2HKIA 5EESA 2VNAA 1DIHA 5LCXA 2VZ9A 1PGQA 1YL5A 3EGOA 3ONDA 3OJFA 4IIUA 1EDOA 1E5QA 4DIOA 1YQDA 2HRBA 3GRKA 2C2XA 1U8FO 2X9VA 3GFBA 4FC6A 1YOVB 3VZRA 5KJ6A 4E30A 1HDXA 3FRJA 5MGBA 2Y99A 1LTHR 5DDIP 4D43A 3HDHA 4U0KA 3I9MA 4W9NC 4EYEA 4ROSA 2UYYA 4ND5A 1U7TA 2BKAA 2AG8A 4DLAA 4YJFB 2ZQYA 1EFKA 1MP0A 5DULA 4A26A 1XQ1A 3HJAA 1ZNQO 2AG5A 1GEGA 3M2TA 4A03A 2NU8A 4CLEA 4BNHA 4YJHB 5F1KA 4DTIA 2Q1TA 3H2ZA 4J0EA 1XYGA 4CMBA 3FR8A 1VI2A 2AEMA 4RPHA 5TT0A 2AQHA 3WX0A 1QV7A 1MG0A 4BVAA 1RYEA 3JQBA 4CMGA 1MX3A 5L40A 3TZKA 1QRRA 2XPCA 3RQSA 4DVJA 1BDMA 2W90A 1SB8A 1KVSA 1B8PA 2FPIA 3UCXA 1Y1PA 4TRMA 3DDNA 4L8VA 2NVUB 4ITUA 3WFIA 1DFHA 4NK4A 1PX0A 5IDXA 3RUDA 2AE1A 3G17A 1RJWA 4MDHA 4IS2A 4MPDA 4DYVA 4KP7A 4JJIA 4E4YA 2W4QA 4HFMA 1E3SA 3I6QA 2ZQZA 3VZQA 1ZJZA 2G17A 3HE3A 3U9LA 3AK4A 3LT4A 3V1UA 1JVBA 3K5PA 5T5QA 1TT5B 1MXFA 3ROQA 3AM4A 1LSJA 4HKTA 3GLQA 3FD8A 3QJ5A 3ZZNA 5G4KA 4DA9A 4N5NA 4QFCA 4CMIA 3VOSA 1QLHA 4D41A 4EZBA 1YBVA 3L77A 2BI8A 1VJ0A 2VWPA 3ETEA 4YBZA 3OQBA 1PEDA 3PHHA 2NSDA 2NU7A 2AQIA 1MFPA 1VL8A 2AXQA 4OHUA 4N5MA 5THQA 4FSHA 2VN8A 3I9NA 4WEQA 3K31A 5A05A 3D4OA 3RUEA 4LK3A 2DTEA 3FWZA 4UULA 4YAKA 1K5HA 2DKNA 4E5NA 3DTTA 1NFQA 3ROKA 4PLCA 4TQGA 4MINA 4CMEA 4FCCA 4B4VA 4GSLA 1I3NA 4XYMA 3GN1A 4ESOA 1IPEA 4XIYA 4RVHA 4CLXA 3KEQA 2ZB8A 3ZWNA 5A9SB 4LSMA 1EUCA 4OXYA 1P33A 3BMQA 3MWEB 4CQMB 4J1NA 1E5LA 3M6IA 3WGGA 1B8VA 5C5IA 5I9MA 1UXKA 2C7VA 1HDRA 1NVGA 1QLJA 2CD9A 3JQ7B 3Q0EA 3TNLA 3TZHA 5CDSA 2DUWA 4ALKA 2DTXA 5ITVA 4XR9A 4YAIA 5KJFA 4IM7A 1EFLA 1YL7A 3WSWA 5H82A 5KWEA 2C0CA 1CERA 3I4CA 3JQEA 5ER9A 3TZQA 4I8XA 4Q3BA 1N1GA 3V2UA 3OF2A 3I5MA 1WP4A 4D44A 2GGSA 1LRLA 3R3JA 3ULKA 2CVOA 1MB4A 4BNWA 1R37A 5A9SA 4E2XA 5I7FA 1WZEA 5T6BA 3BHMA 3ANLA 4PLHA 3JQ9A 4WEOA 2WYWA 1YE3A 4PG8A 1E7SA 3ICPA 1TI7A 3JQGB 3Q11A 4HXYA 1E3WB 4Q3CA 3HB5X 5TSDA 1UUFA 3C1TA 4GKVA 4RQUA 4EBFA 4N18A 4BO6A 3R6DA 1RWBA 2X4GA 4Y98A 5CHEA 1YH3A 4U8GA 4EJ0A 4LMPA 3AOGA 4IGFA 4J91A 2J5QA 4TRJA 4D0SA 1XA0A 1KERA 3HUDA 4PLTA 3RU9A 3H65A 2VCYA 3FTPA 2PLAA 4ILKA 3OICA 4I5GA 2O50A 1ADCA 2ZATA 1ENYA 4JLWA 4BNMA 3QE3A 2HLPA 1QG6A 2JAPA 2PZLA 1YONA 3NUGA 4GAEA 4TWRA 3VDQA 7MDHA 3RKUA 4IDGA 4MKRA 1WDMA 1G1AA 3BMNB 5TT1A 1ADGA 4TKMA 3O9ZA 1P1KA 3FR7A 4IBOA 1D8AA 1PZHA 1V3TA 2PZMA 1A7AA 4O1MA 5HBRA 4PN3A 5TGDA 1K6XA 1LDGA 1RM5A 4DQVA 2BRUA 1XCBA 4YEDA 2HUNA 1UAGA 2PKRA 2DM6A 5K6AA 1WMAA 4XQCA 4GLLA 4IXWA 1PJTA 4IZHA 1LSSA 2J3KA 2WD7A 1E1KA 3H8VA 4XD2A 3GH3A 5TC4A 4YRAA 1GV0A 1I3MA 2GN4A 4GWGA 1CYDA 1Q0LA 1R0LA 4D7AA 2VTDA 2RHRA 2Q1UA 2CNBA 2PR2A 4YT4A 2V6GA 1Z45A 1O94A 3NTOA 1ZFNA 2G82A 1C0IA 4UEKA 4WLFA 3CPSA 3F5QA 1C1XA 1E3IA 3DBRB 5JYDA 1PL7A 3LQFA 1VJ1A 3ITDA 4HP8A 5U1PA 2EEZA 3TDKA 4CPDA 1P0CA 1Y8QA 5B12A 2PH3A 1HE5A 1I2ZA 1PQWA 3GNTA 3OEYA 3F5SA 6LDHA 4DL9A 1Z75A 3ZWBA 5KCZA 3F6YA 5KVCA 3FPCA 1DC4A 1PL6A 3EC7A 3QVOA 4LRSB 1FDTA 3GDFA 2VTEA 4DLBA 3DTYA 3H9EO 3MJTA 3K96A 5EQFA 4FGSA 3TL2A 2PH5A 4FDAA 3BMCA 3BXXA 2HK8A 4CUKA 4JP3A 2RH4A 2ZKLA 4ZQHA 4KTTE 2P5YA 1HLPA 3DZIA 3SLGA 2P91A 1XG5A 2Q2QA 1V6AA 1KVUA 3SC6A 2EKPA 4LW8A 4BNFA 2B69A 1EBUA 3PVZA 5B4VA 1P45A 5C3MA 3IP1A 3GG9A 4XCVA 2FR1A 1I30A 4S1VA 4BGIA 4E2YA 2UV8A 4LN1A 1C1DA 2GYYA 1U9JA 3KSUA 1QYCA 3W4IA 3LF2A 1DFGA 3PWKA 4QECA 5BNFA 5T57A 4E12A 4U6SA 1DIBA 5DCWA 2O48X 3IS3A 3ZWCA 4Q3NA 1TT5A 3U62A 2Q2WA 4FC7A 4QO8A 1E7YA 1VSUA 2VWHA 3CH6A 5GZ6A 2PV7A 1T2DA 3AY3A 3D1LA 3KYDB 5DBFA 5F21A 4H16A 1SBYA 4OH1A 4CQMD 1CJCA 1W4ZA 2P68A 4M55A 3EK2A 4R1SA 2VUSA 1X1TA 3DBLA 5DP2A 3S2GA 2V65A 3PGXA 1YO6A 2GASA 1MFZA 3FSRA 1B2LA 1V0JA 5JBIA 3X2EA 2JFGA 3BMOA 1YQGA 5IDYA 5KOIA 4Y6RA 4P4GA 1YDWA 2EP7A 4WUVA 3HSKA 4J16A 3QY9A 1MG5A 2R2GA 4BGEA 1P0FA 3KYBA 4GH5A 2GLXA 4BQRA 3L9XA 1HSOA 1KVRA 4OSOA 4YT5A 3T4XA 5I9LA 3VVBA 3GNQA 4MVJM 3ZU5A 3VZSA 3E6AA 1XSEA 1B8UA 4NJMA 3AI1A 1IYZA 8ADHA 2DU8A 4GI2A 4WKGA 1KVTA 2IE0A 4M54A 1ADFA 4PG4A 5TQVA 3WBFA 5A1TA 2OP1A 1XDWA 2CSUA 5EQDA 3ZCXA 3FTNA 3DAPA 3L4SO 1ZEJA 2AEFA 2C5AA 3L07A 3RVDA 2ZIZA 3NKLA 3WDSA 1IHYA 4R3NA 3AJRA 1CDOA 3JYOA 1W0CA 3LU1A 3WGZA 4CM4B 5KTKA 2Q4EA 2UAGA 1C1DB 4IJVA 3HG7A 4UUMA 2P9EA 5CPFA 3S2EA 3CZMA 2OGUA 1KY4A 3B6ZA 1T2FA 1EDZA 2OOSA 4PLFA 2NTJA 4PLPA 1EEHA 1KEVA 1HTBA 4RLSA 3RBXA 4QO7A 4XJTA 5KJEA 5C7LO 5A04A 1DOHA 2VRCD 3RWBA 3NRCA 3W8EA 4YT8A 1DC3A 1WDKA 2X0RA 4JNKA 1CIVA 1S6YA 3PWSA 4YR9A 3BZUA 4MVJE 2EP5A 2C5EA 2IYPA 3ENKA 3JYNA 1XU9A 1YBAA 3B1FA 4WECA 5BSGA 5A02A 1X15A 3VVCA 1N9GA 3GGOA 3RUCA 1MC4A 3RC2A 4CM4A 5B4UA 3TL3A 2TMGA 1N7HA 1A27A 2DFVA 3GT0A 4N5LA 1VM6A 2X86A 3UHAA 4AVYA 5JPIA 4ZVVA 3KV3O 2BFAA 1B7GO 1T2CA 3JQAB 2J5RA 4I1IA 3DZHA 4PG5A 4CV3A 2D3TA 2Q45A 1PJ4A 3IMFA 4W99A 2BLLA 1WPQA 5F3RA 1BXZA 2I9PA 1U2DA 5MDHA 4Y8VA 5IXSA 4PG7A 1E6UA 3GA0A 4BB6A 1BXGA 4AJLA 3WFJA 4G5HA 3U4HA 4GMFA 3LVFO 3UCEA 4BO9A 3UFXA 3JQFC 4B7UA 4PLZA 4A7PA 4R1NA 3KSDO 1BVUA 1E6EA 4RF2A 3S55A 3E1KA 4CR6A 5L4LA 1ENZA 1F06A 1FDUA 4ZN6A 1GYRA 3T7CA 3CKYA 1E1NA 5EERA 4B4OA 4BIIA 3BMNA 3ZV3A 2WE7A 1XELA 3D5TA 5FI3A 2D5AA 4RO0A 5L9AA 2TMDA 4J2OA 1V3UA 1HE2A 3FNHA 2JL1A 5L7TA 4JN6B 4LCJA 1ZK3A 2YV3A 3QQPA 1PJLA 3BTSA 4ALNA 1GCUA 1KETA 3WGOA 2PK3A 4BNZA 4H15A 2GNAA 2OBNA 2VHWA 4RCVA 4W82A 5K6AC 3ENNA 1LXCA 3TOXA 4CL8A 5GY7A 1Y8RB 2J3IA 5IN5A 4FPXA 3OFSA 4NG5A 4L73A 3ZWYA 4BO8A 4BNGA 3FNGA 3GVIA 3H3JA 3NX4A 1UH5A 2HDHA 3Q1LA 2E49A 1QR6A 3JD2A 5THKA 2OHXA 1SMKA 2OO5A 3PK0A 1EQ2A 3EMKA 1PTJA 1DJNA 3DOOA 4NZ9A 1M6WA 2H1SA 2QRKA 3JYQA 1E0DA 4A10A 3INRA 2YDXA 2Y0EA 4NJOA 1N9GB 3ZWXA 4CLRB 4EUFA 1GQQA 2ZTLA 4DC1A 3COSA 4K26A 1KEWA 3L6EA 1P77A 5JAZA 3QRWA 4XJSA 1LDNA 1A4IA 3F1LA 3VH1A 5B1YA 5TS3A 5HM8A 2QZ9A 4KTVE 5L4NA 3BMOB 3D5QA 4CQMA 3BHJA 3E8XA 4XGNA 4DYDA 2Q4BA 3DB2A 3CINA 1BXGB 1G0NA 4O5OA 3RAJA 1QYWA 1XGKA 3GQVA 1EZ4A 1IZ0A 1IZ9A 2DPHA 4BOYA 1I2CA 4F46A 5KVSA 3ZHYA 3K2EA 4BMNA 2X5KO 1E7QA 1C0LA 4FW8A 1ZJYA 2WYUA 3JSAA 2GN8A 3BTVA 4CLOA 1PS9A 2D8AA 5CEEA 3LC1O 3NDJA 1K2WA 3AOEA 1VRWA 1T2AA 2PNFA 1NAIA 1I32A 2PD4A 4M89A 4PZDA 2GPTA 2NTVA 5A3JA 2DBVO 3ZV6A 1GY8A 1H2HA 5T8KA 4CMHA 4LRTB 4N7RA 4DQUA 4J4HA 3Q3CA 4J1QA 1WDLA 1R12A 5JAMA 3ZWPA 3SVTA 5CDTA 2I6TA 4ZHSA 5FWNA 1PJ2A 1OMOA 5CG1A 4KMSA 1IULA 2DC1A 3VPSA 2Z5LA 2AE2A 2HMSA 4FB5A 2DQ4A 4ND3A 1XQ6A 2ZTUA 1OC4A 1UJMA 4XRGA 4WNIA 2Z95A 5BQFA 1YJQA 2P9GA 3G1UA 1GTMA 3JYPA 5EN4A 4BKOA 4LGVA 1KOLA 3G79A 1OC2A 1P1RA 1CRWG 4AJ4A 4CQLA 4TMFA 2ZYAA 3FI9A 4CR8A 4D3SA 3BHIA 3DBHA 3AFNA 4G81A 5DNAA 3Q2KA 2Y05A 2Y1OA 3ADPA 4QFDA 2PA3A 5HWSA 2IEDA 4TVBA 4ID9A 3OQ6A 1KBZA 3K30A 4IMRA 1CQIA 3OJOA 2RIRA 1E7WA 2PZKA 4IJUA 2R00A 3BIOA 3TPCA 1BWSA 2GF2A 2YJZA 1O95A 1PS0A 2B36A 2HSDA 2I5PO 4X54A 1LBEA 3GZNA 4CODB 3D3WA 3Q6IA 2JJYA 1GQYA 1OBFO 3C85A 2YHUA 4FFPA 3A28A 5KJ1A 2ZCVA 4XRRA 1KS9A 4L4SA 2NNLD 5KIAA 4URFA 3GHHA 4Z9FA 4YACA 3JD1A 3L0DA 1AXGA 1G0OA 3TF5A 3UICA 1E3WA 3JQ9C 3GFGA 5DF1A 4EJ6A 4XGIA 3PQEA 1P3DA 3ABIA 3JQGA 5EIOA 1E3EA 1SEPA 1BMDA 2DLDA 4E5KA 3ONEA 1PZEA 4YT2A 4CQLB 4MIEA 5GZ3A 5JW6A 1H6AA 4BNVA 1GZ6A 3BTOA 5TJ9A 3AM5A 4R69A 4EW6A 3OJEA 5L4SA 1NQOA 4CJXA 1QYXA 4UUNA 2JHGA 3H9GA 3AOEC 4S3MA 3RU7A 1IHXA 3PYLA 2FSVA 3IC5A 4OOEA 5COQA 4YQYA 5ILGA 4EGFA 5CDUA 1UZLA 2G76A 3EVNA 2BFMA 3NT5A 4ND1A 4GPD1 1JW9B 4K28A 1M76A 2RAFA 2EKQA 1LQUA 4IDDA 3S1LA 1Q0QA 3F3SA 4NBVA 2C2YA 3OBBA 3D4PA 5DOZA 1JKJA 3CMCO 4AJ1A 5I7SA 3TZCA 5CFZA 3QP9A 2WD7B 4GBJA 4OIMA 4AJOA 2PZJA 4JQCA 3PEFA 3ZWMA 3ZW8A 2QIOA 1NVMB 1E3JA 5A06A 3DBVO 2D0IA 1NBOA 1W73A 3K92A 5A03A 4GL4A 2OFPA 4YQZA 4DPMA 3IP3A 3GHYA 2UVDA 4H3VA 2FRDA 5C37A 1KVQA 4IDBA 3S2IA 1LEHA 4CLOB 1K6JA 3SX2A 4WLOA 2JCVA 3JQDA 4J7CA 4L0QA 5ICMA 2ZK7A 1JU9A 5BR7A 1IOLA 2F00A 2ZYGA 3PDUA 5JFOA 2O4CA 2Q2VA 2VYND 2HU2A 5AXDA 3UVEA 3RUHA 3NJ8A 3ASUA 2YDYA 1O5IA 3VAZA 4B3JA 1CEQA 2NUAA 1F17A 4XGKA 1GUYA 3PTZA 4BMVA 2O3UA 1ULSA 4WLVA 2ZTMA 3ZNOA 5I7VA 1X0VA 2HAEA 4B4UA 2GRAA 2X9NA 4Z3KA 4IDAA 4Q3EA 1F8FA 2FPGA 2NTNA 3MJSA 4RVSA 3IUPA 2NWQA 3AI3A 4GVLA 1JA9A 2GERA 3ZV4A 1Y5RA 5TNXA 2P4QA 1N1EA 3O8QA 3MEQA 4Y9DA 3GY0A 2POQX 1I3LA 1DHRA 3N58A 4WCFA 2WSBA 4CM3A 4AJKA 4CV2A 2CVZA 2E82A 1J5PA 3EAGA 3JCZA 5GZ1A 3ZGYA 4CUZA 4AJHA 5L3ZA 4AICA 4CLHA 5CP8A 1G6KA 1JVSA 3KB6A 2A9FA 3ZWOA 2Y67A 3WMWA 3RC1A 4XX0A 5BSEA 4BNLA 4IIVA 4YCAA 4L76A 3OIGA 2GCGA 3PFFA 1LDMA 1ONPA 4BNIA 3GF4A 3C1AA 4FIZA 3ZNNA 2QYSA 1O8CA 4ZJUA 4CLRA 4TSKA 1HKUA 4IDEA 2Q1WA 2IYOA 5KKAA 5K0ZA 5DP1A 1ML3A 5TLSA 3WNQA 2D59A 1D3AA 2BH9A 3ZI0A 4YJFA 3IIEA 5KKCA 4PLWA 5B37A 4N54A 2O2SA 1NQTA 3GEMA 4FD3A 3WWYA 4AFNA 2X22A 2CMDA 2I76A 3BAZA 2J5KA 1WZIA 3OJLA 2NQ8A 2AHRA 5I9NA 1B0AA 1T24A 3RASA 4FOSA 3H6KA 4D79A 1LSOA 3H5AA 3UH1A 1KC1A 1N8KA 3KXDA 4XQGA 3NTRA 4JROA 2E48A 1I2BA 3H9JA 2W2LD 4DMMA 3UCFA 4MVJF 2FZEA 3ONFA 4ND2A 4JXKA 3LC2O 4Q39A 3TOZA 1HETA 3O38A 3ROPA 3ON5A 2W2KA 4HBGA 1UXJA 3H7AA 3UXYA 3LF1A 4KQWA 3OETA 4EEZA 2J8ZA 1LLUA 3TJRA 3DFUA 2AQKA 3LC7O 1HWYA 3I3OA 4J9VA 3PP8A 1O89A 1XKQA 4FFMA 3RJ5A 5LDHA 2EKLA 3ITKA 4YPOA 3AW9A 4I5EA 1QMGA 4ZQFA 4MVJP 4DMLA 4WPGA 3I9KA 5EL0A 1EK6A 2O3RA 2VT2A 3QVXA 4TVOA 1DO8A 4KUHA 4NH4A 4ALLA 3U3XA 1JWBB 1PJQA 3QWIA 3F4LA 2EJVA 1CQJA 2O3QA 4FFOA 3JYLA 3LLVA 1WLYA 2VYVD 1LSUA 1FDWA 2I67A 2EHDA 1JAYA 2D1YA 2Z1NA 1U1IA 3R3SA 4BO1A 4UUPA 2W2KB 1X7GA 2G1UA 4J4TA 1A9YA 4GSKA 1H0KA 1O6ZA 1VE9A 2EV9A 1I24A 2QG4A 4LISA 5L51A 2CDAA 2CF6A 4CUJA 1T1SA 3EVTA 2YV1A 4OQZA 3PJEA 3M1LA 4BKQA 4F3YA 3ZDFA 1IL0A 1J49A 2VOJA 1ORRA 2R00C 5B4TA 2NV6A 1SCUA 3BMCB 4J4BA 4WLNA 4BMSA 4UREA 5JDCC 3HDYA 3IUSA 3Q9UA 3RBVA 3MJVA 1LDBA 4DPKA 1LX6A 4I5FA 2JCYA 3E5RA 5CEFA 2GD1O 3PIDA 4FGWA 3H5RA 4YVFA 1C3VA 1UZNA 1HDZA 4EUEA 5IZCA 4J6FA 2CDBA 3HADA 2YHIA 3GG2A 7ADHA 5JC8A 1YKFA 4P8RA 4Y6SA 1DAOA 2H9IA 3NT4A 3LDHA 5KJCA 3WMXA 2PD3A 1T2EA 4UUOA 3KLMX 1PL8A 3NAQA 4F45A 3JQAD 4TKLA 4EJMA 2P5UA 1U7HA 4NPCA 2B4RO 3OH8A 2XF8A 1CETA 2XAAA 5BSFA 1I3KA 3H4VA 4RVFA 2QX7A 4OKNA 3RJ9A 2GZ3A 4L75A 2D2IA 4GX1A 1YOVA 4EI2A 4NMHA 3DZFA 4GMGA 5ER6A 4E32A 4NBRA 5DBIA 2Y0CA 1I0ZA 2C82A 2JFHA 2PWZA 2BHLA 3PDJA 4Q3AA 4UVEA 4BB5A 1LNQA 4J2HA 5COAA 1YBMA 4I9UA 4A2CA 1I33A 5IZCC 1U8XX 3WIDA 4WNCA 3A06A 2C59A 1PR9A 4Q9NA 5BT9A 1V35A 1DLJA 2YZ7A 5DT9A 4G2NA 1LU9A 1F12A 3EW7A 3P5SA 3FWNA 4YA6A 4J90A 3WTBA 5JCXA 4RF4A 1RM4A 3PLRA 3QW2A 4AJEA 5I8ZA 2FR8A 4YJGA 3OP4A 4PLYA 4BGVA 3U0BA 1NQAO 2WEKA 4E21A 3GUYA 4K1LA 2VUUA 3W6ZA 1UXIA 3KZVA 4PZCA 1P1HA 1BGVA 3A4VA 1YWGO 4HFNA 4BNKA 4MVJG 2JD0A 1T4BA 4GQAA 4XWYA 3RSHA 3CXRA 3RCBA 1MLDA 3ZNQA 4NBUA 1EUZA 2PKQP 3IDSA 3GMDA 1WWKA 4QTZA 4HFRA 2BGMA 3RFXA 3AU9A 3IL2A 1EE9A 2Y93A 4R1TA 3DAGA 3QWAA 1B26A 4E5MA 3DXFA 5GMOA 5IJZA 3QVWA 4AJPA 4R9SA 4DBZA 4W4TA 2EGHA 3VPHA 3O8QB 4B8WA 1GYPA 3BYZA 1M67A 4IDFA 4XIJA 3CUKA 4QSMA 1HF3A 3DZGA 5HRUA 1UR5A 3RFVA 3A9WA 4ONEA 3D4NA 1YJ8A 2X1HA 4CV1A 1PQUA 4PIVA 2ZB3A 3KEOA 2OZPA 3I9LA 5JDIC 4HNGA 4DIFA 5JE8A 3VHRA 3L4BA 3DZBA 3UUWA 4WLUA 1LA2A 1E6WA 1OZAA 2AMFA 2NACA 3VZPA 2I3AA 5F1PA 1NASA 1R4NA 3G1TA 3GZ4A 4BNJA 4OQYA 4D0RA 4CMAA 1YDEA 5T8KC 4DWVA 1DC5A 1W6UA 4P38A 3ZNPA 1ONOA 3KLPX 3ZH2A 3U49A 3PPIA 1TEHA 4J1SA 1ENPA 4IGEA 1NHGA 2WM3A 1JTVA 4P22A 3GAFA 1BG6A 4BNUA 3DL2A 5FFFA 5AXBA 2CUKA 1Y5MA 3JQ8A 1ZBQA 3GRPA 3IKTA 3E82A 4TROA 5U4QA 4R4JA 4E5YA 1D7OA 1VJTA 2C29D 1LC3A 2Y1CA 3A1NA 1C0KA 3E9QA 1YB1A 4GX0A 1AN9A 1B15A 2FMUA 2QQ5A 3C8MA 4GVXA 4J0FA 3L4BC 2IXAA 4BO0A 3ANNA 1PGPA 1T25A 3QWBA 4INAA 3W1VA 4BO2A 5JAIA 3DMTC 2YFQA 3IQDB 1LRKA 2EWMA 1HDCA 4CL3A 5ICSA 3I52A 3GVHA 3PGJA 3UOGA 5DOVA 5L7WA 2AA3A 3G3EA 4HX5A 3LYLA 1ZMTA 3KYCB 3RC7A 4OOFA 3JD0A 3ZN2A 2PGLA 3ETGA 4XA8A 4R9RA 1FDVA 5JCJD 1PJBA 4OMUA 1ZZEA 1F8GA 3HNPA 1R4NB 1TVEA 1QSGA 4W7HA 1SC6A 1QYDA 1VL0A 5AVOA 3WS7A 4NFYA
chains in the Genus database with same CATH superfamily
4P5PA 4HWPA 4MGIR 2BCJQ 1SQFA 2IGBA 4LBZA 1OIVA 1SO8A 1IN1A 2QTVA 1KY2A 1BCRB 1II8B 2QRMA 4RS4A 5FTLA 1RR6A 1Z5NA 2CNWA 2VDWB 1BQ3A 1GTRA 4RCZA 1G16A 2RK6A 4P0TA 1J23A 3RS3A 1RHMA 1GTZA 1SHUX 3PHGA 1C9JA 1KYQA 1TAHA 3IDFA 2ADFA 4HGYA 2NO4A 3U3OA 5AHXA 3ZYCA 1ACLA 3ZHVA 3LFTA 3R5TA 2GFHA 3LFHA 3TQHA 1YFLA 1M34A 1U3UA 4HLQB 4YJHA 4B32A 4QJ5A 4TXJA 2NQTA 1H6DA 2R4QA 2PMKA 2ZDGA 5A5GA 1PL0A 3ILYA 4FHDA 4KZPA 4NFHA 2C2BA 4XM1A 1NC1A 4XUGB 4Y0NA 2I2FA 3LQ4A 4PCAA 1V3QE 1Q7EA 3NEAA 4JLMA 1WP9A 1Z4QA 3EHEA 3IQZA 3NHFA 4K9MA 3UAOA 2PGJA 4JI4B 1K4MA 4MR9B 4TVSA 2GSDA 1XD9A 3ENVA 4HDMA 3R8CA 1U28C 4C0SA 1BHJA 3PE6A 1GPAA 5C8YB 1INLA 1NKVA 5BY2A 5AVTA 2YJGA 3CTPA 4HWOA 4TRRA 1TF5A 2PGDA 5I4IA 4S12A 1XHFA 1UBJS 4D3YA 2HMUA 4HWSA 1FFDA 1X74A 1ZLXA 2XLCA 2XUDA 4XYGA 5LDGA 2WYHA 3DQPA 3IX7A 4COKA 2ZIXB 4K9OA 1DBQA 3L7AA 2EFJA 4D9NA 3ZBPA 4F38A 1E5XA 3AY0A 3G13A 2BFOA 4RD2A 4DCVA 1MX9A 4QWWA 5CA1F 4I1SA 5KHOC 3CO5A 3KSZO 2LCIA 1L5FA 3ZGXA 2FWAA 2COUA 3PHJA 4YRDA 5I6DA 5KTRA 1JHUA 4RE5A 4ZCLA 3UQZA 3FOZA 4K46A 4X0EA 5AUPB 2VAPA 4R8RA 1KO7A 5I8PA 3VNAA 2GS9A 4O4LB 3JAKB 4DCMA 5KYGA 2XCTB 3L7OA 3K70C 5DM4A 2VDLB 2XW6A 3V7FA 3WIEA 3UEOA 1VYUA 3L8HA 3HRKA 2EX4A 4M86A 3VNQA 2XDWA 3SEFA 4F8EA 3OQHA 4WY5A 5DBOA 2W2TA 3DMTA 1K6MA 4JLPA 4OATA 1C3XA 3G68A 3PI7A 2A94A 4MROA 4W8HA 3L2OB 3OLXA 3TD2A 1WQ3A 1Z62A 2BFFA 1AQLA 2H48A 3F0TA 3KS9A 4FOOA 1ISMA 4UVIA 3HA3A 5JD3A 5TXGA 1HOTA 3NOOA 2AUNA 3SBOA 5KTNA 1IH8A 5IM5A 2CFIA 3EJWA 5LUAA 3C87A 4MVJD 4YJKA 4UM9D 4ZRDA 5LZ2A 4RHEA 4WGGA 1V9LA 1X7HA 6PFKA 4F04A 3G23A 1A5AB 3IOYA 3QELA 1XTIA 2FNAA 4I08A 4NV1A 3HRIA 4RH0A 3HGMA 1R6TA 5J4VA 2AQ8A 1Z0SA 1W35A 1R3UA 3KSBC 3H11A 2DETA 2C9OA 4QYIB 3U09A 2Q2OA 3I23A 4NOLA 1MGOA 3NHYA 5KYVA 1K08A 1QZZA 1VLZA 3DBRA 1GQSA 1QKKA 1U81A 2ZXFA 5BR1A 4WJZA 1RP7A 3EG9B 2Y68A 3DT9A 4QRHA 3A9RA 1CF9A 2GVDC 3SLKA 1JQJC 4HTFA 3RFTA 3SPXA 4EELA 1T4CB 2FLVA 2W70A 4O4HF 1EP3B 4RTPA 5CBPB 4CMEC 4X97A 1MOPA 3M6LA 3ESAA 5IKOA 1IN7A 3AWDA 3MTBA 3MWDA 1UWCA 3LUJA 4WESB 5EHNA 2P9HA 4EMTA 3OQ1A 2HMYB 2BF7A 4RFSB 5IT0A 3R9KA 3WQSB 2GZDA 3QPVA 2JFZA 5HE8A 4X8LA 4DLSA 3KTAA 4UEOA 1T8PA 1XTUA 4KRGA 4F60A 1UWLA 1IHOA 2DUMA 2JIOA 3KUXA 3Q0TA 4BRZA 4Z1MD 1CS4C 2Y6VA 2CJWA 2A9QA 3LQYA 3EPKA 4H1VA 3H7IA 3JXEA 3P0RA 1R00A 3BX1A 4K9DA 5DWVA 5E7QA 4ZKEA 3UMFA 1YRQA 4A0QA 1UEXC 3RU3A 3ITNA 1PV4A 1E1YA 1TJ3A 1E6LA 2GK3A 1GWNA 1P9LA 3G9UA 3R5HA 3A14A 2ZJ6A 4HS9A 3T4UA 1DWUA 4F7DA 3OO0A 3NIDB 4YMLA 1GIAA 1UJBA 4W6QA 1NNLA 1SC4A 1L5RA 1UKYA 2ANCA 4JFRA 2ZSUA 1IVYA 4NI5A 2OYCA 3TLMA 4IMJB 3F3KA 3E03A 2HLDA 3WZLA 2J5XA 5BWCA 2JEOA 1GGJA 3BXEA 3KB1A 4P58A 4B9EA 4MJXA 3SZMA 3WB2A 1AGPA 2PKQO 3C7AA 4YLEA 3WGLA 1CY7A 4AJNA 4F4FA 4EVQA 3X2SA 1NVWQ 1UPUA 2ONYA 3TTVA 5E1BA 1ZGHA 2J48A 4K6FA 1M1YE 4K9LA 5CW2A 2N3ZA 1A77A 1A69A 1K1EA 5JS6A 3MYYA 3EZ6A 2GYWA 1B6GA 2LBPA 3CNLA 3JQFA 1POWA 4QOSA 2X2PA 1AKVA 4Q6BA 2FY8A 3UHFA 3HN7A 2ILTA 4G0NA 1ESMA 1YZLA 1YVEI 4HNSA 4OLFA 4CM9A 2JLWA 5K1ZA 3K2IA 2PSHA 5B3AA 4BB0A 2PVCA 3QUBA 1CCWA 2WJJA 4KRXA 1G8MA 3V5NA 1R0KA 2ZAGA 4HADA 4B3XA 5FBWB 5JXWA 3WGVA 2A0KA 4G0PA 4R6XA 1KEZA 1MJNA 4ENWA 3DMFA 4DANA 5TMPA 3I9OA 4TZ0A 4IDCA 2QZPA 4EQ6B 4ZQEA 2YASA 1BJRE 1V8DA 4TQUS 3ZVKA 3O94A 4P7KA 5KKNB 1Q16A 2P40A 4I1RA 3OIYA 1U90A 3SG0A 3G6WA 1ONNA 5ARCA 3W5BA 1K7YA 1RS0A 3CLKA 4J6EA 1OPRA 4RBNA 3RF7A 3GP3A 1DU4A 1XAIA 2F59A 4CDMA 1EA7A 3DL4A 3OPXA 4NEHB 5BP7A 3E18A 5ECDA 1FBNA 1VBMA 2GPYA 2HD4A 4C0AC 1DSSG 1CR2A 1HDGO 3VHXA 2ISSD 1QV6A 1VRCA 3SC4A 3UY4A 2RJOA 4UTRA 3DMNA 3MWJA 3NR2A 4J9UE 1JDZA 4YAWA 3F7OA 1P4JA 4D0LB 1XQXA 1Z7GA 1N5DA 5DFAA 4Q18A 3PDWA 3OWOA 2DFDA 5D5QA 1XNHA 4FFNA 1QTRA 1XLVA 3WR5A 2FTKE 2V5AA 1J6UA 2ZRIA 4Q19A 2O2CA 3JD4A 2ZTSA 3KCQA 1EZZA 1U9IA 1XJQA 3ANMA 3CW2A 4MVWA 1N8SA 1WXDA 3ONWA 3U4CA 4WZBB 3SMVA 1NA5A 1W36D 1AG9A 1NMZA 2DTDA 4CCAA 4EI7A 4Q1CA 4UCWA 3MLBA 2PMWB 5JSKA 1VSVA 4WH0A 5HA5A 5B53A 4F9FA 4PAMA 2V59A 2BN4A 3IERA 1PWZA 5D1NA 2YYYA 1E2EA 2WJPA 2RAPA 3DNPA 4AG5A 4POAA 2Z5VA 4LXYA 2OHOA 2G4CA 3TQTA 1JFRA 3C6QA 2CCKA 3GFFA 4EPYA 2ADOA 4FQ5A 5EJ2A 1N0HA 5A5FA 5BO5A 3RUFA 1EVEA 4NOMA 3GJ3A 2R1TB 1WMSA 4PLVA 3SKXA 3QVKA 2VKTA 3DVRX 5ITWA 1BCSA 5KC8A 5AKHA 4X65B 4MKIA 1LVGA 4NG4A 4WTOA 1RKUA 3IR6A 1FSPA 5GOZA 3KBOA 1D5WA 1C30B 4WCFB 4D8VA 1FDRA 5I5GA 1RM0A 1GPLA 3DO6A 3ZU2A 2HW8A 2RHOA 3LL4A 1R4MB 5FUVA 4CHTA 4DY6A 4R54A 3HB9A 3BJMA 1QO0A 3D6UA 4GUDA 1G20B 1VKOA 4TKUA 1W1WA 2J6BA 1L7QA 2H4HA 5ICGA 3U16A 1M5RA 3FWYA 1Y4AE 4WUTA 4NYMR 1H94A 1R10A 4YO8A 1VHWA 2LIVA 1YK0A 1B3BA 2PYDA 3MOIA 3OEWA 4I36A 4L95C 4DLLA 3UNXA 4ER5A 4BX2A 4UTXA 1US8B 3HCDA 5AVZA 1YD7A 1GDHA 2FN7A 1EB9A 3FDJA 5F2KA 1L7VC 2Q5HA 4YMWA 4E5UA 2WMNB 3D2BA 3I0MA 5IDWA 1AT1A 4C03A 4JHLA 3A4IA 3MT8A 2Q5IA 4OQXA 4XX0B 1ISHA 5A4DA 2X0NA 3FOFC 1SBCA 1KJJA 2R8EA 4DLKA 2WSMA 4LNUA 1HE4A 3E9ZA 4J3FA 1RHUA 1HT0A 4DXHA 1Y3IA 2ET6A 3MFQA 2HXYA 2F43A 3W4KA 4BNNA 4MRVA 1HG0A 3JZAA 3NHBA 4KUGA 4GNKA 3VPXA 3B7WA 2W42A 4UTOA 3G7SA 1GT6A 2BELA 4YRMA 3L9WA 4XB2A 4P3PA 1YFKA 4DM7A 4X44A 5LP6F 2VJNA 1JILA 1EWRA 2O2JA 4FFDA 4E03A 2FXIA 1OBHA 3WGKA 2ZBRA 3ZVNA 3F90A 4GQBA 2RBEA 4ZT2A 2FMXA 2NUPB 4UJ3A 1W29A 3OZBA 2PGAA 1KIFA 1T36B 2NADA 2VHYA 5JNSA 1YJAA 4N5IX 3HB4X 2YW9A 1KP9A 2QRLA 2A5YB 2XTMA 4D57A 3VMMA 4V0KA 2Q3FA 3D3EA 2IIVA 1NM5A 1OROA 1SHTX 3OZAA 1YVPA 5BSMA 1XRPA 2BZSA 3NEJA 1KJQA 4KPUB 2I8AA 3H0EA 4R3WA 1GZ3A 1KZ4A 4RETA 4D4JA 4YJ2A 3KEMA 2BP7B 4WADA 5DM0A 4JAVC 2IJGX 4PS1A 4YMTA 2UVPB 2Q2NA 1U8YA 1K86A 4KIUA 3IAAA 5EP1A 1VXRA 3KVYA 3WG9A 4LA4A 1SKAA 3L43A 5IVIA 4MQBA 4RGVA 3VSEA 3W8RA 4JB8A 3UG6A 4EYGA 2CDCA 3A9UA 3F71A 3T5DA 2Q0XA 2QJFA 1M6YA 5JMWA 4DV6B 4XDYA 1JEQA 2HFJA 4U6QA 1RRPA 4OXQA 2YRXA 1I2AA 2XA2A 1MNAA 1EIZA 1MX5A 2ZUSA 1SEVA 4YCJA 5A4IS 2WF5A 3QXCA 1OB2A 1O9BA 4D8UA 1TUIA 2WIGA 3U7EB 1BYIA 1E3LA 1E1RA 4AMUA 3K9NA 4KQ6A 4QGBA 4EO9A 4F9TA 3MMZA 2FE1A 3OU7A 2GEDA 3ACCA 2OYRA 1JEEA 2CNDA 5EIHA 2QHXA 5GGXA 3PV0A 4AZWA 2VL7A 1A8UA 5JXHA 2AN5A 1P81A 1Y8CA 1SG0A 4DJFC 2ZIEA 1WKCA 1X1EA 4OP2A 2XD4A 3R7LA 4UDNA 1DLIA 1EJBA 3AFMA 2VP3A 4DPLA 2FWIA 2HJSA 5AW2A 1BW9A 4BGDA 1ZL0A 1ZS9A 1QOZA 2HWYA 3GUUA 5CDFA 4EG0A 1NI4A 3LPDA 1H1LA 1OB5A 5J2TF 4XYBA 4ZTZB 1EQUA 3ZDYB 2I2WA 3AEKA 5T3UA 1MQSA 3I9JA 2DHEA 3LX8A 5K01A 1RMYA 2XQVA 3FM9A 5IAAA 10MHA 4JMLA 5HDBB 1FK8A 1T6NA 3ZDXB 1QRUA 4ZK2A 1ZO8A 1SCDA 4OXKA 2EFCB 2BMEA 3QU9A 4ZMBA 5ES3A 4N9WA 1KQFA 1GL7A 3NVDA 3VU9B 4W5TA 1CDDA 4OO3A 1I10A 1XHEA 5CGQB 3T3DA 3NDRA 2WTBA 3X1ZA 1PGJA 1PGOA 4Q7MB 1B74A 1N7IA 3R1IA 1CZUA 4UARA 4RD1A 4XLZA 3VR5A 5LVAA 5I7EA 1BXRB 1K6EA 2B5OA 3N0XA 3OFND 5H1YA 5SYMA 5TRTA 1MOQA 4P3OA 4KIGA 3OESA 3NBXX 1OFUX 3E70C 3PRHA 5H68A 2RGBA 5SICE 1I7DA 2FMTA 4N3BA 5TE9A 4BCDA 1C1HA 4RIEA 1N7GA 5KQLA 4ES6A 4JNGA 3WQRA 4PWZA 1RZUA 3WV5A 3OT1B 4MIYA 3GOHA 2OLKA 3CLUD 4IPTA 3OIUA 3ROGA 2FF7A 1NR7A 3WJ7A 2ZJ5A 4PHFA 1Y6ZA 4MRNA 4U2BA 2J4FA 2EP8A 4HDQB 5A3QA 5M04A 1JV2B 3VNSA 1XRMA 3X44A 1TUBA 4M49A 4HMOA 2WJ3A 4Z0TA 3ZLVA 4AZSA 1Y81A 4B8ZA 3AM3A 3P71T 1K97A 2J1LA 5DRTA 4C08A 1M7GA 3RAFC 2QZJA 1YZFA 1M10A 1WCXA 3LT1A 4W9NA 1GHTA 3WLRA 4MWEA 4NK5A 4ENQA 3IVAA 1P5ZB 2Z1MA 4A6DA 4CRWB 4BFUA 2BZ1A 3QPAA 2WFLA 3DTVB 4DCOA 3CE6A 1QHFA 1K8YB 1G4UR 2R8YA 3H11B 4BZZA 3FFTA 2H7CA 3FYDA 5HCNA 4WHMA 4CNQA 5B57C 4K7JA 5MN4A 4RM2A 1CUCA 5FQOA 3VR0A 4G24A 2V5UA 2YQ4A 4ZRNA 4Q4JB 4TLAA 1JAXA 4XVUA 3RARA 4GRDA 3CLUC 3EPRA 2CBZA 2PZEA 3ASYA 4MVCA 3ZXXA 1IMJA 4BVJA 4ZTUB 2L42A 3FX2A 3CEJA 2BTEA 3MCAA 2PTGA 1SPXA 4TZKA 3NYQA 3H17A 4MVJI 3VPCA 5IZ4A 3AR7A 3A1TA 4EMBA 4MWSA 4B7XA 4F6RB 4WBXC 2KSQA 4H2DA 3WGYA 5KOJB 3DOJA 5C9ZA 1FOEB 3KHTA 1HC7A 4LJYA 5AI0A 4ZD6A 2BR3A 5I4CA 1A9ZA 1W8DA 1L5HB 1U6IA 3L0BA 3KQPA 3GRAA 2FPIB 2JVJA 2Q5FA 3MS2A 1VLJA 4N6NA 2ZYIA 4W1QA 4XIGS 4YI5A 4EKDA 3QHAA 3U7HB 3GAZA 1BA3A 2C7GA 3WE7A 1AH2A 4NL4H 3A0UA 2X42A 3E22A 5JCJA 5JSUA 2QM8A 4DMHA 3IT3A 3A1EA 1RE1A 4PZLA 1KFJB 4MUKA 4NU6A 1VRVA 2F3QA 2BEVB 4P36A 2NSLA 1THGA 2VUTA 1OCEA 3N8HA 4E22A 1ZN2A 3BGOS 2ZT8A 3ZZTA 5ELLA 4TYPA 2BKEA 2Q27A 4J0HA 2OUIA 3AT1A 5DLYA 4EMSA 3PC8C 1LGYA 2MINA 4IQGA 4C4TA 1JZTA 1SK9A 2J0VA 3H1GA 4E5VA 2C5HA 3B9RA 3V8PA 4F21A 5J4HA 2VP4A 1OX6A 1JLRA 1SA0A 1TMYA 1GRRA 2FVYA 2IZ1A 2XE8A 3EIHA 2D54A 2ZJBA 5EINA 2WU8A 5HTOA 4DJTA 3PPXA 1Z0ZA 3GUCA 3K6RA 1M7BA 5CNJA 1WBDA 3SEZA 4Q9LA 2BHSA 4YJ3B 2V74B 3GEEA 1HYEA 4QPJC 3VPBA 5KSOA 2R9VA 1V8ZA 3N0RA 2FPPB 3IJEB 5DN9A 2NVBA 1TYBE 1OI3A 3ECSA 4IVRA 5LYJF 1CQXA 4BV3A 1NLYA 4AYTA 1AS2A 4QBKA 2EWVA 3VJMA 5FF9A 1X7ZB 2OK8A 1G8FA 3S8MA 1ZC4A 4MI6A 1XYVA 1JWAB 4LFBB 4JBNA 1SHLA 2ZBDA 3BDVA 3JATB 4MPTA 4DOMA 1K5GA 2J3EA 3OQIA 4IIBA 3AUSA 2Q3EA 1CEYA 1L8AA 3GEPA 5BN4B 5CLHA 3RVJA 2GEBA 3DHEA 3ZE1B 2ZVDA 3IHLA 1I4DD 1B0UA 4DR1B 3PZRA 2EVWX 3UWOA 4RE6A 5DYWA 3AXSA 1XEXB 2QT1A 5CX1A 3LFUA 3OQPA 2J3HA 3JQ8B 4FXPA 4AULA 2HCJB 3MCTA 5ALOA 3U9TA 2HYDA 3Q88A 4F5YA 1NWCA 4PO9A 4ODIA 4QFBA 4UCXA 2OXEA 2ZS7A 2YNMC 2BGLA 4HDKA 4LBWA 3VX3A 5J58A 5E6UB 2BMJA 3Q0IA 3ZBUA 4MP3A 4BFXA 4ER0A 4QYMA 3DZDA 4WSOA 3TGWA 3TRIA 4MEJA 3EPLA 4QE3A 4J7XA 2W22A 4B3FX 2E4AA 4PSAA 4C4OA 1W96A 1XIVA 4H7PA 4ZT6A 4Z3DA 1G59A 121PA 2WTUA 1Y7PA 3DC2A 4KBGA 2X5OA 4CM6A 3SXPA 4HX9A 1ORIA 3T1HB 2B83A 3OTWA 4KWEA 2BP7A 3VZCA 1FSFA 3SYKA 3N5CA 4E0BA 2I9KA 1LQTA 5I51A 3LJKA 2DUUA 4NHEA 1YT5A 3TZ6A 3MC1A 3AFOA 3JX9A 3PU6A 5LBIA 5IX8A 1GZ5A 1V1RA 2EQAA 2GCOA 3C15C 2MR6A 4WOKA 5TX7A 3TN7A 2G5CA 1QB7A 3E9RA 2VP0A 4HOYA 2P2NA 2ZIVB 2VHJA 2VYNA 2WWRA 3PVSA 1QXSA 5DM60 1UDAA 3QVTA 3TSAA 1J00A 3E9MA 3LUDA 4HXFB 3CV3A 4BQQA 2BF4A 3AI7A 2BBTA 3REQB 1I2DA 2R6CA 1X7YB 1N6OA 1JDJA 5IC5A 4YJ3A 2I3BA 2YIJA 4WGFA 4EITA 1AN0A 4YRCA 4B47A 4EUNA 1E3DA 1KWGA 2JD2A 2DY1A 4NE2A 4LCBA 3TCNA 3PXEA 2RHDA 1YHYA 1ISGA 3P9KA 1LH0A 1XP8A 3HWSA 3WL6A 3H83A 1XZHA 3R4CA 2IUSA 3GT3A 3BWDD 4MHSA 2FN8A 3DKIA 1SQGA 2W8BA 4I4IA 5AI6A 2PFSA 3SS8A 4E2WA 3MBOA 3NHPA 3S2SA 5KNBA 1RHKA 1D1SA 2VYQA 3QWHA 4ZVSA 2ANBA 2C54A 2I7CA 4MQLA 4NZYA 2H18A 2OCLA 2MSLA 2W58A 2FV8A 2ZS8A 1AA6A 4GX2A 3OLVA 2WDPA 4UEQA 5AJYA 4LZPA 3R5JA 4URZR 3LUGA 2A6PA 2W98A 4PVDA 3W3AH 1NVAA 4MVJH 1XTBA 3WRXC 4F2HA 3HN2A 4EZIA 2JJ1D 2WNIA 1CQJB 2YXDA 4KUEA 1ZXBA 4K9RA 1BW9B 2A5GA 3SJ7A 2V3VA 2WWGA 1JKIA 4JJ8A 2DPLA 3ILSA 2XCQA 3NYWA 5J2UF 4GL2A 1SU7A 2DBQA 3VV2A 2H1IA 3BIXA 2O54A 3GELA 1DX6A 1CWUA 1XV5A 2B37A 3WMGA 1VDMA 5IT9A 3SFTA 1ZUHA 1YZKA 1BJKA 2RKOA 3DXZA 2TS1A 4OBBA 5KINB 5LP1A 2HJHA 1W34A 1J8MF 3GR6A 3OSUA 5SY9A 3RGGA 1HY3A 1WZCA 2P4UA 2WQZA 4TXMA 4YMIA 3TSCA 5ENDA 3WMFA 3W5AA 1DC8A 2XYPA 5JVDF 3GJRA 3TBKA 1QH1A 1U3WA 3AL3A 3JZFA 3K8ZA 3TS1A 2BFPA 5G0VA 5HUQA 3S29A 5HIMA 4I0WB 4D9HA 3HGTA 3MMXA 1U0LA 2J41A 4YASA 2ERCA 2RKWA 1OOEA 3WLJA 4IZIA 1D6NA 1N2ZA 2YWRA 4HUJA 1GN9A 3F6CA 1NVTA 1XAJA 3FGNA 3RO7A 1PG0A 4RJIA 4XDZA 4D3XA 3JS5A 4U7JA 3OJ0A 4BKRA 5EE5B 4BMZA 1Y9AA 2WUWE 3CE9A 4QBHA 3SBDA 4B6RA 4RPGA 5EJ9A 1C9EA 2KJQA 3KV1A 1ZIPA 1Z6QA 2V1XA 4X92A 5D6OA 3RLFA 4A6EA 4DJAA 5BMVA 4PQYA 1QDUA 4AKEA 1GCOA 3MGCA 1M2NA 4YCLA 1A9RA 4DN6A 1WKBA 4WAUA 2A0FA 3HACA 1LPBB 3A37A 3N07A 3GJZA 1A3CA 3GL9A 4QQRA 2I2XB 1XU7A 2VWQA 3KOOA 3LT5A 2E7ZA 1FYFA 1TECE 2IXEA 2VP6A 4A3SA 4BQNA 2B1RA 3BKXA 3SF8B 3ANXA 4OL9A 1M8PA 5ELXA 4ZC1A 1XMSA 2DP4E 1BXKA 3PBKA 5IANA 2PEZA 4MOWA 3QVSA 2G8NA 2QN6A 4EQZA 2NNWB 2GJSA 1PWXA 3L1VA 4V39A 3G0DA 4G5FA 4EKEA 1WOYA 3MD9A 4FYHA 1XCPA 2JB9A 3Q2IA 1UBEA 2OILA 1QDEA 1RQXA 4J7UA 3CS3A 5F1OA 2JHAA 1VG9B 2O4UX 3W2HA 1H4QA 3PHCA 4X8OA 3SQWA 4YN3A 4JC0A 4NPAA 7REQA 3EZYA 4JK3A 1NM5C 3D2LA 3EG5A 1P17A 4OSEA 4QDTA 1Z83A 4C7KA 2A67A 3PKJA 4YAJA 4NESA 1Y9EA 5H7XA 3WKDA 4UDXX 5F4ZA 1QP4A 1UXHA 1FJ2A 3E1GA 2PQ0A 1YBFA 2YNMD 1E94E 2H08A 2AK2A 3LXRA 3B1ZA 5DIZA 3WB9A 5J40A 2ID7A 4GGPA 4AJIA 3G7NA 3RTGA 2G09A 3SS9X 1KORA 4BJ1A 5ITSA 5JRDS 5JCOC 3DOHA 3FCCA 3HU3A 3BFXA 3A26A 1IJBA 3RK4A 5EZ5A 1NI3A 5BXYA 3HJRA 3BRCA 3AZQA 1TW2A 2FPGB 4YDHB 3TZBA 4IOLA 1RC1A 1WNFA 2VHZA 3NT2A 4MV1A 1QHNA 3ROEA 5E0KB 4BKMA 2C31A 1ZW1A 1TVKB 1F6WA 1CUGA 3U3JA 2JIQA 4AL4A 4HH1A 1TJ4A 5FJJA 2C4TA 3OUTA 3X1MA 1FA9A 1Z2DA 1S4MA 1ZKDA 4HUQB 3UN1A 1SCKA 4LOJA 4RF5A 2FMFA 4ADSG 4EHLA 5LA6A 4YV7A 4LSGA 1TTQB 5AVSA 4B73A 3OA0A 3ZLAA 3LYHA 1QRDA 4X6YA 2EW2A 4FHGA 3RROA 2PWYA 1KARA 1Q0SA 3PNQA 5REQA 1MAAA 4BQIA 4YRBA 1PEKE 2ZSAA 4MP6A 1Z6GA 4RLHA 4Y2RA 4ECAA 1JQKA 2GZRA 2QTBA 4CF4A 3IESA 2W2LA 5DI3A 3TMAA 2P4HX 2AEEA 4PVCA 2V7WA 4ZVOA 4DUPA 2Q29A 3P9YA 5C8YF 3LS2A 4PLGA 3KTFA 2ZWVA 4R51A 4YCDA 4AXXA 2ODQA 5FTWA 1X7DA 1GITA 3AUTA 3T3IA 2H1WA 4U7HA 4BKPA 3BCSA 3S40A 5CBPA 1PI3A 4I9HA 3USCS 3VHXB 3LP6A 5A6SA 3G0GA 2C0QA 1MVNA 1VLQA 4HAWA 2AK3A 4M88A 2VDKB 1WMBA 3PJFA 5CH3A 2YOFA 1XCGB 3TCXB 2JAWA 1IMOA 3PCXA 1EGQA 5AVWA 1ATIA 2AJTA 1CZHA 2I6GA 2IKSA 1CUFA 5KI6A 5IM4F 4QGFA 2RHGB 3IP7A 1YL5A 2XHEA 4DAOA 3OJFA 4IIUA 1NZFA 1E5QA 1BGXT 3IOEA 1QQBA 3GRKA 2NU9B 3SQMA 2X9VA 5FEMA 4HK4A 4FC6A 1WTCA 3VZRA 1MAWA 3HLKA 4LNUB 5KJ6A 4E30A 3BXPA 3FRJA 3EASA 2Q3BA 1Z7YA 5AICA 5HEKA 3KLOA 3V4OA 1AHPA 4LRWA 4EVRA 4TKZA 4A8HA 3R23A 4AZTA 3C14C 4BFTA 2DFLA 2QNBA 2H06A 3I9MA 5GV8A 4K9KA 1FIUA 2FJ0A 2YWGA 1U7TA 1U4NA 1ZCBA 5AVYA 2P6RA 4NCXA 4EHFA 1EFKA 4HPXB 3FWHA 4TMZA 5DULA 1VE3A 3SR4A 1XQ1A 4XM0A 2ID9A 2JIMA 3G82C 2AG5A 3PCTA 3M2TA 3QEBZ 1J2TA 1G20A 4TKUB 1QE3A 4FI3C 3CGGA 4LTDA 4BNHA 5IBQA 5CXXA 3G8DA 4N0PA 5HRAA 4AQ7A 1XYGA 4MV6A 3FR8A 1VI2A 1QO0D 4QOGA 4RPHA 3L3BA 3RHFA 3SNKA 2J6HA 2AQHA 2WG0A 3WX0A 3ZXUB 4LJSA 1RJ9B 4UCFA 3N8GA 3QX3A 4BVAA 3JQBA 2JF0A 1MX3A 1OFVA 3VTKA 2XPCA 1BDMA 1QFYA 5FTMA 2ZU6A 3CM0A 2HSEA 3T95A 3UFXB 1EB8A 2P4EA 1QAMA 2HF7A 1EBBA 1TKCA 4L8VA 3UT5B 1ZJJA 3JWGA 1VKHA 3IRUA 1XFDA 4D82A 4ZCIA 3EXFB 1CRPA 2FEOA 5GVSA 2V55B 1R7RA 5JTUA 1RJWA 4JEUA 5JTTA 4MDHA 3LVRE 4F4UA 4PYNA 2XVYA 4E4YA 1FZTA 1JHYA 4KSBA 1KR5A 5CA0B 5TPZA 1SG9A 1HR0B 4YRNA 3QUTA 1RPTA 2F3PA 2ZQZA 4Z2YA 3UMCA 1SRQA 2G17A 3AK4A 3HY3A 4FS8A 1CUUA 3V1UA 1ODIA 3KQOA 5IS2A 2AN9A 5D51S 3ZIAD 3JVUA 2OMKA 2BKLA 1MXFA 4BLSA 4F1JA 1LSJA 3KALA 4OY3A 2AYXA 2OCYC 2FK7A 3GLQA 3TRFA 4HEA1 2EZUA 1W48A 3IQIX 4GSYA 4HEJA 5KYWA 4AS1A 4CMIA 1EXMA 2ZE7A 4WERA 5HYVA 1SWVA 3I12A 3L77A 3MUOA 3RLIA 3HCRA 3A31A 3ETEA 4UFNA 1YC5A 2CHVA 3NDPA 2I7TA 3ZJ5A 2WJYA 5K8UA 3E05A 2O0KA 4H7IA 1ESNA 5FUXA 1Z4KA 4M6WA 1ZONA 4YJ3F 1X1SA 4WEQA 5A05A 4MDYA 4HLDA 1MJGM 2YWJA 3D4OA 2HHJA 1UADA 5ALYA 2C7QA 1MH1A 3DTNA 2FPMA 3I39X 4K40A 1J90A 1TJYA 4P31A 3C16C 3FWZA 4O29A 4EY5A 4Z5XA 2A1TS 4NOJA 1K5HA 3QH4A 4OLBA 1R27A 3DTTA 1NFQA 4PCLA 2IQIA 3SFZA 4A8PA 4PLCA 4IDUB 1UJ6A 3HJUA 4TQGA 4CMEA 1KE2A 5EEGA 4P7BA 4BYGA 3K0SA 1FYVA 2EKBA 1I3NA 1W25A 3FYUB 4OA8A 4XYMA 3GN1A 4CKBB 1XDBA 2CXSA 4GW3A 1JXAA 1IPEA 1YZUA 4RMIA 3LQ1A 4XIYA 1XMQB 2H3EA 2SHKA 3AZPA 3LLCA 4RFVA 5A9SB 2PZBA 3P9IA 2VT6A 3BMQA 1KO1A 3MWEB 4GYJA 1P0IA 4DEVA 1O0BA 1E5LA 2WKSA 1O94C 3WGGA 3OLYA 4KR0A 4NAVA 4TLEA 1Y63A 2CD9A 1HDRA 2ATVA 3CNEA 4HJXA 3Q0EA 5H4HA 3TNLA 2R8XA 1V8OA 3EULA 3GJ6A 3M70A 4TL9A 5DX1A 2GETA 3G8CA 5BRJA 3LUCA 4KWCA 4QREA 2DTXA 3DV0B 2GJAA 4X20A 2OV8A 4XR9A 1ZJWA 2UU9B 3NKFA 4JQSA 1OXTA 5BV1A 5FXMA 4REMA 1N1DA 4Q1AA 2OCAA 2XQJA 3FGPA 3G7UA 3MMNA 4K2HA 4B35A 4NH0A 1A2BA 1VIVA 3WSWA 5H82A 4A16A 4EB8A 1R9GA 1CERA 3GYBA 3IP6A 3JQEA 1Z6XA 4L9AA 3FHCB 4I8XA 1OAKA 4Q3BA 4R83A 1H4VB 4U9IS 4C07A 5CVTA 3QYPA 3I5MA 2A59A 2AC4A 3RR2A 1LRLA 3ZIDA 4D44A 4DLPA 5B5SA 5JISA 2CVOA 1MB4A 2HL6A 3P8ZA 4RWZA 2XB4A 5BSKA 3L7KA 4M83A 2G04A 3WYDA 2Q9CA 4E2XA 5I7FA 4DV2B 3WK7A 1C7EA 2QQFA 3CEPB 3OZFA 5T6BA 5KNCH 3PXCX 3L1IA 2OEPA 1Q84A 1E7SA 4UBOA 1FNNA 2B2XA 1U2DC 2CHGA 3M5CA 1U7ZA 1E3WB 2AF4C 3MTQA 3HBAA 4HXYA 3ESCA 5KPJA 3THWB 3K05A 4HNRA 2WFAA 1NT4A 1W8IA 4PC7A 3R7NA 2W00A 4FEGA 2JH8A 4C21A 4Y0AA 2FN9A 2B7BA 4TM7A 3WNBA 3TCKA 4EJ0A 8AT1A 2X3UA 3K8OE 4WKPA 1T10A 4TRJA 1V4VA 4BEVA 2DKOA 4HDRB 3RABA 1XA0A 3DE6X 3HUFA 3RU9A 3C98A 1X7XB 2VCYA 3C6ZA 4ILKA 1II8A 5EYPB 4U2DA 3CLRD 2CJXA 5D2CA 3CRRA 3WHPA 3ER6A 1KI3A 3K72B 1N75A 1FP1D 1NZJA 1ENYA 3HKCB 1EG2A 4M8IA 4MUEA 5KHAA 1MW8X 1QG6A 1SWWA 4IV5A 3ROZA 2BGIA 4OYHA 7MDHA 2H2DA 2UYGA 4F86A 5TGZA 4IDGA 2XUIA 4OLAA 3BSWA 4MWBA 3FDIA 2AC2A 3S7ZA 2QV0A 2PRIA 1VQ1A 4TKMA 5I3CA 4Q37A 2HV9A 1JT9A 1SIWA 4O02B 4UFPA 4PN3A 1MBZA 1V3TA 1ILWA 5CFOA 4DQVA 5JRZA 4K9NA 1MB9A 1G7SA 1CUHA 1ZNXA 4TN5A 1KNQA 4GLLA 3RV4A 4ZCRA 1PJTA 1BXRA 2M32A 1PYDA 4MUGA 4RHTA 2IY8A 3ER9A 3PSHA 1OXKB 2FW9A 1J7KA 4EY4A 1CVLA 4X8HA 4DUYB 1L7AA 2E0IA 4AWBA 2R8OA 1JDVA 1E1KA 4Q1FA 2QVLA 3ZQKA 5F76A 3BJRA 4YHHB 4LJ8A 1I3MA 1JR2A 1UMBB 4EB6B 2VTDA 2AWNA 2RHRA 2XYQA 4NYMQ 1Z39A 5LU8A 1Z45A 1ZFNA 2G82A 4UEKA 4B43A 2PTHA 3BDAA 3CPSA 3L1KA 3C6KA 1PN3A 3JASB 3AGPA 3ZY2A 2XY4A 1OTHA 1DVRA 3LQFA 2Q3LA 3MWKA 4JLOA 4C3VA 3R9XA 1FS6A 5B12A 2PH3A 1I2ZA 1PQWA 1ZGJA 2DH6A 1I4LD 2RGGA 3PB3A 4YLYA 1KDTA 4GR4A 2NZXA 4WD3A 1XNJA 3LUPA 1CW2B 4FFVA 4K6MA 3NVKI 4WL0A 2QLFA 2XUQA 4WZAA 1WHSB 2IE8A 2PM8A 3T0GA 1X9GA 3OKPA 4LAFA 8OHMA 2A9VA 3IMKA 1C41A 1OLXB 1NQUA 3MAJA 3OZGA 1F2UA 4LQDA 1JF8A 3NHJA 4QYSA 4UUAA 4DLBA 3OUZA 2PG3A 2G7MC 3PEYA 3H9EO 5AHOA 5BN1A 3PUZA 4FKMA 1T3GA 4FDAA 1ORWA 1XLWA 2GAJA 4BZQA 4JIMA 3A4NA 3WNDA 3AERA 4YCSA 2ZKLA 3MYRA 4F85A 2P5YA 5I3ZA 4W5HA 4OQMA 4QL3A 5IJ9B 3SLGA 4WN3A 1XG5A 5H70A 5AK4A 4GC5A 4WVLA 4KXMA 4IJ5A 5BN4A 4LW8A 2AFRA 2V8BA 2B69A 2BJHA 1T5LA 1TQDA 3H87A 4PFQA 5ADUS 4KFUA 5KWJA 4EATA 3Q3GE 1UBTS 4H59A 4ZVPA 5M34A 2J85A 1PZMA 5F3DA 4S1VA 4WXYB 2FN3A 1WA5A 3EGDB 3V4VB 5ITZB 4RJLA 1F60A 1DFGA 3G2PA 3LF2A 3LXMA 4E12A 5JS7A 3HTXA 2H5JA 2V6IA 1N8NA 2JIZA 4BEBA 3BG5A 3T1VA 1UPBA 1GA4A 1L7RA 2Q2WA 4XSVA 5I9BA 3ELDA 5SY4A 3FMGA 2H9AA 3VGJA 3OPYI 1G41A 3H2YA 5JJ5A 1E4EB 5KNBD 3OKCA 5GZ6A 3AY3A 1DBRA 5DBFA 1TC1A 3CKLA 1JR3E 1ZG3A 2QTVB 3M6XA 4UU1A 4QYXA 1RRKA 2C5FA 4H16A 1SBYA 1E1QD 1A96A 5CLGA 1HI9A 1Q7RA 4ZDJA 4UBMA 3RYHB 4LWPA 3I6YA 3EK2A 3K5WA 3EEQA 1P9WA 2VUSA 3DBLA 1E4YA 3MWYW 4Y1GA 2EQBA 5DP2A 1UT6A 2DUJA 1ZCAA 1DTSA 2O6LA 2ZS9A 3M1YA 4MW9A 2YYZA 2O5CA 4OMDA 1IONA 2P6NA 2F4VB 3ELWA 2WIKA 4KYIB 1II9A 3X1DA 1XLTC 3HO8A 1V8PA 4P4GA 2EQ5A 2Z2ZA 2ZWPA 4RHXA 5CT8A 3UAXA 2HSGA 2EP7A 1QNFA 2N47A 3DDCA 3HSKA 3H16A 3MB5A 4WUVA 4ED9A 4GYKA 3QY9A 1MG5A 4Y0VA 3H1FA 1P0FA 2XWSA 2EGUA 5GJCA 3L9XA 4EB3A 4YT5A 1I1HA 3K4PA 4CVNA 4RZ2A 2HA6A 3VVBA 4V24A 5JATA 1WG8A 3MELA 3L01A 4MKHA 1VG1A 1XSEA 1U7OA 5TMEA 4YMGA 8ADHA 2CJPA 1FS5A 2FW0A 4TWZA 5K09A 1BKDR 1UDWA 2OAGA 3WBFA 5A1TA 2XT6A 1U8ZA 3V4ZA 1XDWA 2N1BA 3F49S 2H57A 3LCVB 1MX1A 2R96A 3FTNA 2JJ8A 1EUCB 1QC5A 1ZH2A 4H0CA 1T6XA 3PFGA 4M76B 1RAIA 5F3WB 3O1LA 4YAOA 5I7RA 3O8OB 4YAUA 3WDSA 3DTVD 5EXEA 2A5FA 3AJRA 2F4NA 2FXVA 4MHTA 1XTTA 4TV8F 4BASA 1LS6A 3REGA 3ZLTA 4YGYA 4K6HA 4CM4B 2G36A 2FMHA 2DB3A 2W0SA 3O9MA 2P9EA 3HBMA 3RSSA 3ZVLA 3CZMA 3UMMA 1ZR4A 1Y82A 3EZ7A 3O93A 2QI9F 3D7NA 4OI2A 1GAQA 1NDHA 2H7VA 3K1ZA 3SYRA 3IA7A 5LOVA 1E59A 4JI5B 2PSDA 1GSOA 3PWTA 1YRHA 1PYGA 1GL9B 2HZBA 4QO7A 4BFCA 1Q17A 4PPNA 3TO5A 2R97A 1GKUB 3W78A 5C7LO 6GPBA 1FYEA 2FEAA 3GLFE 5LA6B 2CHEA 2CLEB 1HK7A 2WT9A 1BEUB 3BE8A 1RYYA 4JLSA 2QDXA 3GRUA 4PSVA 2UZ3A 3OSZA 1DC3A 3OOSA 3RYHA 5GINE 1NVKA 3CZAA 1CIVA 5KNDH 4YR9A 1O87A 1Z4MA 3AUJB 3A6KA 5EMLA 4BQEA 5JBNA 1TTTA 3JYNA 3VAYA 4B2IA 5C8XA 2XR1A 4WECA 1HQKA 4I3GA 3F74A 3V1KA 2IU4A 5IH3A 1X15A 3S2UA 3EIEA 3VVCA 1YA4A 2RB4A 3GGOA 4UJ5A 1A9PA 1SBTA 3N2EA 5F73A 3TL3A 2Z9CA 2TMGA 1GOTA