2Q2VA

Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
255
structure length
255
Chain Sequence
TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-D-hydroxybutyrate dehydrogenase
publication title Cosubstrate-induced dynamics of D-3-hydroxybutyrate dehydrogenase from Pseudomonas putida.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 94
structure length 255
sequence length 255
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2q2vA00
3ST7A 4CL3A 3LU1A 1I3NA 3TZHA 3NGXA 1IUKA 4R16A 2FSSA 5A3JA 2EGGA 2WE7A 2UV8A 4WNCA 1ZZEA 3RUHA 4WLFA 4XR9A 2CVZA 2OMEA 4J2HA 5COAA 4JP2A 3ZZNA 3F6YA 2VWQA 1BW9B 1ZJYA 4D45A 3ZWPA 3EC7A 4NR0A 4UUOA 1XKQA 3TNLA 2C0CA 4J9VA 1BXGA 1VL6A 5TF4A 3TDKA 3F1LA 1ZKMA 1SC6A 1ISFA 1YL7A 2BFOA 2QYTA 2E6UX 3TJRA 4BNLA 3W4IA 2OL4A 4UVEA 5EN4A 3SLGA 3R0IA 2B5VA 2O2YA 1EBUA 3GPDG 3OQ1A 5JDIC 5C7IO 2QW8A 1BW9A 3RUIA 3I9JA 2PD6A 1IOLA 1QORA 1XR3A 1YJ8A 1ARZA 3ANNA 1NPTO 3JQDA 4Y98A 4PG5A 1PQPA 3V8BA 2D2IA 1ML3A 1N9GB 3AI2A 4R5MA 3OEWA 4YTEA 4F3YA 1U7HA 3AK4A 3L77A 4ZHSA 1JW9B 4XRGA 1KEWA 4WLOA 3BXXA 3BMQB 1C14A 2B37A 4MVJD 2PGJA 3FI9A 3K73O 1RM3A 2ZQYA 1A4IA 2PGLA 4R51A 2X9VA 2YQ4A 3IOYA 2EW2A 2FHSA 1JDJA 4JNKA 4YR9A 5C7OO 5T6BA 1XA0A 3T4EA 1F14A 5TX7A 2PGDA 4CQMA 3IC5A 5L40A 2AEFA 4ND5A 1G0OA 1ZK3A 3DZKA 1EBFA 4L4SA 3KYDA 2HRBA 4R9RA 4XRRA 4XGKA 2UUPA 2Y99A 2EJWA 1NM5A 3U4DA 4MVJA 5DNAA 2ZATA 1KY4A 1HYEA 1SB9A 1SZJG 3QJ5A 4IMRA 4OIMA 2CY0A 4MVJE 1KETA 2PNFA 4CMBA 4G5HA 4BMVA 1DC5A 1E7WA 2RHCA 4WOJA 4PLZA 2QZ9A 1E3JA 3DL2A 2ZB3A 4PG6A 2Y67A 1MGOA 1U4OA 4BQPA 3QA9A 1YBMA 4PFJA 3A28A 4EDFA 1B3BA 1DIBA 1V8BA 2E49A 2O3TA 3LSYA 1YDEA 4MIEA 3H5RA 1J49A 4ITUA 4YPOA 2CD9A 2V6FA 1DBVO 4MDHA 5JDCC 3WNQA 4QSMA 3OMLA 3GHYA 5G4KB 3O03A 4B7XA 3ROKA 1N1EA 3AI3A 3K9QO 1DIHA 3FTNA 1H6AA 1XCBA 4YAGA 2X0NA 1UZLA 1EUZA 1KEVA 2YW9A 4DIBA 4AFNA 4CUKA 4KZPA 1BVRA 3JSAA 3U3XA 3FF4A 2Z1NA 3DQPA 4BNJA 4I1IA 4CM9D 4WKGA 3NTRA 4K28A 5TSDA 4BVAA 3N58A 4A73A 1QV6A 4B8ZA 1LDNA 1VKNA 1K6IA 4YJFB 3H2SA 1W4ZA 4BNNA 1Y5RA 1WAMA 4J1TA 3PJDA 5I7SA 3U4CA 3W6UA 3FNEA 4NQZA 4TKLA 3M2TA 4ZRMA 1IE3A 2VYVD 2FR1A 1A5ZA 3KYDB 4OOEA 3W8FA 9LDBA 1BXZA 5LDGA 4CQLA 5KCZA 4ND2A 3P2OA 5ITWA 3B6ZA 4O59O 4PLHA 4Y67A 5DBFA 3WR5A 3VPGA 4J2OA 3DAGA 4L4RA 3ZW8A 4C4OA 3E9NA 1LDMA 1DB3A 4DPKA 4OHUA 2GNAA 2VTEA 5HA5A 5TRTA 3WICA 3WLFA 2I65A 1A4UA 3DZHA 4NMHA 4B4VA 3COSA 1MV8A 3PQFA 4BNTA 1NPDA 3PIDA 1TXGA 1UAYA 4Y6SA 3UOGA 1IZ0A 3JD2A 2Y1OA 2JL1A 3QWHA 5IFLA 1U28A 1EZ4A 3OSUA 1O9BA 2JFHA 4P8RA 4AJ2A 4DLAA 4FB5A 3WS7A 1MG5A 1VE9A 1N7GA 2X5JO 4NI5A 2VUUA 5L7WA 1VC2A 4ZJUA 1U2DA 4YT2A 4R1SA 4WOKA 1J4AA 1HDZA 2H1SA 3BHMA 3DZFA 4RVHA 3WGQA 4Q3DA 2BLLA 4DYDA 3HADA 3L6EA 3MZ0A 4BO7A 1IB6A 3PHLA 3I5MA 1A9ZA 3NT4A 1HDGO 4LCEA 3IS3A 3ZV4A 4CJXA 1A7KA 1IZ9A 2VWHA 1SOWA 3PLNA 1H0KA 4E12A 4O63O 2NQ8A 3O26A 2YV2A 4PGFA 1HEUA 4UVDA 4BNXA 4MVJH 3DTTA 3AUUA 4RLSA 2YDYA 3D0OA 3HNPA 3WMWA 3FCOA 3ZDFA 1OC2A 2HJRA 1HWYA 1WPQA 4QX6A 2ZTMA 3FPCA 3K96A 3ZU5A 1PJBA 4FD3A 1FXSA 1WMBA 3BHJA 3MEQA 4J0EA 2P9GA 4B4OA 3AY7A 1ADBA 3B70A 4URFA 2Q46A 3FTPA 3PJEA 3LF2A 4I5DA 4PG7A 5ES3A 1JN0A 2OP0A 4B4WA 2WJPA 4NH4A 2VHWA 2X0RA 3UGKA 3AY6A 1DRWA 5BNIA 2CDBA 1DHRA 1ISHA 2C7GA 4OSPA 3WTBA 2D4AA 1FDVA 5ADHA 1NWCA 3GDGA 1X1EA 3OEYA 3LQFA 4G65A 1M67A 1PIWA 4YJGA 2W90A 1AHHA 1P1JA 3GUYA 4Y8VA 1WLYA 3I9KA 2NVWA 2NM0A 3T4XA 4R01A 3GC6A 1I2CA 3UCXA 1U3UA 2GRAA 2ZK7A 2HKIA 5ICSA 1A72A 1LRJA 4D41A 5JE8A 3JQ8A 2WYUA 2VHXA 2IYOA 3ADOA 4BGIA 2PH5A 3VH3A 1M76A 3E9MA 2PZMA 3O9ZA 4UUMA 4U8GA 1R6DA 3HN7A 2RIRA 3K2EA 2WD8A 5G0SA 3TFOA 5DCUA 4DXHA 1JKFA 2DPGA 3NTOA 5T57A 4PG8A 4J90A 1UDCA 5B12A 2HLPA 2W8ZA 1GZ4A 3DMTC 2BRUA 3GLQA 3VAZA 4TZTA 1I10A 3FSRA 2AQHA 1MG0A 4JIGA 1Z75A 5C37A 3NDRA 3O38A 4PLCA 2C54A 4L9RA 1O0SA 3NRCA 3ZWCA 1MX3A 1P1KA 1QMGA 4FGSA 4Z9XA 1EFKA 2Y66A 1M6HA 3TQHA 4YCAA 3PZBA 2X7HA 1DAPA 1BDMA 3DOJA 3DMYA 3FD8A 3GAFA 3OETA 4TZKA 1O5IA 4TVBA 4PVCA 4MP3A 1Q7CA 4OMUA 3ULKA 4BKQA 3AY3A 1YVEI 2B5WA 1I24A 5GY7A 4GVXA 4BGUA 3UUWA 4BB5A 5JY6A 2OBNA 1HDXA 3DWFA 5KVSA 3DOOA 2DBRA 4RO0A 3CUKA 2VRCA 4J4HA 3L4SO 3S55A 1NYTA 3AM5A 2WD7A 3EK2A 4D79A 4FN4A 2D5CA 1GTMA 1P0FA 4YJGB 4BMNA 1C0LA 5A02A 3PWKA 1PQUA 4WCFC 1H6CA 3ZWWA 4J1QA 1QG6A 5KVCA 2ZB4A 4JGBA 3HDJA 4ZN6A 5EMHA 1Y8RA 1G1AA 3L6DA 4J7UA 5COBA 3CXRA 3RJ5A 2A4KA 2I3AA 4P4LA 2AA3A 1R4MB 3NJ8A 4D3FA 4FJ2A 2OXIA 3RFXA 4XA8A 5JC1A 3F9IA 4JXKA 2DPHA 2HMUA 1SEPA 3M1LA 5DP2A 3TOXA 4CMGA 1E5QA 2J3JA 1JU9A 4U0KA 2I67A 5JLAA 1U4SA 4GWGA 3WJ7A 1XELA 4ROSA 1DIGA 3D3EA 2G76A 1X7DA 5H82A 1GUYA 5H83A 1Q1NA 3TRIA 1RM4A 4DBVO 2PFGA 1QYDA 1UXHA 1LSUA 2Z5LA 2AXQA 1NWHA 3JQGB 3UFXA 2CFCA 2QQ5A 3WX0A 1UR5A 1D3AA 2ZYAA 3AUSA 3I9OA 3NV9A 5F1KA 3SXPA 1P1RA 1ZH8A 3C3XA 4IDCA 2B4RO 3QIVA 5IAAA 3VH1A 5B1YA 4YA6A 4FFLA 3PHHA 4PLYA 1XHLA 3HB4X 2O4UX 1ENYA 4CL8A 4KWHA 4BNGA 1BHSA 4QO8A 3EVTA 1WDMA 5COQA 2JD1A 2P4QA 3AU9A 5I7FA 2VYNA 1FDWA 1R0SA 1ZSVA 4IMPA 1DC4A 1GYQA 2EKQA 4ZA2A 1ADCA 4QXMA 4BO0A 5FYDA 1YOVB 4OXKA 5I7VA 4Q9NA 3WG9A 1YL6A 3ZWXA 3DZIA 1GV0A 3F5SA 1LEHA 4XCVA 1UUFA 2P9CA 2E4AA 3RAJA 4GX1A 4M87A 3QRWA 4ILKA 2ZB8A 3AOEA 3OIGA 4J16A 4AJEA 5I9NA 1SOVA 4K6FA 3PGXA 5DBGA 1PZEA 3WNVA 1F8GA 4BO8A 3I6IA 3JQBC 4YB8A 5I8ZA 1WDKA 4M49A 3VDQA 1DSSG 1ENZA 2VZ0A 4IM7A 5JC8A 2PH3A 3BTUA 4DC1A 1ONNA 5IJZA 1MLDA 1V9LA 4CUZA 3DBLB 3CKYA 1WW8A 2HRZA 3WOHA 1NX6A 2VCYA 4RPLA 1F8FA 1WMAA 3R6DA 3ZCXA 4EYEA 1GQQA 4ZQBA 4FBGA 1BXKA 1NR1A 3AOEC 3GNTA 2NADA 3V2HA 1E7RA 4BOYA 1DRUA 1EDOA 2VHYA 5TC4A 3Q0EA 3BMOA 5JNLA 4D43A 5EESA 1KY5A 3E5RA 1NAHA 3KYCA 3UVEA 5HBRA 3UH1A 1DFHA 1OI7A 5CDTA 5IDXA 3Q6IA 4CM4B 3BTVA 3NJ4A 2TMDA 2POQX 3AFNA 3G1TA 4HUJA 4F6CA 3LC1O 4UAGA 4PLGA 1YBVA 4DMLA 1EDZA 1I33A 4XR4A 1T4BA 4E6PA 2PKQO 2Q4BA 4CPDA 1GADO 4IXTA 3ONFA 4OXYA 5ILOA 1U8XX 4MP8A 1JVSA 3QVTA 3TZKA 1JQBA 3E8XA 3WYBA 4FFOA 3I9LA 4CMCA 3UN1A 4W6ZA 3WIDA 1F12A 2HO5A 2PKRA 2Y1FA 1P44A 1E0DA 1JAYA 2DFDA 1ADFA 3JV7A 1P9LA 4BHTA 5JXWA 1Y9EA 1B15A 1R15A 1GZ3A 1QYCA 3VPSA 1OOEA 4F6LA 4UUPA 5A05A 3WWZA 2CF6A 3S2GA 4A10A 2WYVA 3PK0A 3IJPA 3K31A 2VRBA 3H3JA 4HWKA 4E13A 3H65A 3DR3A 3WDSA 4NPCA 1JA9A 1KS9A 2IEDA 1WZEA 3QVXA 5IN5A 5KVQA 4YQZA 1ZSYA 1LC0A 2EV9A 1I30A 2C7VA 1T1SA 3BMQA 1FF9A 2DUWA 3ANLA 1TB4A 2Q3EA 3B1KA 3MOGA 4A7PA 4N5NA 1R12A 4NK4A 1LSSA 3V1YA 3DZGA 5T67A 2ZJ1A 3WB9A 1P33A 3H3FA 3PDUA 3KYCB 8LDHA 1DLIA 1HETA 3JYNA 3PQEA 3D4PA 3TF5A 3ZWVA 3KVOA 1XLTA 3MJTA 4B79A 2YZ7A 2YDXA 5F1PA 5DOZA 1SNYA 1VSVA 2PTGA 1D4FA 2RCYA 1GQ2A 2WM3A 4YT5A 2I3GA 3PWSA 3D4NA 3QLJA 5JW6A 2DTDA 3KM0A 4OH1A 3S1LA 4AJ4A 4DPMA 4CV0A 4AG3A 4YRAA 4KUHA 2AMFA 4FW8A 1ISGA 2O2SA 3K92A 4GH5A 2EP5A 2HU2A 3GVIA 3F4LA 4I8XA 3ZHBA 1SMKA 2A92A 4TWRA 2Q2VA 3RD5A 4ZQHA 3ZU2A 3QE3A 1LUAA 3UF0A 2X0JA 4RF5A 2J3HA 1K6JA 3FHLA 4II3A 3ZWBA 4H3VA 3EW7A 2VYND 4N18A 2H9IA 4DUPA 2CSUA 4W9NC 1E6WA 4LN1A 3I52A 2D3TA 3JTMA 2JCXA 4E5MA 3AJRA 5JDCA 5JYDA 4J1NA 1CQIA 2E48A 3GDFA 1CWUA 4WASA 3DBLA 4IIUA 3ENNA 1U7TA 1WWKA 4QEDA 2VUSA 4LRTB 3GMSA 2LDXA 4NU6A 5KJFA 3R3SA 1LRKA 4UEJA 4BO6A 1UXJA 5EPOA 4D0RA 3KTDA 3RVDA 5L7TA 3NX4A 4M8SA 1KEUA 4PLWA 4IDGA 2NVUA 5BR7A 5G0UA 4EEXA 1T2EA 3KSDO 3INGA 1PZGA 1TT7A 3GPIA 3IQDB 3WGOA 1M66A 1LSOA 1RM5A 3ZH2A 4R41A 3IP1A 4QO7A 2X58A 4RF4A 2J8ZA 3GOHA 4HNHA 2P68A 2SCUA 3WGZA 2ZJ0A 5AYVA 3AI1A 3VZPA 3MWDB 4W4TA 2YUTA 2AG8A 2UAGA 3EHEA 1J6UA 4JBHA 3TL2A 4CR7A 3GFGA 1W6UA 4XEHA 2C5AA 2DQ4A 3FR8A 5HRUA 2IRWA 4XKJA 1HZJA 5G4LA 1PZFA 3JD3A 1B3RA 1CRWG 4JBGA 4OKNA 1EQ2A 4YQYA 5CDGA 3OJLA 3RC2A 2DKNA 1UP4A 5TJHA 2ET6A 5KKAA 3WJAA 1L1FA 4DRYA 1LQUA 4TRJA 3K5PA 4UEKA 2Q4EA 4H15A 1MUUA 3FNFA 3ROQA 2VZ8A 5KJEA 1CYDA 4NK5A 3GZNB 3OM9A 2GD1O 3AW9A 3RQSA 1D8AA 5CFZA 2CVQA 1PGQA 3OA2A 4GGOA 4IDAA 2ZTLA 3IIEA 2Y93A 2Q1UA 1O95A 3JCZA 4PCVA 2F1KA 4BL5A 5ITVA 3ZWOA 2YV3A 2CZCA 4GAEA 4Z9YA 2NLOA 5ER9A 4GWKA 4AJHA 3RBVA 5GZ6A 3DMTA 2PZKA 2XPCA 4CMHA 3I1JA 4WCDA 4YAKA 2WD7B 5B4VA 1Z74A 2OP1A 2WWRA 3SLKA 5A5FA 5A06A 3RUAA 4LCJA 5JMWA 1UXIA 3KYBA 4YYZA 3ORFA 4ZICA 1IHXA 1T25A 4BNVA 4XYBA 4GSKA 1TT5B 5ICMA 3LF1A 2DBQA 1DEHA 2HUNA 4MVJF 2GERA 1L7DA 4R4JA 2RHRA 3NUGA 3PYMA 1XGKA 4UVHA 5KWEA 5BSHA 3WTCA 3TWOA 3M6IA 2RH8A 1UAGA 3PTZA 4BUCA 1B0AA 3BMCA 2PZLA 1HL3A 2FRDA 3H5NA 1K0UA 1KIFA 5IXSA 2P4HX 5A1TA 3OJOA 4CM1A 3C24A 3WGGA 3V1UA 3BA1A 1PJCA 4CLXA 4RLHA 1EK5A 1YRLA 4WLVA 1QP8A 1YB1A 3LK7A 4PZCA 1C1XB 4YXFA 2JJYA 2BMAA 2HMWA 3K30A 4XQCA 1V3TA 1E3WA 5FFFA 2HQ1A 3DHEA 4CODB 3L9WA 1UXGA 1TA4A 4XD2A 5CG2A 1NR7A 3OJ0A 2X9GA 1B2LA 4M55A 3WGYA 3C8MA 1SEVA 1V3VA 4IDEA 4NJOA 4W99A 4R3WA 3BTOA 4B3JA 1E6UA 3RBZA 5KOIA 5A9TA 1ISIA 3WLEA 3VH4A 1PJ4A 3QWFA 2JD0A 2ZIZA 3PYXA 3C85A 5MGBA 1GFSA 1JKJA 2C2YA 3I9NA 3VZSA 1T2CA 4FR5A 5DT9A 1YONA 1PU2A 1I36A 5TIIA 2JFGA 3JQ8B 5FI5A 4E5NA 3NDIA 2NU6A 4MVJG 1PJQA 3DOCA 2GYYA 1E1LA 3FBGA 5F3RA 2QYSA 1IPFA 4I9UA 3JQAD 2X0IA 1HT0A 1GL3A 5L4LA 4ONEA 3RUEA 5CG1A 5L9AA 3WIEA 3DAPA 5JAZA 5IDYA 4RF2A 4YAJA 5I8WA 2NSDA 3MWEB 4YJHB 4E33A 4NFHA 1VRWA 3OFSA 4RDHA 5AXAA 4Q3CA 3STHA 3RASA 1LDEA 1I2BA 2VT3A 5TT0A 3R3JA 4M86A 5T8KC 4YEDA 2HSDA 3CZMA 3ETDA 4U5QA 2GDZA 1Y9AA 3JQFA 4DLBA 3ANMA 2I5PO 1HZZA 4OOFA 3EY4A 3S2EA 1QYVA 4EJ6A 1ZSNA 4FFPA 1KC3A 5A9SB 3M1AA 3FBTA 2LDBA 4NDNE 4IGFA 1QLHA 2QX7A 4R5HA 1EMDA 3MJEA 2NTVA 1MXHA 1HDYA 2E37A 3RCBA 4DQVA 1P1FA 1DC6A 1B8PA 1ADGA 2C82A 4GKVA 3TFQA 5GMOA 1BMDA 2QZZA 1LLDA 1PL7A 4NFSA 1XSEA 1YKFA 3JYPA 3V2GA 1Z73A 2X5KO 2QRLA 3OJEA 2Y1EA 2NTNA 3GG2A 2EERA 3D3WB 2J6IA 4FS3A 2AHRA 1OAAA 2C07A 4AJ1A 3QVWA 2AW5A 5IF3A 2O48X 1GZ6A 2P9EA 4N7RA 2VUTA 3F46A 1HXHA 4IS2A 1HE5A 1HRDA 3FN4A 4DREA 4EITA 5CDUA 2G82A 3ZGYA 3LVFO 4BKRA 4BMSA 4YVFA 4O1MA 1B8VA 2GASA 4CM9A 5L45A 1E3SA 2VWGA 1PR9A 3S8MA 1VI2A 4BO3A 4YJHA 4XGNA 5TQVA 4LMPA 4XB1A 4EJMA 1MXFA 3P2YA 3EMKA 3GGPA 3JD4A 4NHEA 2HK9A 3HQ4O 2VQ3A 5EIOA 5THKA 5TGDA 3ONDA 1X1TA 1I3KA 4L76A 3CSDA 3NKLA 2FN7A 3IUPA 1G0NA 3PFFA 2OZPA 2Y68A 1E3WB 1LU9A 3E5MA 4JJIA 3MTGA 3PFWO 1DJNA 2UVDA 5U4QA 4TQGA 1PX0A 3KZVA 1SCUA 1MP0A 2Y0DA 1SAYA 3HG7A 1HSZA 1PGOA 1Z45A 1TT5A 4E2WA 4CR8A 1E5LA 2I76A 3RC9A 4D42A 1PS9A 3JQ6A 2Q1WA 4BNFA 3GT0A 3GVCA 2FPPA 1YB4A 5HTOA 1NQ5A 1FDUA 3L4BC 4XB2A 1VL0A 3H9GA 4YJFA 4RQTA 4BV8A 5DN9A 3GNQA 4XYMA 3PPIA 2DBZA 2DTEA 1ENPA 1Z7BA 4CQMD 3EZYA 1DFIA 1ZK4A 1GYPA 1ZW1A 2C59A 2W2LD 4I5GA 2X1HA 1HE2A 4FJ0A 1HYGA 3GRKA 4IGEA 3KXDA 3PVZA 1T4DA 3MJSA 2Q50A 4MJLA 3KBOA 3JYOA 2D8AA 4IBOA 4RORA 4E5YA 2PV7A 4LISA 2Y0CA 4L8VA 1NFFA 1ZK2A 5TT1A 1XIVA 2B83A 4AJNA 1U2GA 1BSVA 3I23A 1D7OA 3OBBA 1EQUA 3TPCA 9LDTA 4CM3A 1R66A 2IDZA 3JQFC 3WGTA 4UUNA 1A9YA 3KV3O 1KVTA 4Q3NA 2H6EA 1XDWA 3RUDA 4A5OA 4E2YA 5JSFA 1NFQA 1PTJA 1WNTA 4XX0A 4ND1A 4HV4A 1RKXA 4DQUA 3IKVA 3PXXA 3A06A 3LC7O 3RC7A 1YQDA 4NZ9A 1NBOA 3F3SA 4Z0HO 4Q39A 4QUKA 5IDWA 3RJ9A 1G6KA 2A9FA 4BNIA 4AVYA 1NVMB 4RVUA 3VHRA 2XF8A 4CM6A 2BD0A 3KEOA 2NVUB 4XQEA 4OKIA 4BO1A 5K9ZA 4L73A 4QFDA 2B69A 1DOHA 4PN3A 4HFNA 2IODA 4EUHA 4J9UE 2RBEA 3ZV6A 2VN8A 4FC6A 5KTKA 3ICPA 4YRDA 3VH2A 5LCXA 3ZN2A 4DQXA 4GKBA 5JS6A 3TOZA 4MPDA 4KDEA 3QWBA 3I83A 2BELA 4RPKA 1R0LA 4II2A 1QR6A 4EGFA 5JCXA 2FZWA 3I6QA 4MP6A 4D3DA 3NYWA 2GN9A 1ORRA 1SBYA 4QFCA 3VOSA 3UCEA 1Y7TA 2X9NA 4U7WA 3ROMA 4GVLA 3I4CA 4CV2A 4HFRA 2WEKA 4ALMA 1NPYA 2JCYA 7MDHA 5GZ3A 5C5IA 5L3ZA 3ICCA 3HJAA 3JQ9C 3D5TA 4Z0PA 5T5QA 4K26A 1QV7A 2IE0A 4UVGA 1ZXLA 1I5RA 4GX5A 4L4XA 4BNKA 5IXYA 3DXFA 3ZU4A 2G1UA 3RU7A 4HBGA 5KVVA 2PKQP 4AL4A 3JQ9A 4C7KA 4R1TA 2O7QA 2TMGA 4J49A 2O3QA 4YBZA 4FFMA 1H94A 3WYCA 1RYEA 1U3VA 3DZBA 3DTYA 4CQLB 4B4UA 2ZYDA 3UCFA 2W2KB 1LQTA 1NHWA 1Y6JA 1W0CA 3HWRA 2GN8A 3PLRA 3PRJA 4J4BA 4RPHA 5JYEA 3C7CB 3OIDA 3ZWMA 1BTOA 3FWNA 5K6AA 2PY6A 3OH8A 1T24A 4DTIA 3NDJA 2EGHA 1K89A 4ZQEA 4XDYA 5I9LA 3I9MA 1DIAA 4TRNA 1DC3A 3ASVA 4KUGA 2EKPA 1PJSA 1WXDA 4DWVA 4W7HA 4PRKA 4GQAA 2O23A 1YL5A 2DLDA 2OOSA 2UUOA 3DFZA 2EP7A 3HN2A 3PHIA 4GMFA 4IPTA 1GDHA 4DIOA 4RJTA 4CLHA 4ALJA 5IDQA 3AUAA 3IDSA 3PDJA 1CF2O 3KRTA 4CLEA 1JWBB 1LLCA 4B8WA 1EVYA 1VJ0A 4GBJA 4QT0A 2GLXA 2HK7A 4CQMB 1S6YA 4FIZA 4TVOA 5B4TA 1LRLA 3A14A 2XAAA 4YAIA 3VKVA 4ND3A 5MDHA 4KP7A 2OHXA 2DTXA 2Q2WA 3GK3A 4EW6A 1PGNA 2JHGA 3KLMX 2OFPA 1HTBA 3NT5A 5EINA 3SVTA 1ZUD1 3OICA 4OQZA 1BWSA 3ZNQA 5AQ1A 4BNZA 4G81A 1LC3A 4A26A 1M2WA 5JAMA 3K6JA 1KC1A 2R2GA 4TKMA 3H9JA 3RROA 3VTFA 4Z3KA 2Z95A 4IY1A 3UICA 4P22A 2PA3A 4PLFA 1QLJA 5JDIA 2FPGA 1V35A 4XQ9A 3FNGA 5F21A 2G0TA 3GDOA 2ZYGA 1GUZA 4E32A 2F00A 3UW3A 3DHYA 5FF9A 2EG9A 4ZGWA 2GSDA 4A03A 3FR7A 4LVUA 3BMNA 4FSHA 4Y6RA 1E7SA 1MB4A 3D1LA 4BIIA 4Q3EA 1P0CA 4WLUA 2GR9A 3GY0A 3IP3A 4CM4A 2Q99A 1P45A 3LC2O 4QQRA 1X15A 4C7JA 4GPD1 4R3NA 4FGWA 2H63A 1H5QA 4IJVA 2CNBA 1GUFA 4K9DA 2NV6A 5HS4A 4ALIA 3CE6A 1PQWA 4PVDA 3C1OA 2V6BA 4HNGA 3SC4A 4EUEA 1C1DB 1HKUA 1BVUA 1PWZA 1E92A 5HWSA 4UVIA 3CH6A 4XYGA 3RC1A 2UYYA 2YYYA 1V0JA 4OXNA 4KQWA 4YWJA 1JWAB 2JKVA 1LLUA 3TZ6A 3DO5A 5K0ZA 2BHLA 3FWZA 1UDAA 2W4QA 5CPFA 2W2KA 1IY8A 1YH3A 2WSBA 1TI7A 3LDHA 4WEQA 3B20A 3JYLA 2Q1SA 3MJVA 1AN9A 4DLLA 1GD1O 2ZKLA 4D3SA 5L95A 1UZMA 4PZDA 4BO9A 3D3WA 2IXBA 2DUUA 4ZRNA 1ZIDA 2FPIA 3M2PA 1Y1PA 1O6ZA 1CIVA 3RKUA 1EUCA 1LX6A 4H16A 4MVJM 1U1IA 1KVUA 2O3SA 3E1KA 2CF5A 3RWBA 4FFNA 3ZHYA 4KMSA 3EUWA 4NFYA 4OAQA 1LI4A 5BQFA 2BFPA 1Y8QA 1U3TA 1D1TA 1HYHA 1KYQA 4I08A 3VPFA 5CDYA 1U3WA 4BQRA 2FWMX 4CLDA 2W2LA 3OF2A 2QIOA 2R00A 5U1PA 2AE2A 3UKOA 2EJVA 1XEAA 1PGJA 3GG9A 4S3MA 2GO1A 3EVNA 1XU9A 2P5YA 3U62A 4E21A 4ZD6A 2DU8A 3GMDA 5DDIP 1R4MA 2X22A 4J4TA 3UHAA 1B16A 4MIOA 5JO0A 1EVZA 4FCCA 4Z3DA 2D5AA 3OP4A 4M54A 1Y8RB 2GZ1A 2OO5A 3EYWA 3QSGA 5CEEA 3BIOA 4BO4A 2D59A 1VL8A 2FZEA 1IL0A 4XIJA 4E5KA 2PLAA 3G1UA 1W73A 1ZVMA 2Y05A 4HXYA 1CJCA 2VTDA 4LMRA 4HADA 2BFAA 3ROPA 4UEOA 3LT4A 3V5NA 4CM5A 2Q1TA 4KWIA 5BSEA 4R1UA 4WCFB 1HE3A 1I3MA 1T2DA 2FR0A 2YHIB 1I32A 1Q0HA 4GX2A 3H6KA 4XGIA 2PD3A 2HMVA 1S7CA 1ZEMA 2EHDA 3JQGA 5F1OA 3ZNPA 3B1JA 2FSVA 3IMFA 2BF7A 3ZWYA 1ONPA 3RI3A 1ID1A 4CM7A 4WGGA 2B4QA 1PGPA 3AWDA 3F5QA 5ILGA 1RYDA 4M1QA 3DBHB 3V1TC 4OO3A 5LC1A 4YRBA 4LSWA 1NAIA 5F5LA 1M6WA 2PZJA 3GEGA 5G2OA 4FJ1A 1P77A 4INAA 4U6QA 1NP3A 4BO5A 1ZO8A 3ZV3A 2FMUA 4JJFA 5AXDA 4MVJI 3HUDA 4WNIA 4IDDA 1DAOA 3PJFA 2YY7A 4UREA 3DBHA 1DPGA 3G0OA 1LXCA 2WTBA 5JPIA 5TJ9A 2AQKA 4PIVA 8ADHA 3KOUA 4TMFA 3JQBA 1YBAA 4TRMA 2QG4A 1J0XO 4JROA 4K1LA 3MTJA 3ZV5A 1MA0A 1Q0LA 3PHGA 3RFVA 1OFGA 4JJGA 2VRCD 1PWXA 2BGMA 3W6ZA 4OJNA 5JFOA 1LDBA 4M89A 1PS8A 1XWFA 1O94A 3MOIA 3WFJA 4BNUA 1T2AA 4XZ3A 2H5LA 3CINA 1N1GA 4E5PA 5GZ1A 3DC2A 3JD0A 2ZQZA 4GSLA 3ONEA 2NWQA 4NBVA 3DDNA 3AFMA 2IZ1A 2JHFA 4E3ZA 1C0IA 5KJ6A 4QECA 1FMCA 2B36A 1N5DA 1O8CA 1Q7GA 4IJKA 3ZNOA 1R0KA 1XYGA 1RM0A 4DBZA 1HDRA 2JAHA 2QRKA 4I9HA 5B37A 3GQVA 4RCVA 4CMAA 2NACA 3WGIA 3GFBA 3MCVA 5JY1A 1PL6A 3GEMA 1X7GA 1E7QA 2EW8A 4IQGA 4BGEA 1X7HA 5T64A 5U9CA 3GA0A 3RBXA 3TN7A 1P1IA 3H9UA 4RPJA 5C3MA 3ZWAA 4NBWA 2V7PA 4A0SA 4RPGA 3E9QA 3HB5X 1OZAA 4MVJP 1GEEA 2NTJA 2Y1CA 3JQAA 5CEJA 4R9SA 4AJJA 2YV1A 1FJHA 1SO8A 3U09A 3KB6A 2E82A 3DZJA 3MJCA 4XQGA 5JAQA 5DCWA 4FDAA 1XQ1A 3GF4A 2VT2A 2YJZA 1PEDA 1T26A 2FY8A 3Q11A 1C0PA 2XOXA 4BV9A 5CEFA 1SPXA 4LVCA 1O89A 5A04A 4NBTA 4J0FA 1I8TA 1UXKA 1ZK0A 4J7CA 3LZ6A 1EFLA 3KETA 3OHSX 4ID9A 2Y0EA 2P91A 1HDCA 1KERA 1X0VA 3U49A 3AOGA 3SX2A 3D5QA 1UZNA 2JD2A 3VC7A 1LDYA 2BKAA 5KIAA 3OJFA 3DBVO 1NQOA 4CLOA 2P2SA 4E31A 2A35A 4Q3AA 5KJCA 1BRMA 1QXSA 3ETEA 4EZBA 1DHTA 2I6TA 4GL4A 3T7CA 5BSFA 2NU7A 4AJOA 4J6FA 4OL9A 2HDHA 2HMTA 5BSGA 3QVOA 3GVPA 3S2FA 4IS3A 1GAEO 5JCJA 4N5MA 1DFGA 2DAPA 1AUPA 1C3VA 2BGLA 4FOSA 4BNHA 1RJWA 4Y9DA 4AJLA 1C1DA 1LJ8A 1YXMA 2IEBA 3GAZA 1GYRA 3H2ZA 3QV1A 4NU5A 2OUIA 1BGVA 2P5UA 4DIFA 1H6BA 5G0TA 4E4YA 2CUKA 1AE1A 3VPXA 5A5EA 2Q2QA 1E1KA 4ALKA 4GLLA 3HSKA 5A9RA 3GGOA 3WQSB 3LT2A 2WE8A 4NJMB 2JCVA 4A2CA 4R69A 3AUTA 3H9EO 3NGLA 1EE2A 2EKLA 3EDMA 4LGVA 3S2IA 3HDYA 2D0IA 1QYXA 1BXGB 1R37A 4PZEA 1N92A 3RIHA 1GCUA 3E6AA 5IZCA 6ADHA 3DBRB 1LDGA 1Q2XA 4IJUA 2DM6A 5HM8A 1DXYA 5DZSA 1KEPA 5H81A 3F4BA 2OGUA 3HFSA 5BT9A 1KOLA 1YWGO 1BG6A 2GZ2A 4W9NA 3PYLA 2HCTA 1ZNQO 5KJ1A 3GVXA 3PI7A 3NAQA 2XXBA 1EUDA 3VKUA 3P5SA 2GGSA 4BGVA 3KO8A 3CTMA 5CHEA 3WQQA 4HP8A 4ALNA 5KNLA 2AQIA 5IZ4A 4YT8A 4CM8A 3TSCA 2EXXA 3OA0A 3JQAB 3WMXA 1DJQA 1ZK1A 4EEZA 1A27A 2BI8A 4RVDA 1CDOA 2VYVA 3L0DA 4GMGA 4Z0TA 1R16A 2V6MA 5TS3A 4NIMA 3DEYX 4IJWA 1E1MA 3VZQA 3FRJA 4PLVA 3K2BA 2AE1A 3ZU3A 1C1XA 3OQ6A 4ND4A 1OC4A 1N2SA 3JQ7A 3N74A 4CMJA 3RKRA 3O8QA 2NU8A 1TEHA 1EEHA 2J3IA 4IXWA 1CEQA 4F46A 1GR0A 4MKXA 4TSKA 3C1TA 3RUFA 4ZU3A 1KVSA 2VHVA 5KKCA 4GGPA 4HX5A 3G49A 5EQDA 1W8DA 4XIYA 2BI7A 4AJKA 1Q0QA 2IYPA 3GUCA 4ALLA 3W4KA 1GCOA 1PJ3A 1UP6A 4AJPA 3KEQA 4MKRA 1YS4A 1K3TA 1IHYA 2D1YA 3ZHZA 3L6OO 4HFJA 1BDBA 4RF3A 2O7SA 1YO6A 4BO2A 1LBEA 1H9BA 1Z6ZA 3IL2A 2HAEA 1JLLA 2VHZA 2Y1GA 4OQYA 1E77A 1H2BA 1TLTA 1VPDA 1N9GA 2YQ5A 1P74A 1ULSA 4WJZA 2C2XA 2JAPA 5HS6A 1E7MA 4MIYA 1ZCJA 3A1NA 5EQFA 4QTZA 4LRSB 4BKUA 3ON5A 1M75A 1NQTA 1GPDG 4CMEC 4G2NA 3DBRA 4BKPA 2VOJA 1ZFNA 5FI3A 3DB2A 1DRVA 2RH4A 1NQAO 2ZCUA 3WBFA 3LYLA 5JCJD 2CMDA 3IJRA 4H7PA 5BNTA 1MFPA 2B4TO 1KVRA 3A9WA 3HDHA 3WFIA 2QRJA 1T1RA 3Q2KA 2C20A 3O4RA 4XJTA 3WSVA 3Q9UA 3QWIA 1EVJA 1LNQA 1AHIA 2IZZA 3WYEA 3AM3A 4P4NA 2ILTA 4JX8A 5FEUA 4HY3A 5LDHA 2O3JA 4KOAA 4N54A 3BZUA 3D4OA 4IUYA 3ZHXA 2X86A 1N8KA 3G3EA 4DYVA 3A4VA 1DO8A 3W1VA 2GPTA 3FNHA 3TZCA 3I3OA 1ZMOA 3FPLA 3SC6A 5IG2A 3AM4A 2GN6A 2EIHA 4FC7A 5CDSA 1NXQA 4CV1A 4NBUA 1VKOA 3ABIA 3C1AA 3U5TA 4CMKA 2CDCA 3KLPX 4Y6PA 1AGNA 3ENKA 5IN4A 4OGWA 3CMCO 3ITDA 3I4FA 1L7EA 1F0YA 4BNMA 4PRLA 1QYWA 2OORA 3NT2A 3QY9A 3H5AA 3EGOA 4J43A 1GEGA 3PP8A 2HK8A 1PJLA 4WECA 1NVTA 1OMOA 2V65A 1JKIA 1CQJA 3TL3A 4JCOA 2BFMA 1Z7EA 4P4GA 2X4GA 3RU9A 1Y8QB 4J1SA 4CLOB 3X2FA 1IPEA 4EUFA 5L51A 3D64A 3QVSA 5C7LO 1A7AA 1TVEA 3IAHA 1ZMTA 4OM8A 4YDRA 1ZBQA 3U4HA 1MFZA 5FWNA 5J23A 1B26A 4O6VA 4IZIA 1C0KA 1V6AA 1XQ6A 2I9PA 4A27A 2ZB7A 5EJ2A 1FDTA 4YACA 1RPNA 4CR6A 1ISJA 1CERA 3O8QB 4J91A 3AU8A 3Q2IA 2VWPA 1WZIA 1ZEJA 4S1VA 5BNFA 1PJTA 3Q3CA 3VVCA 3PQDA 4KDFA 1F06A 5THQA 4FOOA 1WP4A 1YDWA 2Y1DA 2EF1A 2I66A 3BYZA 1GPJA 1PL8A 4XJSA 3KSUA 1I0ZA 3B1FA 5JO9A 4L0QA 2EWMA 4WK6A 3E82A 2DT5A 3GNSA 1R4NA 3F1KA 4O5OA 4WLEA 3Q9NA 3ASUA 5G0WA 5I7EA 1KVQA 3GR6A 2O50A 3OIFA 4NNJA 3ETGA 4IDFA 3NEPX 2NUAA 3OQBA 3Q1LA 3DONA 2NNLD 1B8UA 3W8DA 3VVBA 5JAIA 1K5HA 3BMCB 5A4DA 3F47A 2ZCVA 4EI2A 1U9JA 1LTHR 2RAFA 3K8ZA 3G79A 4B3IA 1JTVA 2BH9A 2GZ3A 3U9LA 3IUSA 2Q45A 2A94A 1E7YA 2DC1A 4J3FA 5ENDA 1Z82A 5DULA 2X8LA 1I01A 4J7XA 4W82A 3LT0A 4NBRA 1GY8A 1Y81A 4WCFA 4GX0A 5L53A 2VNAA 1E6EA 4OSOA 2NU9A 4R1NA 1E3EA 3JQCA 4CM8B 3HZZA 3QQPA 4FQ8A 5CPBA 3PZRA 4I5EA 1E1NA 3GRPA 4BS9A 2R6JA 1VLLA 1DIRA 3QP9A 3GH3A 2IZ0A 2NVBA 3P7MA 4JP3A 4BKOA 4JLWA 4RVSA 4UULA 2OBYA 2XXJA 1GQYA 2PD4A 4DPLA 2FR8A 5A03A 3T7EA 3WSWA 3CPSA 3HFGA 2B0JA 3WXBA 1GU7A 3X2EA 2B35A 3GZNA 1P3DA 3H7AA 1PS0A 4KUEA 4IDBA 3PEFA 2YFQA 4RQUA 1KBZA 4DGSA 4MKZA 2R00C 1QRRA 1I3LA 3CEAA 5L7YA 2X5OA 3H4VA 1K6XA 1ZJZA 2DVMA 1H6DA 1VJTA 2UDPA 2J5QA 3HHPA 2W98A 3E48A 5ENVA 4BNWA 1HF3A 4WUVA 1QKIA 3VZRA 1DLJA 5CAEA 4TRRA 4IINA 1AXGA 4BB6A 3JD1A 4ZQGA 2C29D 1FK8A 3GZ4A 5TLSA 3D7LA 4LK3A 4Z9FA 3N7UA 1H93A 4B7CA 2PWZA 3BMOB 1JVBA 1UDBA 5A9SA 4I9NA 4IQ8A 2ZTUA 2V6GA 4CLRA 2WYWA 2YHIA 1Q7BA 4N5LA 1WDLA 2HMSA 4MINA 5L4SA 3VTZA 4XYLA 5A3VA 4LSMA 4IQ0A 5CP8A 1UJMA 2G17A 5I9MA 1SB8A 2PR2A 3SJ7A 1ZXBA 1NNUA 3GN2A 2AG5A 3GN1A 3H8VA 4RVGA 3C7DB 1NFRA 2GUGA 4LW8A 2ZTVA 1MC4A 1EE9A 1ULUA 2GN4A 6LDHA 1E3IA 3GGGA 1YQXA 4CV3A 2Z1MA 2DFVA 3CMMA 1LA2A 1PR3A 4XWYA 1MC5A 4K6CA 2JFFA 1P1HA 4IIVA 3JYQA 4NG5A 3KUXA 3CZRA 5AOVA 1D1SA 4U0JA 4W7IA 4YJDA 3V2UA 2WMDA 2C5EA 2VOEA 3WQRA 4EBFA 3E03A 1FDSA 5TNXA 1VJ1A 4CMIA 2X23A 5JMPA 3UXYA 4KTTE 3P19A 4E0BA 1F17A 3BTSA 1OBFO 2PK3A 4RV9A 4AICA 4D0SA 4I5FA 2O3UA 5ER6A 3QW2A 2YHUA 4WEOA 4D46A 1E3LA 4DL9A 1P31A 1U8FO 3LT1A 1NASA 4GI2A 3KSZO 1H2HA 3BMNB 3U0BA 3HE3A 1NVGA 3C7AA 3DFUA 4Q3BA 1ISMA 5AXBA 4JK3A 1B14A 1NTOA 3SEFA 1GV1A 2YFHA 4CLRB 1HLDA 3SBOA 3SJUA 2IXAA 4B3HA 4DA9A 1YJQA 3PGJA 3EZLA 4R54A 1N7HA 5L4NA 3KHUA 3VDRA 1ONOA 3GEDA 5F5NA 1Y5MA 3GHHA 3TZQA 1LLQA 4MOWA 2EEZA 2VZ9A 3LLVA 1U5AA 4XDZA 3PJGA 5JBIA 4RDIA 3NTQA 4Z6KA 4X54A 4XYEA 1HDOA 2VNSA 4JN6B 2AQ8A 3INRA 4B7UA 1NHGA 2O4CA 3H9QA 4RZIA 1PSDA 1YE3A 4R68A 5DOVA 1J5PA 3MJ4A 1XG5A 4BNYA 3EAGA 2CDAA 4D7AA 2G5CA 4WPGA 1U5CA 4DMMA 4F45A 5B4UA 2FOIA 4WE3A 3VPHA 3DHNA 1H9AA 1DDOA 3WBBA 3ADPA 1HE4A 5DP1A 5DBIA 3RFTA 1HLPA 5AVOA 4L75A 4D44A 1T2FA 4FFRA 3U4IA 1K2WA 4WLNA 1X13A 4OYRA 4IZHA 3GVHA 3WWYA 2AEMA 3W4JA 1UP7A 5T8KA 2QHXA 5IZCC 4CMEA 2J5RA 1YGYA 3PHJA 4ZQFA 4P38A 4O0LA 3BAZA 5K6AC 4AJIA 3QHAA 1VSUA 1I2ZA 4GLOA 3R1IA 1R4NB 4CUJA 3RUCA 4DC0A 3PWZA 3DAFA 1XU7A 2AEJA 4FPXA 4PG4A 3ITKA 2BGKA 3JQ7B 1A71A 4YT4A 4ESOA 1PJ2A 1EK6A 4TROA 1WVGA 4RVFA 3W8EA 5G4KA 2HJSA 3HDQA 3L9XA 1ENOA 4U6SA 3E18A 4HFMA 4KQXA 3INTA 4E30A 4KTVE 1UH5A 3PIIA 1X0XA 5DCYA 2J5KA 3ZWNA 2CVOA 2GCGA 4MO2A 2X6TA 7ADHA 4ZVVA 5G0VA 4E2XA 1YQGA 4YAEA 2I99A 4PLTA 1VM6A 1B7GO 5AXCA 2DBVO 2J3KA 4CMIB 2GF2A 3CIFA 5EL0A 3QWAA 4DVJA 3G17A 3LLSA 1PZHA 3IKTA 2WDZA 4PLPA 1QSGA 4RL6A 4JQCA 3BHIA 3UAGA 2O3RA 1EVIA 1CETA 1JAXA 4L74A 1RWBA 5DF1A 3ZW9A 3RSHA 4HKTA 1IYZA 4RZHA 4JBIA 3WGHA 1X14A 2FP4A 1LSJA 2NQTA 3L07A 2Q49A 3OECA 4EJ0A 4E2ZA 1YB5A 3L4BA 5EERA 1V3UA 3JQEA 1IULA 1HSOA 1YOVA 3ZI0A 3ZNNA 1AXEA 4NJMA 4RGBA
chains in the Genus database with same CATH superfamily
4XLTA 1XVTA 1YCDA 2H57A 2FKNA 4OYLA 4HNRA 4QARA 3PE3A 2B6HA 2JGIA 1X7ZB 1ZRHA 3TZHA 3NGXA 1IUKA 4R16A 2FSSA 4KQ1A 3KKQA 3PFCA 1MD9A 5A3JA 4E70A 4L6CA 1U0OC 4KPGA 1QGED 3EA5A 4K03A 4GD3Q 3JQPA 3MMNA 1QDEA 2EYUA 4RXMA 2BKVA 2VWQA 4TXNA 1BW9B 1WABA 4QHSA 3DP9A 4D45A 4TTJA 4UE6A 2HT6A 2VTKA 3FVQA 1U98A 1XKQA 1AUQA 5ELMA 4FZRA 1L7BA 2F67A 3A27A 5KAPA 4HF7A 1H3NA 4CTNA 3WB1A 1VL6A 4LZNA 4UEWA 4V24A 1W44A 3TDKA 5A2QA 2XJ4A 3NEJA 1ISFA 1YL7A 3KPUA 4OFXA 3F6PA 2ZS8A 3TJRA 3AVUA 2P40A 5EZYA 1TCVA 2HA2A 5EJIA 1KI9A 3D02A 1JHQA 4KVAA 5LA6A 4KHPB 1QVZA 2ZEJA 2GZDA 1IXKA 3BIFA 4FBLA 1M2GA 2YHAA 4P7FA 3RVNA 2BDUA 4JJAA 1M1NA 1RADA 1XR3A 1YJ8A 2YIMA 3C3AA 4Y98A 4A6EA 1TIPA 4FKZA 1WG8A 3V8BA 4V1CI 4OF4A 3SJBA 3WLKX 3AUYA 4QWWA 5DFAA 4R5MA 2HHCA 2PZBA 1NRJB 4OL0A 1RKUA 1NLZA 5ERXA 3QBDA 1OLXB 2GZMA 2WJ3A 1UOQA 2JIRA 4GYKA 3DWEX 1VLHA 3MWFA 4WACA 1QUFA 1WUTA 1IBSA 1KH1A 2X15A 4TLAA 3WWDA 4OLFA 4PYIA 2YNMD 4HOYA 1B43A 1TF7A 3NONA 2H9YA 3BXXA 4MWSA 2A5FA 4NICA 5EIAA 5K8VA 2R8ZA 2K5UA 3NXKA 5HCIA 3NTLA 3M6VA 3OZAA 3PD0A 4LXGA 2WTMA 5K6TA 3CS3A 4R51A 2X9VA 1MAAA 3R6LA 1K9VF 3S70A 1JBQA 2FHSA 3SMVA 3O8CA 4YR9A 3MK31 5T6BA 2CWWA 5C7OO 1Q0TA 3TVYA 4B83A 3U9TA 3V46A 3KALA 1Z83A 3IC5A 4X1IB 4DNXA 1MEOA 5CXUA 1YQUA 1PYOA 2WMYA 2HRBA 1WE2A 1NSYA 1Y1TA 2BUCA 2WAMA 4REMA 4TWJA 4KQJA 4XGKA 3HUFA 3K0CA 4I3GA 4H7KA 1GQRA 2IGTA 1OKKA 4XSGA 4ZC8A 1JQDA 4LJ8A 5H4HA 1VTKA 4HEA6 4OIMA 4AZWA 1GFIA 1ZUHA 1UDXA 2FUKA 3MC1A 5IKPA 2EFDB 1C1HA 1UM9A 3JATB 4MVJE 1KETA 1C5KA 1VCMA 3AI7A 5KSZA 3FIJA 1DC5A 3JQRA 4HDMB 4BMVA 4ZAVA 4PLZA 1L5NA 4YCLA 3DL2A 4URUR 3QA9A 3GZJA 1M8KA 3MBOA 3OJWA 4QYWA 3H2KA 2O1WA 3D9QX 1A8UA 1YDEA 3IUBA 2HBRA 1PE0A 1T9HA 3TGPA 1UC4B 1G8JA 1DBVO 2CD9A 2V6FA 3KKMA 3WNQA 3ND9A 3K16A 1ZU5A 4D98A 2JGEA 3NVMB 3ZZMA 4ZYXA 4EG1A 5IVPA 2YXPX 1NI4A 4HEJA 2CLFB 4AN4A 3AI3A 4RU1A 1GOTA 5P21A 1H6AA 4YAGA 2ZWPA 4MITA 3V7UA 1CHDA 1E59A 3GLFE 1NI4B 3NWEA 3LQ1A 1A88A 2AOWA 1KEVA 5EZ5A 3PTAA 3PD7A 4U39A 3ISTA 1GKLA 3DQPA 1HK7A 4O2AF 1A2KC 1AQLA 2CXOA 2XUDA 4CM9D 4DY4A 2OCDA 4ZV7A 2ZIXA 5TSDA 4DA7A 5JJ5A 2AH5A 4IFTA 3P9YA 2QD1A 5KCMA 4YRNA 2OQ2A 4MV4A 3T95A 2X7XA 1EFPA 4HLUC 5C46F 1VKNA 2GPYA 1GPLA 3VNRA 2BBSA 3CUWA 2IHZA 3I34X 1PEYA 4I1VA 4M22A 1FJGB 1Y5RA 3I0ZA 4HDMA 4MI9A 4OXIA 2XIQA 5CM2Z 2VBIA 1ULTA 4QTUB 3HCFA 1Z08A 3PJDA 3Q87B 4J1TA 5I7SA 2K87A 3IP6A 3EGVA 2I62A 4KG7A 4OJQA 1MO4A 3AR7A 2JCBA 4ZRMA 1WXHA 2R87A 1IE3A 1RAGA 1TL7C 2VJKA 2N47A 3WSTA 4ANFA 2NP7A 1Y80A 4ZCQA 3KYDB 3GRCA 5IT5A 1BXZA 1I6MA 1B00A 1Z35A 3EASA 3R2JA 3VU9B 3I2IA 4ERXA 1ECBA 3B6ZA 4O59O 5ITWA 4R2HA 5C31A 3VPGA 5BVHB 1M74A 2ZRFA 4Z54A 2EWVA 2AJCA 3E23A 1XLWA 4L4RA 3U37A 2CDNA 1D07A 1ZVKA 3E9NA 3EODA 1LDMA 4QAJA 1LK5A 1VSBA 3LK6A 2QAIA 4OHUA 4DKXA 4AZ3B 2GNAA 5TRTA 4XVCA 1ZGZA 3WICA 2I65A 1A4UA 3HU1A 4AX8A 3COSA 1L7PA 9ATCA 3EXEB 3T3EA 3PIDA 3JD2A 4PO9A 1AKVA 1O87A 2JL1A 2IH5A 2H2AA 3QVUA 3QWHA 4LDNA 5BYJA 3M6MD 4P0QB 1EZ4A 2Z8XA 1Y3BE 3Q7QA 4DLAA 6AT1A 5CNJA 5EJ6A 4KLZA 1JEQB 4H6PA 1KDOA 2VJAA 2XTJA 5AJUA 2X5JO 4NI5A 5F12A 2VS1A 2VUUA 4HR7A 2W37A 1N0WA 1VC2A 4B6SA 2O5EA 2I8LA 1CS0A 2V9ZA 5ENZA 4YMWA 5JCZA 1EXDA 4DLRA 2HUPA 4R84A 2PYZA 5CJ2A 1P0MA 1A8HA 3DZFA 2D3WA 4W5RA 1W46A 3TZQA 3F6EX 1I7QB 3MZ0A 2JGDB 3OIYA 1IB6A 1IXYA 3I5MA 3CLSC 1A9ZA 5E38A 5ANRB 5FUYA 1HDGO 3RU3A 1RXWA 2V7QD 4BFSA 3FHTA 3A6ZA 1WPGA 3AERB 3H97A 1SOWA 3EJWA 1RLJA 2NQ8A 3H84A 4WA8A 2YV2A 1D09A 1W1IA 2BM9A 4UVDA 2I2FA 4QGBA 4ZFNA 4PZ0A 3QX7A 3WJ2A 5JS8A 3LPCA 1AY0A 3LCRA 2CFSA 4RLSA 2YDYA 1R9JA 4ER5A 3RF7A 3FCOA 1F4VA 4FXOA 1OC2A 1YFKA 1YRBA 1ND6A 3CZCA 1E61A 3AFGA 5IT4A 2QBYB 5IKMA 1EB9A 2P9GA 1L3IA 1H8HA 1ADBA 2LGJA 1ETHA 2LD4A 4AS3A 4B4OA 2Q46A 4BQQA 1DKPA 3LF2A 1XJ5A 4WJKB 4CHGA 5BSMA 3QGMA 2H5JA 2OBBA 3DD1A 5BWNA 4B4WA 2V1UA 2WJPA 4Y2HA 5HSGA 3I3SR 4JVSB 1HRKA 5J4LA 1NXVA 4LZAA 1MABB 2YN2A 3UGKA 3AY6A 3NVAA 1WHTA 5ISMA 3ZTWA 1DPFA 3DWIA 5EVCA 4LWOA 2FUEA 1W2WB 2IX3A 1ISHA 2C7GA 3F3YA 4OSPA 3WTBA 4DLKA 1XZLA 3HY4A 3W8NA 1OFTA 4M1WA 1F1JA 3DAYA 1PIWA 1SUPA 3UBTA 2PZGA 1Z6AA 3IXMA 1FEZA 1FUEA 1TO1E 1NMSA 4TL8A 3OMXA 3HXMA 1UPCA 3SHVA 4PPFA 2DZDA 4Y8VA 3A6KA 1DIOB 2NVWA 3PA6A 3LY5A 3VX4A 4ER6A 4F12A 1BFDA 1GHTA 2O1EA 3I9V1 3MIIA 5KYWB 2C7PA 2RBGA 1XQ9A 3TSWA 4W1PA 3ZY5A 1QB8A 3H1EA 4HI0E 4M4SA 2VNJA 4G24A 4HWSA 2ZK7A 5EPEA 4BCCA 3HDVA 3HL0A 2HDNB 4N03A 1V1RA 5JE8A 3RG2A 2FMTA 2HYIC 2WYUA 1GNSA 4BGIA 4KSYA 3A32A 2V6JA 4JJKA 3EYAA 4UTVA 3L0ZA 3KJXA 1L6IA 2FK8A 2QVZX 2K6GA 3TFOA 5G0SA 2NOAA 1Y7PA 5DCUA 1SRRA 1OVGA 4LVNA 1K66A 1N8TA 4LF9B 4J90A 1UDCA 3PV0A 1LPSA 3DMTC 3GLQA 3VAZA 2BRUA 4UASA 2BRUC 2EZTA 1K08A 3QLEA 3KJNA 2FI1A 1Q3TA 4M9RA 3LJKA 5I7OA 1MVOA 2GAOA 4JBXA 3SAJA 4JVMA 1XPOA 3HM2A 4IRUB 2C54A 1FMLA 2GHTA 2IY8A 4ZDKA 1C30A 1QMGA 4RD4A 2Y66A 1O8BA 4HS9A 2H7YA 2D1RA 2R7AA 2JJ2A 3KFVA 4HZUB 3PEUA 3DOJA 3DQQA 2QL6A 5LQJA 3FD8A 1O5IA 4NP6A 5DI3A 1GG8A 1O96B 5CM8B 2MINB 2I4NA 2B5WA 2JJMA 3LHDA 4JVLA 3JYHA 1GTL1 1SXIA 3E3LA 3RT7A 3M9WA 4N6GA 1AS0A 2OXRA 4XM0A 4BZWA 3DOOA 1P7CA 4G0QA 1ZD8A 3SBDA 3CUKA 3SS8A 3S29A 1NJ5A 3R41A 4XW2A 4MZXA 5KYNA 1NF9A 1FUYB 1YUMA 1A50B 1C3OB 1JHOA 1UBEA 3O3MB 3S1AB 3T1TA 1SUSA 1DBQA 3I8OA 2GZAA 1RMYA 2WYHA 5J2UA 1NF8A 3ZGXA 4Z51A 2BGNA 2R11A 4I66A 4BMNA 2I6FA 2QSUA 2PM8A 5FLKA 1SBQA 3PWKA 4D9IA 2VH2A 1PQUA 1LB1B 1AKRA 1XI2A 2JRLA 3LCVB 4PX9A 1XZKA 3ZX5A 1QG6A 2HSGA 2HRDA 2OFXA 4V0RA 2W6JD 5ALMA 2X0FA 3W9UA 3T5MA 3MINA 1ZBDA 3HDJA 4YCMA 4ZN6A 1IJKA 1R64A 2C5GA 1QFJA 1PR4A 1H22A 1N0IA 1X1BA 2BM8A 1Z5UA 3L6DA 5COBA 4V0MA 4JLUA 1DBRA 1DWPA 2QMZA 2K2WA 2A4KA 4ZYLA 4L2IB 1OI2A 3VNUA 3H4MA 4FYKA 1V5WA 4R9UC 5CVUA 3U26A 1VGVA 4HGPA 4YCDA 1ZOSA 4X85A 3IRUA 1QO0A 2E18A 4FJ2A 2VJQA 2F3RA 3OZCA 2OQVA 3RFXA 1GPAA 5T4BA 3A1CA 1DWUA 3F9IA 2BGUA 4RCZA 2NUAB 2HN9A 2HMUA 4RK6A 3QKUA 3L0CA 1Q11A 1N2OA 2OCBA 2DLNA 1BA2A 2HNBA 3GOQA 3STYA 1P62B 2J3JA 1KEKA 4BY9E 2FW8A 1JU9A 1YR1A 5GONB 4CIWA 2AF3C 1AVTA 5DKFA 2G70A 1HNXB 4NWIA 1L7VC 1XELA 4H6VA 3LXRA 2H51A 1XVIA 1DIGA 1RPJA 2G76A 3FNIA 4NECA 3ZE8A 1C9EA 1GUYA 4RA9A 4DBVO 3THYA 3AT1A 3EWAA 4GG1A 1CY1A 1UXHA 5GWXA 3AETA 5KS2A 5AIAA 2UZ3A 3JQGB 2C9BA 2QQ5A 3I12A 4FDUA 4INPA 4MB6A 1UR5A 5I7WA 3VJRA 4H7DA 1D3AA 4HWGA 4CT0A 3BIJA 1WB5A 3NV9A 1JG1A 4QQFA 3AXSA 1P1RA 1XMSA 3C3XA 2O7VA 2ZITA 1RBZA 3BBPA 2A3RA 5CMLA 3D1VA 3RS8A 2QTCA 1BH6A 4Z4FA 4G0MA 2WJVA 3H5VA 2O4UX 3EEIA 4MUHA 1FJXA 2XUGA 4CKYA 5HKKA 3BCSA 2TYSB 4P2GA 2FZVA 4LAFA 2WTXA 5I7FA 5B64A 2WWIA 3A6EA 1DC4A 3K1AA 1QIFA 3QYJA 1ADCA 2IYRA 5I5GA 1SOAA 2QN3A 4JL6A 3EWNA 3Q8LA 4BO0A 1ESDA 3E3NA 1DT5A 1TPZA 2GM3A 4Q9NA 1KDVA 1VYHA 2GPAA 2ZJBA 5JYBA 1X1AA 4LY6A 4NYIQ 9MHTA 3R77A 3F5SA 3R9XA 3EZ6A 1CYEA 3IDQA 2APJA 4AZ0A 2FGKA 2E4AA 1SXJC 2DRIA 4GOND 3BXGA 3T5GA 1UQUA 2WU3A 1E9VA 3UWKA 2F90A 2IPXA 4TZ0A 3K0SA 2MSCB 2QW1A 3OIGA 4AJEA 1WKCA 5I9NA 4MQBA 4K6FA 3TTWA 1KYVA 1PZEA 3JS5A 4C5BA 3I6IA 2C95A 1OX6A 1WDKA 2HBQA 2NXCA 2OTCA 4M49A 4YB8A 1IPHA 1DSSG 1G3MA 2DCUA 1Q7RA 4BLWA 1PEAA 1ZGBA 4IM7A 3SXJA 1Y5LA 4WVFA 1PLKA 3BTUA 3EXHA 3N0TA 3UMFA 1PR0A 3CX7A 1QQ7A 4ZPJA 2AMLA 5IF9A 1MLDA 2FW7A 4JU9A 5ALEA 4C0BA 1ZHHA 3DBLB 4YO7A 3CKYA 4X45A 4FCTA 1Z7YA 3E9YA 4MPPA 4JI8B 1KFKB 1U2PA 3SEAA 2I6XA 4EQZA 3ZCXA 4C22A 2CLLB 1Z5ZA 4KVFA 1OX5A 4EYEA 1SVWA 3QLUC 2I1LA 5BW6B 2RHLA 3PCRB 4L78A 5HJ2A 4U2BA 4F5ZA 2XB6A 4FBGA 1SUFA 2AFRA 1L7QA 5CR9A 5LB4A 2IS6A 1NJGA 1FFDA 3BS4A 2NADA 3C3CA 4LJYA 5TC4A 4BFXA 3ESDA 3W8RA 4P6VF 4EH1A 3UAVA 3IMEA 3UZUA 4CI9A 1KY5A 3E5RA 3KYCA 4EW1A 3TMYA 3UH1A 1CB0A 1OI7A 4CM4B 2VXBA 2ZAOA 3BTVA 3NJ4A 1Z6GA 1JDZA 2C5SA 2POQX 4R7GA 4RA9B 4MK4A 1XTPA 5C3UA 3C15C 4O4HA 3IKJA 3LC1O 4UAGA 3HYCA 4UJ5A 5JH7A 3TBKA 2WI8A 3V8RA 2LRHA 3WLQA 2I71A 4R05A 2PIDA 4E6PA 4K40A 2PKQO 3TTVA 1FYXA 4CPDA 4Q12A 2WTUA 4QSHA 3UJ8A 2O8EA 2B8JA 4LHEA 5ILOA 4MP8A 2RGNC 2IUSA 3QVTA 4MKHA 4QDOA 7ABPA 3I28A 4I2NA 1IHUA 2UU9B 1JLRA 3RVRA 1OXUA 1SKAA 4ITVA 1I7DA 3KQWA 3GJRA 3KEFA 1NV9A 1NW5A 3OIWA 2B9VA 3B5IA 1ADFA 3JV7A 3PDHA 2WHXA 4K81B 5JXWA 3SC3A 4GC9A 1GL7A 1TE2A 3CT4A 3VR4A 2PLRA 1AQJA 4NEHB 3T8YA 3D7SA 3DOUA 4A10A 5L3RA 3ENVA 3PK0A 3U7QB 3SHQA 1E0KA 5DEOA 2WJIA 1H4SA 4EEKA 3IVAA 3NZEA 1QH8A 2Z2XA 3AESA 4D5EA 4M36A 2W70A 3SQOA 3AO0B 1E98A 4X1YB 3PQ8A 5BYBA 3RV3A 1M54A 3DT9A 1B4DA 4H1UA 4OHMA 3ZDEA 2CV1A 1SVUA 5JBQA 1LC0A 5GVSA 5BRJA 1I30A 3LWNA 4N40A 2G7MC 1B0PA 2VPWA 3BMQA 2DUWA 2R6CA 3ANLA 5INTA 4PC6A 1S3IA 3UMVA 1CR1A 1T5IA 1CY2A 1S01A 3LQQA 4A7PA 1SBCA 3LOQA 1FP6A 2WOJA 4NYIR 1QP7A 4I55B 1B93A 2ZJ1A 3NOQA 1EIZA 3H3FA 4O2RA 2LCQA 4ZAXA 621PA 1KWGA 2WSSD 2ANBA 3PQEA 2O1SA 4KAJA 2HHLA 3ZWVA 1TW2A 3RABA 4RXUA 1OXSC 2BCGY 2YZ7A 4G0OA 4MPTA 2W11A 2PTGA 2VK2A 1SG9A 2GNOA 4LXIA 1GQ2A 1V6CA 2WM3A 4C5CA 4YT5A 2I3GA 3PWSA 5KTTA 1EXMA 2DTDA 2XODA 2HV9A 5C7YA 3WNDA 4AJ4A 3EGXB 1ESMA 3OJCA 2P6RA 4CV0A 4ZCPA 1TQHA 4YRAA 4KUHA 5AWFC 1UK9A 2WKPA 2EP5A 4L0MA 4F11A 2B1JA 1C7EA 1J7JA 2QLFA 4WK0B 4AUKA 2ADMA 4B75A 4EP1A 1TAUA 3BIWA 3ZD7A 5MGNA 3BVPA 4Q1DA 3ZU2A 1Z2PX 2F9MA 4JGIA 1SOUA 2H1OA 1EK2A 1SCBA 1F0PA 4IOMA 3W04A 4NZMA 5DYGA 5SZIA 3QTTA 3ZWBA 5KWIA 3G23A 3EW7A 4N18A 4QXPA 1AH2A 4GPBA 2FJPA 3OI7A 1E6WA 5A7HA 2BHTA 2Z3ZA 1E64A 4LN1A 1HQYE 3UFBA 3E7WA 4LNUB 5HZKA 4OQLA 1XEWX 3V8PA 4B84A 1CQIA 3GDFA 3TAXA 3G2KA 4ZVNA 3ELUA 2V7EA 3MRTA 1WWKA 5FPHA 3CF6R 1FC0A 1NUSA 2J7KA 2GFIA 2OB1A 3BE5A 3DCIA 4QEDA 5K3FA 1J5EB 2GETA 3DZ8A 2UZ1B 3KZXA 4KFSA 4BO6A 5IMBA 2G06A 4RTLA 4U7TB 5K0CA 1DG3A 2ZJ6A 4PIPA 4MR9A 3BFJA 4LC9A 3O6VA 4QFMA 4ED9A 4M8SA 1GNTA 1X80A 3MLBA 3Q3VA 2XF2A 4PYRA 5BQ3A 3KTOA 2ENUA 5DE3A 3TINA 5C2JB 3NLLA 1EXWA 1T2EA 3KSDO 2KLBA 1YNSA 3T9AA 1PZGA 4WT7A 1TT7A 1SCNE 3IQDB 3BE8A 4MCJA 2J33A 1LSOA 4YJ2B 4A0RA 4F8JA 3OZDA 4MRNA 2GBPA 3B48A 1JFRA 3A4YA 2SCUA 1DKNA 3UB2A 5HJ7A 1T9GS 1WW3A 2IXFA 4W4TA 2AG8A 3N8GA 2WA1A 2OMKA 3EHEA 4CR7A 2IU6A 1QFYA 2WTAA 1CCWA 1F8XA 3BWDD 3A1DA 4G0YA 1FS6A 1KEEA 3EH1A 1YZTA 1U63A 3DT8A 1WXXA 2KE5A 2WIGA 3MAGA 5EZYF 4IEIA 4G07A 1CRWG 5G4LA 1GXSB 4ADSG 3IEIA 2X3UA 1W19A 3OZSA 2WPDD 1QG2A 3NORA 4NFLA 1P29A 2UYOA 3FMIA 4LOAA 5K8CA 1JHZA 3VSCA 5TJHA 1VG9B 5KKAA 4P3XA 3WJAA 3B1YA 4QM6A 1BFUA 4P53A 5DHQA 3K5PA 3QF4B 2BFDA 3LE8A 4UEKA 2JASA 2M1ZA 4L5JA 4DC9A 1MUUA 3FNFA 5GJVC 4LY0A 3OM9A 4XE5A 4GPIB 1IN8A 2VXOA 2DFKB 4WTOA 2GXSA 3I01A 5CFZA 2RC5A 4C29A 3OA2A 3K2QA 4GGOA 2W5UA 4Y7CA 1GPH1 1H2XA 1OYWA 3GBSA 1U1EA 1AK1A 3OWOA 4LC0A 2AZXA 2I7CA 2RGXA 4LF8B 3HO1A 1ZL0A 2QRZA 4PNZA 4BQSA 4BX0A 4XFKA 1NOIA 2W2VA 5ER9A 4AJHA 1U3DA 1FVOA 1SC1A 2XPCA 3R3HA 3I1JA 3IUJA 2OO5C 3QU9A 4TYPA 2AVNA 5A5FA 4BJ3A 5LQMA 4UD6A 2TRSB 5E9WA 2V9PA 4HS4A 4LCJA 5FXMA 3NU1A 4F4HA 4ZYTA 1NTRA 3ORFA 4KXYA 1IHXA 2JCGA 3HKBB 1IZYA 5BYKA 2Q27A 4BNVA 5L3QA 2HUNA 3VU9A 2GERA 3H2GA 5HQ3B 2ATIA 2RHRA 4QL3A 3K3PA 1JJVA 2EX1A 1G55A 1HLFA 2DOKA 2JH8A 5FX2A 3DW1X 5KWEA 3AUFA 2O2CA 3PT9A 3TWOA 5K0ZA 5CNMA 2UVQA 4M0PA 1DMRA 3GDHA 5BWCA 5JJIA 3PTZA 2WU4A 4BUCA 4PX3A 1NW3A 1B0AA 4AAYA 4YMHA 3ZQ4A 1H3FA 4MARA 1XZAA 2GXQA 2AZMA 2C92A 1IWBB 3H5NA 2C4MA 3M5WA 3V4VB 1MA3A 2ZSKA 1ORTA 1E1RD 3ZX4A 5A1TA 1EYZA 4EX6A 1JEJA 3UGQA 4RMJA 3C24A 1BYIA 2CL6X 3CLRC 4YUVA 3WGGA 2IXGA 1QS0A 5ED0A 1E2BA 1PBTA 1WLSA 3KWJA 3BA1A 2NZ2A 4WIAA 2GM4A 1U8AA 4CLXA 4YMIA 1EK5A 4M9QA 3CZAA 4UZEA 2QP3A 2Z2ZA 3QMWA 4FX5A 4EQ6A 4D6XA 4D6PA 1GGMA 1LBSA 2YASA 2HMWA 2R6GA 5FFFA 1H1LA 1E3WA 2CHVA 3OEHA 4IO0A 4TXHA 5EMMA 3L9WA 3PNBA 5BMVB 4ZU1X 1TA4A 4XUGB 2CLSA 5AP9A 1AMNA 4K6HA 4P3NA 1PQ4A 4HAOA 2E5LB 3HSSA 3BX1A 1MQ9A 3LNCA 4IRXA 5EJ5A 3C8MA 5K8JB 2F64A 3HVUA 4W99A 1D6SA 3E81A 5IU6A 4GZMA 1J0DA 1I3OA 2R1UA 1KMCA 1W2HA 1X9IA 3QFRA 3C74A 3RBZA 1IXSB 4RE5A 2P9JA 5DNYB 4AKTA 4RK4A 1OH6A 3WLEA 4KIGA 3NPAA 3WMRA 3CLUC 1PJ4A 3ZD6A 2JIZA 3RC8A 3BWBA 1CV2A 5CDFA 5AW7A 3C85A 3STXA 4C2AA 4TLCA 5CYFA 1VPEA 3L1VA 4FR5A 4FK8A 3VC3A 4BMYA 2B4YA 5TPWB 1I36A 5TIIA 3JQ8B 3URMA 4E5NA 1JT9A 1W5EA 1YVUA 1Z26A 2VSFA 3IIMA 2A1TS 2NU6A 3NDIA 4GLJA 1XNRB 2XCIA 3DOCA 3NTVA 3VXKA 2W9XA 1QZTA 4HJXA 2QYSA 3COVA 3THRA 1IPFA 1OBOA 2VK8A 4XDHA 3FZYA 3NCTA 1KSFX 1S02A 3W5VA 2CHEA 5L4LA 3UYLA 1FFGA 3RUEA 5L9AA 3MLEA 4AZ0B 2N42A 3WL3A 3ZBPA 2BVNA 3P5BA 4PYQA 5KDOA 1E1QA 5ALLA 1VLZA 4NFHA 1I4TD 1VRWA 2VT7A 3CEMA 4BX8A 4URWR 1U5BA 2CYCA 3GFTA 3OFJA 1N78A 2RK3A 1LDEA 2XYPA 3DNFA 5TT0A 3U7HB 4IIHA 4L5AA 1WD7A 1WVMA 1ZW6A 5C5CA 5G1PA 3CG0A 2P4UA 3O4VA 4O4JA 1Q0UA 3ANMA 4H3HB 1CZKA 5TV2A 3TIXB 4DXDA 1HZZA 2JLCA 2TMYA 5KTNA 2W8BA 3IHLA 4TOIA 1ICIA 2Q5HA 2R8XA 2OCIA 4O2LA 5AKJA 5AKYA 5AOBA 1TM1E 1ZSNA 4B82A 1EEXB 4C4ZA 4L5CA 4LQ4A 4YV7A 5KYXA 3OJXA 4V3CA 1AKEA 4ZEXA 3TQTA 3P71T 4NDNE 2Q5CA 1NLMA 2QX7A 3CNQS 1V95A 2EF0A 1EMDA 3L7IA 3WLRA 5LA6B 3TW8B 1HDYA 2E37A 1LJUA 3DV9A 4DQVA 1W0JD 1DC6A 4V0LA 3NR2A 4GKVA 3TFQA 2RHDA 1KDZA 3E7PA 2A5JA 4PSUA 3RREA 3JYPA 3KJIA 4DDHA 2CCGA 4RJLA 3AR4A 5JZMA 2QUHA 4RGYA 2BFBB 3FLBA 4K6MA 9GPBA 4DM4A 5JMOA 4EHHA 3N2EA 3JARA 2HJHA 1N75A 4LYFA 2AHRA 1OAAA 2B2XA 4YDHB 4C03A 2W0SA 3P9ZA 2IJGX 2FKAA 4LTNA 1CRZA 1QHIA 1Q19A 3NYRA 4N7RA 4BWVA 1X80B 4R8MA 1HE5A 2FX2A 4DLUA 3WK9A 3K6SA 1KZYC 4BKRA 4P35A 5AVWA 2C5HA 3QVLA 5BRNA 3U7GA 1C7JA 3Q1KA 1KEZA 4BFUA 1E3SA 1DBPA 2VWGA 2WR8A 3BK1A 2P6UA 4S2EA 1O6FA 4YJHA 3RTBA 4XGNA 5TQVA 4AT1A 3DOIA 1EXNA 1KPIA 3GLIE 5F76A 2V59A 1K8RA 4HB0A 3VO2A 5IJ9A 2O8DA 2VDVE 5A0FA 1ILEA 3BGWA 2HK9A 2ZJYA 4UTPA 2VQ3A 3FYTA 2D0OB 2FP4B 3RSQA 2CBZA 1XRPA 4BP3A 3NOOA 1TQ8A 4LWZA 3IUPA 5F1YA 4D5GA 4EUSA 2Y68A 1LU9A 2ZVDA 5ALDA 4LZWA 2CL7X 1NJ6A 1DJNA 5U4QA 1TYAE 2G9RA 1NBWB 1PQYA 3C3BA 2XT9A 1MP0A 2Y0DA 4QDJA 3DFFA 3N2IA 3HG7A 1HSZA 1Z45A 4Q93A 3V4SA 3SYNA 2MMGA 3HYTA 5JARA 1E5LA 3DKPA 3AONB 2I76A 2G72A 2FA9A 2OZVA 2DQKA 3BK2A 5ALGA 4BNFA 4DNPA 4NHOA 1YB4A 3DE1X 3VYUB 1NQ5A 3QKIA 3L4BC 1ISPA 4XB2A 4JMPA 4HB3A 5ALOA 1TADA 3M8KA 3ICQB 2GEKA 2PMCA 4XYMA 3S6JA 3RRBA 3N2KA 3AV3A 1FMJA 1T1GA 3JW8A 1N2XA 1Z7BA 3D8HA 3EZYA 4OIFA 1ZW1A 3PNVA 3K5WA 2WU0A 4FJ0A 1J97A 1F4PA 2JAQA 3GRKA 3NATA 3ANSA 5JMTA 1IQPA 3AY0A 1OYOA 4MJLA 1CB7A 3EN0A 4DCNA 4E5YA 4ERNA 1UBTS 1ZONA 1TQ2A 1ZK2A 1XIVA 3BORA 5J4KA 2CVFA 3W2GA 3I2YX 5LXTF 1I4LD 5L6MB 2IXEA 1PK8A 3I23A 1PHPA 1D7OA 1Q5PA 2QOEA 3F2VA 3AR9A 3AIOA 1EQUA 3GX1A 2IPLA 3JQFC 4QEKA 3WGTA 1A9YA 3OCZA 2BMJA 4N7MA 4F4FA 5CB6A 2H6EA 1RWVA 3TMAA 1H2AS 4Q7EA 1X38A 3KKKA 4A8TA 3K2IA 1KJQA 1DAHA 3LPMA 2JHAA 4YRMA 3C70A 3W9YA 3IEPA 3Q6MA 1EM8B 2AL7A 3A06A 3WL8A 3LC7O 3R3UA 5JU6A 3A6JA 5HIAA 3V1KA 3R7AA 3SIWA 3P2EA 5NLLA 3BRWA 4B3RB 3HJTA 1FNSA 4BLSA 1RLOA 1G6KA 1XEWY 3CRQA 3CLUD 3R6WA 3KHKA 4YIKA 1FFYA 2A9FA 3LYHA 4C2BA 2E85A 2HWXA 1NVMB 1X7YA 4RVUA 2O1XA 3VHRA 2XF8A 4CM6A 5KNCH 2BD0A 4G4IA 3EDOA 2ZANA 1BCRB 1HV8A 1QVWA 1YC2A 2VJOA 2VQSA 3KEOA 4OB6A 2H9AA 4QOEA 4XQEA 2NVUB 3UB3A 3V4ZA 4D9HA 5K9ZA 4XASA 4RZSA 4LSZA 4TYNA 1MZPA 3EJ6A 2QVCA 4PN3A 3K0AB 3HM9A 4ZVSA 2IODA 4J9UE 1PLJA 1P0IA 3HXLA 4O4IB 1DTWA 4AQDA 4BIMA 4GQBA 2Q6VA 4GL2A 5LVAA 4B6FA 3KT6A 3P4UA 5IAKA 4YRDA 4A8PA 4AYXA 1PR5A 3ZN2A 5LCXA 3LRTA 4DQXA 3TOZA 1UANA 4EFKA 1OSNA 2PKCA 5T41A 3HCOA 3QWBA 2QYOA 4WGFA 2ZTSA 1ZM9A 2QEQA 1MJFA 2V98A 3CF2A 3B12A 5JCXA 3QVGA 4D3DA 4L3WA 3TAUA 5JJLA 4DR4B 1ORRA 1SBYA 2BIFA 1MO2A 2C9OA 4OMCA 3UCEA 3VOSA 3ER8A 1QHXA 1U0GA 4LKRA 1I51A 1THZA 3IJEB 5B7GA 1TUBB 4TV9A 4V0KA 4U7WA 2VJYA 1ZLYA 4U2CA 2QTZA 1E94E 3OUTA 1FTYA 3RJMA 2P9YA 4QJBA 5I4IA 1CUDA 2JAWA 3C6BA 5L3ZA 3UUGA 1VYUA 4GFDA 3VA7A 3LQRA 2A67A 5T5QA 3WKDA 4E6EA 3RGGA 1OXMA 2XOKD 1ZXLA 4L4XA 3IEXA 2BE7A 2O8NA 2HLHA 2GN2A 3GQBA 4N01A 4IEEA 3W9BA 1OZFA 2XCQA 3ZU4A 4IKPA 2G1UA 4JT2A 5ECWA 1U7XA 2A9RA 3P32A 4HBGA 4I50F 2PKQP 5KVVA 3G0DA 2I7DA 1KAGA 1TNDA 3EGDA 4TS3A 4WBNB 5C1BA 1FE8A 2VBGA 2O7QA 3IQHX 5CFMA 4J94A 2TMGA 2HT1A 2D1SA 4PHGA 4J49A 4B6JA 2UZ4A 2R62A 1A7JA 4YBZA 3KS9A 2GA8A 3R20A 1TTTA 1DAKA 1ZI8A 3OLVA 2A78A 1CRLA 1O6BA 1RYEA 1U3VA 3DTYA 3ESAA 3FOBA 3QVGB 4LJ9A 4A92A 5KQMA 5LJIA 1FUIA 4RJIA 2CJWB 2M9MA 3FIUA 3ORHA 1GTRA 2CNKA 4YFVA 2CFRA 1Y6JA 3PLRA 1QPBA 2GN8A 4GUDA 3KX2A 4J4BA 4MVWA 3NP7A 1THGA 2AWOA 3C7CB 2ODWA 3FWNA 3NNNA 4KO8A 1PFKA 3E9EA 4I4LA 5K6AA 1WXEA 1VA5A 2J59A 2YXDA 2ZUCA 5E9QA 1PD1A 1TUEA 4PE5B 3V00A 4JYBA 1D8TA 1Z7GA 4YC7A 3VJKA 5EXSA 1FA9A 1SHUX 1DC3A 3GXBA 4HGYA 4M7PA 3TRJA 1QGOA 3WMGA 3D8BA 3N5CA 1GN8A 5LP6C 1U6JA 1WXDA 4DWVA 3FCUB 2O23A 4KE8A 2GPSA 4N48A 2J4DA 1BMFD 3DFZA 4TVKA 3H7IA 3HN2A 2V7GA 3VNSA 5ARCA 1CUFA 4LY9A 4CLHA 2FDCA 1NM5C 1UJ2A 3AUAA 3HKBA 5JYCA 3QBJA 2HMAA 1W4LA 1RRGA 2C00A 1CD5A 3MINB 2EJCA 1PJAA 2J3DA 1YA8A 4AZTA 1C1YA 2SKDA 4D9CA 1VJ0A 1AKYA 5J4HA 1FVXA 2ZYRA 3PPVA 4JQSA 4S12A 1S6YA 5AUNB 4TVOA 1UBCA 1TM2A 4JC5A 1M7HA 1WD5A 1WSDA 2BSXA 1JBKA 2Z0MA 1TM4E 4TPKA 4YAIA 4ND3A 1M2OA 1KMHA 2IYVA 4EW6A 4JLMA 3IAEA 1WZCA 5FQNA 2OFPA 4ICIA 1VJGA 1KQ3A 3PEWA 1LI5A 5E1BA 5KPJA 3OZRA 4X97A 2V7BA 1QONA 1SZDA 3ZNQA 2WLTA 3Q8XB 1S3FA 1E2HA 4G81A 5D5HA 3UMJA 2F3TA 3ETJA 3MPOA 3T5AA 1JB1A 1Z8HA 2A4MA 2HHJA 3LCCA 3RROA 2BTQB 5ITZB 1SIOA 3UICA 4IGAA 4P22A 2NPFA 4PLFA 1AMOA 2FPGA 2ZWOA 4MCAA 5HUHA 1SR8A 1RW4A 2OGWA 5F21A 1RI2A 4J6EA 4TYWA 1SQSA 2ZYGA 3WI7A 1GUZA 1Y4ZA 4E32A 1QH0A 2F00A 2ANCA 3BAFA 4JT9A 3IPRA 1UXOA 5DW0A 3VO1A 5CVEA 5FF9A 1PR2A 2EG9A 1J8VA 1FTQA 2GSDA 3C3EA 4K9QA 5DM0A 1S2MA 4IWYA 3O47A 4QRHA 3PPWA 2R65A 2WFLA 4LE2A 4CGZA 4Y6RA 4KC0A 1MB4A 2JFOA 1AZWA 3AEUA 5GM1A 4BIIA 4DEXA 1EINA 4HGNA 3PRHA 1D4OA 4G5RA 3HCCA 3BQNB 3GY0A 3IX7A 4KMRA 2P3QA 4YQFA 4O2BF 4P4TA 5DB4A 1FDOA 4QQRA 2ID9A 3ZWQA 1U7UA 1JE0A 1L5GB 1MJ5A 3LP8A 4P84A 13PKA 1IUOA 4HGOA 3EPRA 4HPXB 5C35A 5JD5A 2GXAA 1CRPA 4K9DA 1JXMA 1T3GA 4LF5B 3GRRA 3RRFA 2IPAB 2QJFA 4JNCA 3L40A 4HDKB 2V6BA 3NCHA 4C14A 4EUEA 2PUDA 4G0XA 3ZC3A 1ZYUA 2XE4A 4W5TA 1Z39A 1PK9A 1JIXA 3L02A 4QPDA 1B0UA 1C30B 1ITZA 1VYTA 2PR7A 2YBEA 4UVIA 2AS0A 4W5NA 1KQNA 2QR5A 4XYGA 4BMXA 4YMUA 5JD3A 2UYYA 3BUSA 4MQ4A 4ARAA 4KQWA 1GGFA 1Z3CA 1ZC4A 4K88A 5E0KB 4YWJA 1H4VB 2JKVA 2E4WA 3DO5A 4U7HA 3TEFA 3FWZA 1UDAA 5CPFA 5K3FB 1EFHA 4JJ8A 5BT8A 3GV0A 4JC8A 2BH2A 2ZWMA 2XZTA 4QULA 1IY8A 1G7CA 1HQCA 3OQHA 4QYXA 5FPPA 1KO8A 2ZSUA 3OBIA 1TI7A 2XUFA 2NV0A 1E2EA 3B20A 2GEUA 4LDJA 2YYSA 3RLFA 1TEVA 1RYBA 5KNDH 3WGNA 1BQ4A 3D0QA 5WRFA 1XVUA 4KFTA 1Z6TA 3SR4A 1AN9A 4EHNA 3TLXA 3BL6A 4MKFA 3AINA 2JDID 4I8XA 4AMVA 3I5YA 4LXXA 4ZTUB 2DUUA 4IILA 1KWKA 3NIBA 4GO1A 4LZJA 2H1CA 1E2FA 1ZIDA 3M2PA 4G0ZA 1RP1A 4PCUA 3RAPR 1SUEA 4MW5A 3TZ6A 1LX6A 1JIVA 5BQ5A 3W9SA 1U1IA 2WHQA 3E1KA 4EA6A 1DRKA 2AOUB 3LLUA 4DSTA 4FFNA 2QP9X 2DY0A 3T61A 2UYHA 5BQFA 3AUJB 1W5FA 1GZSA 1Y4AE 4P98A 1Y8QA 3HU2A 4Y2UA 1EJ0A 5TMEA 2XDQA 4KO3S 1OBCA 2QN1A 4I08A 2XBUA 3VPFA 4E51A 1U3WA 3WC4A 4DA0A 1ELOA 1VIVA 2W2LA 3D7NA 5IH7A 2FGJA 3VMMA 1MRNA 3N6VA 4HEHA 2MDTA 2AE2A 3MXTA 1Z62A 1FYDA 4CIVA 2EJVA 1R8SA 2QX8A 3DV0A 4S3MA 3IODA 2NUPB 4M0KA 3PICA 4RHXA 5DDIP 5HMMA 1R4MA 3OOJA 2PGNA 3FDZB 1WB4A 1MMFB 3QU7A 2PXXA 4HSGA 3U81A 1U9ZA 4FCCA 1JGTA 3OZ7A 2NTEA 1Y8RB 4O4LB 4D4GA 4L28A 4BBZA 4AX4A 1VL8A 2FZEA 4XIJA 3DTVB 2RC6A 4E5KA 4F38A 2HEGA 3THWA 3WKEA 1EPUA 2P4SA 1A8PA 1U2SA 4UQOA 3VSBA 4MRMA 2IHNA 2A2ZA 1RJDA 2C42A 3R5XA 2R5NA 4LMRA 1CF9A 3MF4A 3S68A 3MRVA 4H0CA 3BXZA 1T2DA 1CZLA 4FNAA 3T7SA 2YHIB 4ZMSA 3H6KA 4POAA 2XWJI 4PZZA 2YTZA 4Q0MA 2HMVA 1B42A 4P80A 4ND6A 1BROA 5AJHA 3TRKA 5J2TB 4GM1A 2KS6A 3OOEA 2P7HA 2FSVA 3TTUA 2ORVA 2W4MA 2H48A 2OYCA 4MH0R 4FHDA 4L9SA 3RI3A 1ID1A 1FDRA 3DCYA