2QXTA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 4.5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 66
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxtA00
4UBNA 4ZWNA 2AJCA 1QFSA 2BCEA 3WWPA 2XQFA 4M0FA 1KU6A 1EX9A 2JGEA 2DSNA 1CUVA 2WQZA 3KDAA 1XKLA 1Y37A 4Q82A 5HK9A 4N8SA 2J3DA 3HI4A 3DKRA 3H2HA 2J4CA 4UBLA 4PV7A 1DT3A 5HF9A 5DNWA 3WL5A 3QVMA 4WDQA 1A8SA 2FJPA 2GYUA 3I28A 3BF7A 1QTIA 1XQYA 2WUEA 3FBWA 5JASA 3QM1A 2Z3WA 4HZGA 4XVCA 4EY6A 1SCKA 2GBIA 1EVEA 1U65A 3FOBA 2XMQA 3OM8A 2XQJA 2ROQA 4WY8A 3O4HA 3K2IA 1ZICA 5D3ZA 1MNAA 4JNCA 1H2ZA 5CT5A 2WTNA 1C7JA 4N5HX 2CEKA 2HM7A 4DGQA 1CLEA 4FLMA 3BXPA 2CZQA 4OYYA 1CRLA 1EK2A 1BRTA 3VKFA 2VSQA 1E8DA 4IH9A 2WU4A 1X70A 1VE7A 4DMKA 1OCEA 3STVA 5HFNA 4PW0A 2VAXA 2EDAA 5AK4A 1R1DA 1EH5A 5DYWA 2DCMA 2DFPA 5AI5A 4BCDA 4Q1VA 2JGIA 2ACEA 4MYSA 3O9VA 3I2IA 4J03A 2Z8XA 1AZWA 1UT6A 1N5RA 1CUWA 2WIGA 1EB8A 5ALHA 1XLVA 2ZVDA 2C5FA 4WFJA 1GKLA 2OAGA 3LS2A 1OXMA 1TRHA 4KE8A 1VOTA 2O2IA 1LPNA 3C8HA 4DSAA 3D4LA 2QVBA 3FVTA 3B3QA 3OURA 4FLEA 4EZIA 1T4MA 1XRQA 3BIXA 2WHRA 2O7VA 1EA5A 4G4GA 5LZ2A 5I7UA 5DTJA 3RLIA 4P93A 1BEEA 1FSSA 3PUIA 4RNCA 4DNQA 1JMYA 2PSFA 4UHHA 3ZPXA 4BVJA 4LXGA 4XX1A 4X6UA 4C01A 4G4JA 5AK6A 5LLSA 5K3DA 1CUYA 1K5PA 2VA9A 1USWA 2CKMA 1Z68A 1UKBA 2Y2VA 1ZI6A 5CTAA 3WK5A 1JKMA 2B4KA 4B80A 3E3AA 2JGJA 2AJBA 4J7AA 5T4HA 1ISPA 4YX9A 5K3AA 2XUAA 2DHCA 1BU8A 1WB6A 5HF6A 2OLEA 4G9GA 4CCYA 4UFNA 3QMWA 5D3KA 4X92A 2HA6A 4OSEA 3AZPA 1TCBA 2QXTA 2PM8A 5HCUA 5HFAA 3ESAA 3SK0A 2BKLA 4X90A 5J3JA 3M3DA 1HPLA 1UKAA 5JD4A 4OCZA 3EQ9A 3ED1A 1L7AA 4BDTA 1C4XA 4G1FA 3C5VA 4WCVA 2JGMA 4KEAA 3IA2A 1Q84A 4BYMA 5DWDA 4FLFA 4AN0A 1K4YA 4H7KA 2GZRA 4AN1A 2OQIA 1YCDA 3LP5A 1IMJA 1F0PA 2G63A 5D7BA 2FJ0A 3H19A 3Q0TA 3RARA 1LPSA 4L0CA 1CUEA 1XLWA 2HA4A 4X6XA 3FYTA 4B85A 1EVQA 3FLAA 1UZAA 2VEOA 1P0PA 3IIIA 3WIBA 2C4HA 4AX4A 4C4ZA 5C7YA 1IZ8A 3E0XA 3HYSA 1XZKA 4J0IA 3CCCA 1JJFA 3DNMA 4W63A 2K2QB 5I8PA 2V9ZA 5FRDA 3YASA 3FAKA 2JIDA 1PFQA 2XLCA 1LBTA 4BZZA 3SX4A 1XZFA 2RHTA 4CCWA 5DNVA 4YASA 3K6KA 2YASA 1B6GA 1ZD4A 1L7QA 5FPPA 1EINA 1J06A 1IUNA 1UOQA 2GYWA 4GHWA 3AFIA 3DYIA 1JT2A 5AHXA 4UHCA 3DYVA 5K3FB 3IUJA 3OOSA 1XZMA 2C5GA 1XKTA 5HK8A 4WY5A 3O4IA 2ZJFA 1NU8A 2RAUA 1HL7A 5CURA 4B0OA 4BC0A 3H17A 5IKXA 4TVKA 3IDAA 5AM1A 3I6ZA 3ESBA 3W2TA 4Y2SA 3PDCA 4JEIA 5JAOA 4B9AA 1B41A 1MU0A 1K63A 3G9UA 3F96A 5FP0A 2AXEA 1VJ5A 1AMNA 1J1IA 4FKBA 4AZ3A 4HXGA 2BFNA 1C7IA 2WG2A 4GXNA 2VJDA 1ZIXA 1LPPA 2XUGA 4YPVA 1IZ7A 3VISA 3HSSA 4S0XA 1YASA 1UXOA 1OILA 3AUKA 4DM7A 5JAPA 5E4TA 5AI6A 3M82A 1CUZA 5ALDA 3EQ7A 5A71A 3H2IA 3KXPA 4B7ZA 2OCIA 2HA0A 3PFCA 1A88A 4BP8A 1EDEA 1G66A 3KSRA 1LZKA 4OPMA 4BBZA 3I1YA 5AI8A 3S8YA 1SCIA 1DT5A 1QIEA 1DTEA 2GYVA 4E15A 3TJMA 5HQ3B 2HFKA 3TGLA 3UUEA 3I2KA 3E4DA 4Q3LA 1S8OA 5SYNA 2HA7A 1LNSA 3H0CA 2OCLA 4RGYA 3F8SA 4G8DA 3AJAA 5JYCA 1ZOIA 2H7CA 2XUIA 4AQDA 3MUOA 1NX9A 1E5TA 3OC0A 1KEZA 4BCBA 3O4JA 2B20A 3LIPA 3WKDA 1TCAA 2XQIA 4I4CA 4UHDA 3DS8A 1CQWA 3AZOA 4QEKA 1EDDA 5YASA 2BGNA 1MAAA 1YB7A 4GECA 5DTIA 1GXSA 2UZ0A 4AZ0A 4J0HA 3WLAA 2VAVA 4ROTA 3FYUC 1CFJA 4KE6A 4OUKX 2HU8A 5C8ZA 2XMRA 3NWOA 2VT6A 5KWIA 1TQHA 3JW8A 4WJLA 4RPCA 5CMLA 5EI5A 4HRYA 5CXUA 4BAUA 1DU4A 2ZJ7A 3M83A 4DMFA 2X5XA 3HC7A 3R3UA 4BTVA 4ARBA 3OG9A 4G8CA 3WK7A 3DEAA 5ALWA 2YXPX 5CH8A 1MNQA 5CT6A 4W1RA 3I2HA 2XB6A 5ALFA 5CXXA 2AJDA 5HF5A 4DLNA 2H1IA 1ZJ5A 2J4FA 2QUBA 1JJIA 4Y2PA 2H7YA 4J0GA 3JYHA 2Y2UA 5EFZA 4K6GA 2CBGA 3H1BA 1QIMA 2ES4A 4EY7A 1DQZA 4KRYA 4GEGA 1ODSA 5CT9A 2Z3ZA 5JD5A 3I2GA 5K3BA 3UUFA 5BWCA 2WJ6A 2VTVA 2C58A 1QONA 1CUCA 3BF8A 4AO8A 4BB0A 1XRRA 4U2DA 5F4ZA 2QT9A 4XWGA 5ALUA 1BN7A 5ALOA 5ALEA 3STTA 2Z8ZA 4H7FA 4E11A 3H2GA 5AOBA 3A6ZA 2DQYA 1K8QA 4UHBA 1QGED 5FOQA 5CBKA 1HQDA 4Y2RA 5LYYA 4Y2TA 2XT0A 4PSCA 4FNGA 1W76A 4CI9A 4HXFB 2BUBA 4MYDA 1BN6A 4ZV9A 1YB6A 3ZV7A 4MQLA 5JZBA 1LPAB 4MEAA 1UOOA 5JADA 5IVIA 5ALLA 5I9IA 1XZGA 1R3DA 3SC2A 3KD2A 4X7BA 2QMQA 3WA6A 4QWWA 1QFMA 5A7HA 4Q3KA 1XQWA 3C5WP 3NUZA 3DLTA 1Q0ZA 5KBYA 2WHPB 2IIVA 2VQ6A 4PO3X 4AO6A 1GQRA 1MTZA 2OGZA 3VJKA 1VE6A 4MEBA 3PF9A 3BJMA 3G0BA 1MO2A 4K5QA 2XMSA 3C87A 3R3VA 1YS2X 4DNPA 5AH0A 5JZSA 3X3HA 3PICA 3LLCA 2HRRA 3R3ZA 4FBLA 2ZYRA 1T2NA 2XUFA 2C0QA 1DQYA 1IUOA 1I6WA 4LHEA 3M81A 2ACKA 4CIAA 4JYMA 4IHAA 1M33A 2WTMA 3L1HA 4UPDA 1WHTA 4LIPD 4B82A 2H7XA 5ALJA 5JD6A 2VJCA 4WFKA 2HA3A 5IH7A 2Z5GA 5CT4A 4J0KA 4HRXA 4INZA 1BCRA 4AMYA 5ALXA 2JBWA 1QIKA 1WPXA 3QH4A 1WHSA 4F0JA 5AK3A 4Y7DA 1ODTC 3QITA 4DIUA 5AOAA 3HABA 3ANTA 3C6ZA 5ALYA 3DOIA 4CG3A 2OXEA 2EDCA 3FLEA 2XI4A 1CQZA 5BOVA 3WIOA 4GW3A 5AM3A 3QMMA 1BCSA 1EB9A 4OU4A 4F21A 3QBJA 2WFZA 2ZSIA 5LIPA 5ALMA 4DMHA 2ONCA 2G4LA 3KOOA 5HKAA 4N5IX 2DQZA 2HU5A 2GBFA 1A8QA 4NVRA 3G0IA 1DWOA 3V1LA 4F60A 4UFOA 1MX1A 5AIBA 1ETHA 3AIKA 3ZLVA 3WWOA 5FV4A 2OCGA 3H04A 4H7JA 2BUAA 2I3DA 4Y2YA 5LKRA 5AK5A 2PPLA 1JMKC 1EI9A 3QYJA 1JU4A 2CMFA 2WFMA 2WHPA 2ORYA 3GFFA 1R9MA 1AGYA 4W1SA 2W6CX 4OD0A 1ODCA 3WZLA 1K6EA 4NMWA 5H3HA 1Y7IA 3N2ZB 3A70A 5AI4A 4E46A 1GZ7A 1QIHA 2Y6VA 4QA9A 2ZSHA 4QLAA 2E3JA 5AICA 4Y2JA 2JGKA 5C8XA 3O9MA 3MGAA 4CIBA 1CUXA 3BDVA 3WK9A 3IB3A 1A7UA 3QMVA 4BP9A 2WJ4A 4B6GA 4K6KA 5C81A 2PSJA 4UBMA 3VVLA 2D5LA 1O6GA 3GROA 2ZYSA 1Q83A 4X94A 3HRHA 3A2NA 4BRZA 2VJBA 3WMRA 2HIHA 3PI6A 4EY8A 3O0DA 3F97A 3IURA 4EY5A 3CXUA 1G5FA 3FYUB 3FCYA 3VDXA 3GA7A 4EB0A 3AILA 4H7EA 5LZ5A 5K3EA 4W1PA 4O08A 2O7RA 1JU3A 2I3ZA 3DCNA 3O4GA 2ZJ6A 5LZ9A 2CJPA 2LIPA 3KWJA 2JGLA 4C89A 4CFSA 3MVEA 5E4YA 2RONA 1P0QA 1E89A 5AOCA 5EHXA 1PV1A 3R3WA 1TCCA 2B9VA 4UBIA 5CH5A 2XQGA 1CVLA 3G0DA 1XZLA 4ZREA 5A2GA 5ALSA 4X91A 3STYA 2VF2A 2WSLA 4G5XA 4CG2A 1VZ3A 1ZIYA 4Y9SA 3D7RA 2QZPA 5T4BA 2XUJA 4Q05A 4L3WA 1HBJA 2NW6A 1VZ2A 4K6HA 2J3QA 3WKBA 1CUJA 4H77A 4U2EA 2VT7A 4HXEB 1VXRA 4GDMA 2XMZA 4Q3OA 3A2MA 3WZMA 1G42A 4FFWA 4LYDA 4EUSA 2XDWA 2Y1KA 2QRUA 1UK9A 4BTLA 5LP1A 1YA4A 1AKNA 1RP1A 1GQSA 4YK7A 3WKEA 4HAIA 1F0NA 2WHQA 5AKKA 2PX6A 3DD5A 1CV2A 1RYYA 1FJ2A 3G8YA 1UFOA 1LGYA 4PSDA 3WI7A 1SOMA 5FLKA 3G02A 5K3CA 4J0CA 5HQ3A 4LXIA 4PF1A 1QIJA 1H2YA 1ZD3A 3G9XA 1QIGA 1CUFA 5DJ5A 2OGTA 3FWHA 4N8DA 2WJ3A 4U2GA 1U8EA 5HF8A 2WIFA 4DTCA 5IVDA 1EK1A 4Q34A 2RGUA 2B61A 1AUOA 3WK8A 4UUQA 4X71A 5AKEA 3D5EA 5LZ8A 1TKRA 3FVRA 2FUKA 4QDZA 4H18A 3WKAA 4B83A 4ZV7A 3VXKA 3RKSA 5C8VA 3DOHA 2D0DA 1WCYA 4QDTA 4OB7A 5K3FA 1MPXA 2FX5A 3G9ZA 4J0DA 2V97A 5FPQA 1X2EA 4BE9A 4AMZA 3QZUA 2G5PA 4F5ZA 3ZI7A 3IBTA 5ALIA 4QWMA 1LZLA 2AJ8A 3CN7A 3HJUA 6YASA 5CRIA 4P92A 2BJHA 4MXDA 4QZVA 5CW2A 4GLBA 4WFIA 2YYSA 4X3CA 5FUMA 3FSGA 4GWLA 3SWWA 4GI1A 3FYUA 2HADA 3BIWA 3FCXA 4C87A 4E14A 1QIDA 2QOEA 1THGA 1TK3A 1WOMA 1XZHA 1XZIA 2JGFA 1SC9A 1AC5A 2XMGA 3OTQA 3IUMA 2IITA 3W05A 3R40A 5JAHA 2XMBA 4TPKA 4C4YA 4BDSA 3V48A 2BUCA 4EHBA 3E1GA 1RWQA 1VKHA 5CT8A 1Y7HA 1H2WA 1XQXA 4Z49A 3V1MA 3NGMA 5AP9A 5JANA 2WG1A 1GGVA 1WB5A 1LPBB 1QTRA 1YAJA 1QO9A 1N8SA 2HDWA 4OB8A 3IVMA 4DSZA 1XQVA 1CR6A 3CN9A 4DYHA 3DL4A 1GPKA 1CUBA 2PSDA 1W52X 2XUKA 1MJ5A 5HKBA 4BAGA 1XZJA 3QPCA 4X95A 3WYDA 5ISMA 1THTA 5AO9A 4QDXA 1H2XA 3AIMA 3STWA 5DNUA 3LCRA 1TAHA 5DLPA 1FFDA 2PU7A 4A5SA 1CUHA 3G0CA 4MWSA 1QO7A 1CPYA 1XZAA 1H23A 3W04A 5ALNA 2ZYIA 1KU0A 1QJ4A 3I6MA 1W75A 4QE3A 4I3FA 2DR0A 4D9JA 5FXMA 4FBMA 3EF3A 1YAHA 3AINA 3V9AA 3WJ1A 2AJLI 4AO7A 3RK4A 4Y2XA 2RI6A 3P2MA 1R50A 3I2FA 4RE6A 2PBLA 4U2FA 4BATA 1QIFA 2WIJA 1XRLA 2O2GA 2PU5A 4H7DA 4KYVA 1XZBA 5SYMA 5A7GA 1ZJ4A 2OGSA 5T4EA 4X00A 3D2BA 5ALQA 1ORVA 2XQKA 1QIIA 4KAJA 5K5EA 2O2HA 3ESCA 1HLGA 2Q0XA 4IH4A 5AKLA 2YH2A 4JH0A 4UBKA 2HFJA 1AX9A 3BE8A 4K2AA 2QTBA 4J3JA 4QNNA 5AKYA 3WL6A 4KE9A 3L1JA 2WG0A 4FNMA 4KAFA 2XMCA 5FDFA 5AM0A 2R11A 3STUA 3W06A 2PUHA 3H18A 3D59A 1PJAA 2WFLA 3C6BA 2BAGA 1CEXA 4V2IA 3B12A 4KACA 4OU5A 2BGRA 1ZD2P 5ALTA 3DKKA 2GBGA 3DJYA 5HZGA 5AI0A 5AKGA 3D3NA 5ALPA 5EIAA 2DHEA 3O95A 3PE6A 4UBJA 3R3XA 4B81A 4W9RA 4UHFA 4LKOA 1CUUA 4A23A 5ALGA 1YA8A 4PNZA 1LLFA 4X85A 5EIEA 4JYPA 1NU6A 3D0KA 1QLWA 3QPAA 4G8BA 1XZCA 4QDOA 4AXBA 4H7IA 2JEYA 4ZRDA 1ZGCA 2WUDA 4U2CA 1R88A 2OCKA 2VATA 1TIBA 4U2BA 1WPRA 5ALVA 2XE4A 4P9NA 5JARA 4ETWA 4FTWA 1U4NA 2RHWA 3L1IA 4EA6A 3EBLA 3W9UA 4IO0A 1WB4A 2XUHA 3IUQA 3H2JA 4CG1A 2Y6UA 3T4UA 2XUDA 1MT3A 5JZ9A 2QJWA 4BCCA 1LPOA 3R0VA 1ACLA 3I6YA 1BEZA 4Y2VA 2X76A 1XLUA 1QOZA 1UOPA 1DINA 1UWCA 2PVSA 1UK6A 2WKWA 5LZ7A 2EEPA 2WM2A 4A16A 5JATA 1ZD5A 3WYNA 4ARAA 4QDUA 3W9BA 1SCQA 1CUIA 4M0EA 4KR0A 2PL5A 1QZ3A 1J2EA 5ESRA 5EHQA 4MJ3A 3Q8WA 3I2JA 5LKAA 1L7RA 5D6OA 4XIIA 4KE7A 1CUSA 5A62A 1ORWA 2QR5A 1E8MA 5EHZA 1E8NA 3HZOA 1DWQA 2OQVA 1FFCA 4BVLA 3LIIA 3I1IA 4LYEA 2XUOA 4X6YA 5ALRA 4H7HA 4LXHA 4ZI5A 1X2BA 3PF8A 3PUHA 3MUNA 4B84A 1HKHA 1IVYA 1MX9A 4GBGA 3VJMA 2HA2A 2XMDA 3CCBA 3U0VA 1J07A 1DWPA 4HTAA 3UMJA 5BV7A 4KJXA 2QKYA 5ALZA 3HLKA 3NOXA 1AQLA 3S2ZA 1R4ZA 1F6WA 2PKYX 5JIBA 3WL7A 3KWFA 1EDBA 3WWEA 4C4XA 1P0MA 3IULA 3WWDA 1W1IA 2V96A 4C88A 4P08A 1BS9A 3WA7A 1XZEA 5AIAA 2ZYHA 3BDIA 4HVTA 3R3YA 1ZI8A 1BROA 1GPNA 1UK7A 1EXWA 1GPLA 2PSEA 3GZJA 1YS1X 3H2KA 2R8BA 4UHEA 2WLSA 3ANSA 3K9BA 1UKCA 3D2CA 4G4IA 3BWXA 3BL8A 4FDMA 1HDEA 1MAHA 1U2EA 3G9TA 4DNOA 3V1NA 4BE4A 4EBBA 4FHZA 4DMCA 1LBSA 1VA4A 1MX5A 3GBSA 4L72A 3HXKA 3ZWQA 3ILSA 2GBCA 1FFEA 3FLBA 2JEZA 1XRPA 3WK6A 1G4HA 4C6HA 1ACJA 5AKHA 3C45A 4PSUA 1AURA 3ICWA 2X8BA 5IVKA 4JUIA 2OAEA 3WJ2A 1E66A 1VXOA 3IUNA 2HU7A 2I03A 1XFDA 3HACA 4Y2QA 3ZLUA 4UBOA 5DYTA 1XRMA 1P0IA 2PSHA 5CH3A 5KWJA 5LZ4A 3T52A 5ALKA 4M0MA 4X93A 1QE3A 3FSGD 2ECFA 2WILA 4MQMA 3AIOA 2H9YA 2V98A 1IUPA 2DHDA 1GT6A 2HRQA 4N8EA 1JFRA 1MN6A 1BE0A 4UFPA 3V1KA 3FNBA 2QXUA 4WDRA 3F98A 3C70A 1DX6A 7YASA 4I19A 2HHAA 2CB9A 4XJVA 3G7NA 4QLOA 2WFLB 4BZWA 1D07A 4BC1A 1Q0RA 4AB1A 1YR2A 4H0CA 3WKCA 3ESDA 4OYLA 3C43A 3DL7A 5EGNA 1WM1A 4J0JA 2QUAA 5JAUA 2WU3A 2OPHA 3D2AA 2VJAA 3A2LA 3WK4A 3WL8A 1VA5A 4BVKA 1CUAA 1JI3A 1H22A 5E4JA 2HL6A 4KRXA 1CUGA 3GELA 4FFVA 4ZXFA 2JF0A 4EY4A 4IQ4A 1SFRA 1O6FA 2I78A 3R41A 1FFBA 2W22A 1LPMA 5E2IA 1E3QA 4PQEA 4ITVA 3VJLA 3EQ8A 4BAZA 3HEAA 4H35A 3F67A 3STXA 5BWBA 1F8UA 3C8DA 3GUUA 5AKXA 2C7BA 2WIKA 3RM3A 2P8SA 3OPMA 2QJRA 2XUPA 4Y2UA 5AM2A 3U1TA 5AM5A 3WQHA 4B9EA 4B0PA 3ICVA 5AI9A 2XUQA 5EIHA 4OB6A 3TEJA 2IX9A 4FMPA 1VLQA 3H1AA 5A6VA 5AJHA 1R9NA 2PUJA 1FFAA 4TGLA 2GZSA 2CUTA 3N0TA 3BJRA 1GKKA 1CUDA 3JWEA 1XROA 1UK8A 3C6XA 3DQZA 5FKJA 2QM0A 2WIDA 3WWCA 4W1QA 2OG1A 1XRNA 1N1MA 5EHNA 5IVHA 2G5TA 2XLBA 4X97A 3DDUA 3C6YA 3G0GA 1ZGBA 3AZQA 1W6RA 4MWTA 5JALA 4KAAA 4DNFA 2HA5A 5A7FA 5AKIA 4NZZA 2WUFA 4CCYB 3EIOA 4FOLA 2QS9A 4HS9A 3B5EA 1JJBA 2WUGA 1EHYA 3ZLTA 4FWBA 4BRSA 4G9EA 1ZI9A 5AM4A 1CIJA 5AKJA 3PFBA 1XZDA 5AKZA 4L9AA 1A8UA 3QPDA 5KREA 2C0PA 4RE5A 5T4FA 4ZGBA 3TRDA 1DX4A 4IH1A 1W4LA 1YSCA 2RIPA 3F9CA 5DYYA 4NS4A 3VVMA 1N5MA
chains in the Genus database with same CATH superfamily
4BWGA 3OP1A 4LYGA 4OGKA 2W42A 4TKVA 1RABA 3A28A 4BQEA 1NFRA 1K7SN 5KQMA 1GA4A 5AJWA 3U3DA 3P9NA 3VH4A 2H0RA 5K8VA 2Z8YA 1Q16A 2J0VA 2RK4A 3DEKA 4FSHA 2QQEA 2P69A 3VO2A 4PIVA 1R4NA 5GVSA 4KL8S 3V9PA 4MO9A 4ID9A 1QG2A 2BEKA 3A1TA 5CLGA 2B94A 3IUPA 3PJGA 2MSDB 3OFVA 1EWKA 2DBQA 1KU6A 3CPHA 3DW1X 3QKTA 9MHTA 1EVYA 1WULS 4AL4A 4I50F 1G7TA 4CUZA 4BMVA 5JFOA 5HRAA 4C2UA 4AFNA 5HK9A 4Q82A 3CRVA 3H11B 1NWCA 2J3DA 2G0AA 3AFGA 3HI4A 3QF4B 4Q48A 1J8DA 5SZKB 4DM4A 1A96A 2J4CA 4MVJI 4UBLA 4BGIA 3IT2A 1DL5A 2YWEA 4NJOA 3N8DA 1UOEA 3RSLA 5AVZA 2RHRA 1WIWA 5DHSA 4E32A 1NP6A 2IRWA 2WKSA 2ZDGA 6REQA 2O8FA 3VOSA 3QVMA 1JI0A 1WXHA 3E8SA 1W30A 4WCFB 4ZCSA 4QPCA 1KAGA 3OX1A 3BF7A 3P2IA 4ENTA 1QTIA 3QXJA 4CEHA 1IJFA 1XVAA 5EMHA 2DLDA 1AQIA 3D7KA 3FBWA 5LQKA 4WKBA 4N03A 4B3JA 4LHXA 4E22A 3OQHA 2LPMA 2JEOA 4IPTA 2CZGA 1JFLA 1O95C 2Q9CA 4HZGA 4Q7EA 4QOHA 2P9FA 3I1JA 5DSZA 2BHLA 4JYBA 5AJYA 1XMSA 4L5AA 1GNVA 4ZOLF 2GBIA 3TNYA 4EHHA 3NVMB 4NH4A 4HDAA 3ORQA 1LCIA 3BTVA 3N8HA 2XZLA 4UZSA 1U65A 1ZESA 3EDQA 3ZHTA 4QHTA 1H3EA 4LJ5A 2XMQA 4G1MB 1E63A 1YDGA 4P7KA 3TUJC 3VPAA 3HS3A 4NDNE 2D54A 1V1RA 3LOUA 1PCXA 2FKNA 4K9SA 1E3WB 1ESCA 1U0JA 2G4CA 4TXMA 1ZICA 2YWHA 3FN4A 2Y77A 4RIEA 3DVAB 4WESB 4J43A 1MNAA 2G8LA 2DWQA 1GL3A 2X6QA 4K9MA 1J9GA 4BIIA 3CSUA 3RS0A 2CEKA 2WE7A 3QLTA 5CFMA 4YAUA 4PYIA 4PSVA 2BN4A 2MOKA 4MRAA 5K0CA 4JXJA 4L3OA 2IVZA 2YDXA 5EWMB 1TC2A 1UF9A 4M76B 3AFMA 3BXPA 3T7SA 2ZZMA 4OYYA 3MYYA 5F3WB 1RXCA 1NQAO 1WXGA 1KMHA 2NUAA 2I9KA 4OMCA 5BVGA 2VHUA 4US2R 3RVSA 3ZWOA 3LLUA 3T5TA 1IB0A 1ULHA 5DH9A 1RBZA 4BX8A 4N7BA 1V16B 1VL0A 1NZDA 1NNSA 1VE7A 3KU1A 5FA5A 4DMKA 1HORA 3QUTA 4RUKA 2BGLA 2XB2A 2NG1A 2EDAA 3QG5A 4B43A 3O1IC 1Y3BE 4NHEA 1FDSA 3EUWA 4DY6A 1ISGA 2D0PB 3CRMA 1L9XA 3SC4A 4YNBA 1A7JA 5BQXA 2BELA 4QJBA 1FEZA 4MRRA 3SYKA 3C3EA 2DCMA 2GUWA 2QG6A 3UK1A 4BCDA 2CLOB 2JGIA 2ACEA 1KNXA 1VE1A 2PGOA 3O9VA 2A1UB 3SLRA 2X3YA 5IW8A 4IOMA 5JS8A 1RLMA 3JRXA 1AZWA 3WIDA 3QBDA 2XT9A 3G59A 3GZNA 4BNLA 4GRDA 3UK6A 1A9SA 1RWBA 2H5EA 4TKVB 3TAUA 3MWKA 1WB9A 3AESA 2WIGA 1U2DA 1G60A 1EFVB 2QMHA 3PC4A 1NOIA 3EDRA 5ALHA 2OV3A 3VH3A 3WRWA 3ELBA 4J9UE 4WFJA 8LDHA 1GKLA 1Z8FA 3WYCA 5L4LA 1E3MA 3GT0A 3LS2A 1DEXA 1TRHA 3DOUA 4TVOA 3SSNA 1L8QA 1VOTA 2GD2A 2GZ2A 1LTHR 5BV8A 5KDOA 2C4VA 2GX6A 2LP4Y 4KFCA 1ZEJA 3SJ7A 3WADA 2HLDA 3GVIA 1TUBB 1GR1A 3IVRA 4ODIA 4MV8A 2QVBA 3BSWA 3O94A 4QBGB 1P2VA 2YHIA 5MFPA 1RM3A 3I4LA 3JAWB 3KM0A 3B3QA 3O21A 2IEGA 1W46A 2BY4A 2C9MA 5LMNB 4FOSA 1BFDA 1GGKA 5HIMA 3WTBA 2Q5CA 1K66A 2AEMA 3K4QA 3KS9A 5CFOA 1HZZC 1B73A 5ARDA 4Z4IA 4UJ5A 1A97A 1IVNA 1QAMA 5FI1B 2WHRA 1GA1A 5FNVF 2O7VA 1T25A 3TPCA 2CV1A 1GQYA 3IODA 4F4CA 5DGDA 1I14A 2K7ZA 4IR7A 4C22A 2I80A 1X8KA 1NJ8A 1Z4MA 2H2GA 5DSTA 3OM1A 4ZIRB 5B4VA 4B1FA 2FEPA 8ABPA 1I0LA 4KX3A 3NKFA 5ETJA 4YPOA 3VMFA 4E08A 2PSFA 1R5OA 2HLHA 3ETEA 4TVSA 1N5LA 3T34A 3G5UA 4R1TA 2MMCA 4LXGA 1KTIA 3RUPA 3SP1A 2ZUUA 3LPDA 5CCDA 3AEQB 4GS5A 2GFQA 4RTNA 4C01A 2XOXA 4XCVA 2DMRA 3ZDRA 4LGCA 3B1XA 5AK6A 2HT6A 3U19A 1Q1EA 3CFYA 4Y6RA 3RWMB 4DJDC 2BTEA 2VA9A 3QY0A 1Q44A 3P94A 4EENA 3O8CA 5K8IA 3L9XA 1KYYA 3R3HA 2E5WA 3ZCTA 4JSTA 1ID1A 1AN0A 3OHSX 4XD7A 3TCXB 2AN9A 3ELUA 3VRHA 4BO2A 2SICE 4LNHA 3WICA 4MA5A 5DTQA 4TUYA 2XHEA 2BR5A 2EERA 2Q4RA 4UOZA 1W36D 4AKEA 3TNFA 2D1YA 3MB5A 1NFFA 3OPVA 4JBIA 4ZYWA 1TIKA 3L01A 2ASVA 4NPCA 1JSRA 1KBOA 2IZ0A 2XUAA 5KJ6A 3TTXA 4N0QA 4H1HA 1HYBA 1FF9A 3PQ8A 3RS5A 2GDJA 3L7JA 5C9ZA 3V34A 4EG5A 4PRYA 1J49A 3IFSA 1P2UA 4HDCA 2OLEA 1Y1LA 4KN5A 2FSIA 3TS1A 1TLTA 2OWDA 5DP2A 1E3SA 3LHIA 3V00A 4EGQA 4ZCPA 1T1JA 4WTOA 1GAWA 2P79A 1W5AA 2Z5FA 1J2JA 4TRMA 3RW9A 2HPHA 2QR2A 4QBTA 1KI1A 2PM8A 3B38A 4PX9A 3T7DA 4IMRA 3PITA 1BVYF 4YJ3B 3WYGA 5K8CA 3ZR4B 2IFTA 1QM5A 3EC7A 4GXQA 2WNHA 2VF8A 2XIJA 1T0UA 1HPLA 4P84A 3M3DA 3C16C 4KV9A 4AXBA 5JD4A 4MVJF 4HV4A 4OCZA 3EQ9A 1T0HB 1Z73A 7AT1A 2FEXA 1NQOA 3GQVA 1Y8RA 3RYHB 4BDTA 1QRSA 1OH6A 1C4XA 4Q01A 4WCVA 2J6IA 3DEYX 1JX6A 3CLSD 4OATA 4XCQA 2KWIA 2AF4C 1V5FA 1AO0A 4XLLA 4LHWA 4D25A 1ML3A 3U16A 3EAFA 3WMFA 5LOVF 3JQGA 4U63A 1N2CE 4NECA 1QWSA 5E1DA 1RHUA 4BFZA 4ENVA 1Q84A 1WW2A 2D13A 4BYMA 3PV0A 1E4VA 5DWDA 3DV0A 3VHXB 2WKQA 1JU9A 4KI7A 4MR8A 4CODB 5A06A 3V4RA 1GGMA 2JLQA 2OXIA 5CG2A 1MEOA 5FBHA 1Y8ZA 4OVKA 4EG6A 3GLGB 5CD1A 1NY6A 1QFZA 4FMCB 4UM9D 2AZTA 4LE2A 1YRQA 4D45A 1JTFA 2WABA 3PEVA 2BSAA 4BGUA 4H7KA 2GZRA 5TY0A 4M1TA 1Q7GA 2WF6A 2ZRLA 3IYLW 3N2EA 3P71T 4UTOA 3W2IA 5JNLA 4MPPA 2XVYA 5T7BA 1Z4PX 3GJRA 2F67A 3HG7A 3QVGA 3BWBA 4GPTA 4MWEA 3GQBA 2QQ5A 3N7AA 3EK2A 2Y67A 3AHGA 3WBBA 1FXSA 3PDJA 5I9SA 1OIWA 1P3DA 1NC3A 3T7AA 5ILQA 1G64A 1CUEA 4B85A 4F1KA 3RVJA 3DBRA 1KI9A 1I5OA 3FYDA 1EVQA 3AF2A 3SNKA 4AJLA 2HQOA 1CLUA 1UZAA 1NKSA 4RD0A 5J43A 1OY1A 1FP7A 1P39A 1P0PA 1SVMA 2AOUB 1RJEA 2XYPA 1H66A 4MKFA 4XD2A 5LXTA 2NP6A 4J7CA 1P2BA 3JTMA 1LRJA 1YIDA 2Q6TA 3OQPA 1IAQA 4CZ2A 1XTIA 5JY1A 5CJ2A 5ED4A 4BMCA 3HYSA 1E2LA 1JEQB 2GNOA 2I99A 3H97A 3MCTA 3OQIA 3BJEA 1YQUA 1D2HA 4LJ9A 3V7NA 3VZCA 4I2VA 2FEMA 3KKQA 2ADMA 5DWVA 4QUKA 4PRZA 1PNVA 4Q24A 2FPWA 3I53A 3DNMA 4XIGS 2FCAA 2JLZA 2CLEB 4JXZA 2F8MA 4NOMA 3RBAA 4CKYA 2R5NA 4AD8A 4DREA 3PCXA 3PEFA 5EZSA 5F64A 3RVOA 2K2QB 3WV5A 1IQRA 4D9NA 3E3LA 1V8BA 3DZIA 3P9IA 1R6AA 4WERA 1F9EA 4O4HF 2JIDA 5KNDH 3SNHA 2QT1A 3O8NA 1N2IA 4I7EA 4M86A 1HT3A 4MW5A 4XIYA 1ZK4A 2ZBGA 3SX4A 2J48A 4F9TA 1XZFA 2RHTA 4GOXA 1U2GA 4QOGA 1DELA 4QQFA 4X3PA 3K6KA 4UEWA 2IY7A 4C06A 3IMKA 2YASA 4EAAA 5HX7A 3NOOA 3OOJA 5FPPA 1E62A 2WB2A 2AMJA 1J06A 1LK7A 1DAPA 3NGXA 4PZAA 2GYWA 5ER6A 5JWRA 3ZJUA 2OFOA 3M89A 1NR5A 3RWBA 2DOKA 3D6JA 5AHXA 5BT9A 4UHCA 2EX0A 2XH8A 2CF5A 4M0DA 4RHXA 3Q3EA 5JXJA 1XZMA 1UANA 4IX9A 1OFHA 3FG9A 3GBVA 3HP7A 3KEOA 3M7IA 3PZRA 4L0MA 4BLSA 4EG0A 2JCXA 3H5OA 1AKMA 1V7PC 2VWHA 4URWR 3ZOZA 4DIKA 1PT5A 5CU7A 2OBXA 2FPIB 3M5WA 3O4IA 1G55A 3NXKA 5C0OE 3WL4A 2RAUA 3RSSA 4ZK6A 5KNBH 3BGWA 3FDIA 1FMLA 1T1RA 4BC0A 1M7GA 5EMNA 1MQSA 1YDMA 2VL7A 2Z2JA 5D8DA 4EY3A 2WYIA 2WAXA 4LV8B 1HE4A 2XCQA 4TVKA 4BXOA 3K09C 5C8YB 1FYVA 1VLVA 1WSWA 3ESBA 5KC8A 5IC5A 1N9KA 3SOPA 4Y2SA 3PDCA 1ST2A 2PX2A 4EELA 2OXFA 3DM9B 4B9AA 2JHPA 1TZKA 5I7EA 3I9LA 3ROKA 5FTLA 3QELB 4RH0A 1QRAA 1GA6A 2A7QA 1ZM2A 2P9EA 1C3JA 1T3HA 4WA7A 5FP0A 3K8YA 3UK2A 1M9NA 4U3JA 3ORRA 4YREA 1YZTA 3TD9A 1W36B 2EYQA 1Z12A 2K5UA 3QHAA 3CW9A 4MGIR 3O6VA 3R6GA 4AZ3A 5KYWB 3UAYA 4TLEA 4DILA 1CQXA 3A3OA 2B8NA 5EZYA 3A1SA 2CDCA 4C4RA 4E2ZA 4M2LA 3KETA 1LPPA 3LA8A 1KQOA 3MG9A 4DT1B 4RPGA 2OCAA 3MXTA 3P5SA 4N0MA 1AH2A 3D8RA 2DC1A 1Q3KA 2W6JD 1QKIA 2I1WA 4GVPA 1RR6A 1E1YA 1WU7A 2GN2A 3HN6A 1YASA 3VKVA 1UXOA 1Y8AA 4L0QA 2ZS7A 1DAIA 4WMLA 1A04A 2VJNA 5JAQA 2Q2WA 4OKIA 5IHXA 4DC9A 1F3OA 3THSA 4DLBA 1E6UA 4IIDA 4X1IA 5AI6A 1N1GA 2KS6A 2P1ZA 2MYTA 5A9SB 3M82A 3MLBA 1CUZA 4HQ6A 1ZY2A 1M2NA 3GRKA 3QSYA 1PWEA 1H2RS 1QH8B 2B1QA 3EQ7A 4HB4A 3H2IA 5A71A 4CGYA 4EA8A 3AEXA 2QE6A 1KQFA 3AUAA 1M2EA 1LZKA 2HOQA 2OFXA 4UAVA 5E4FA 1BJRE 2Z08A 4B31A 1TKAA 2GWHA 2ZKIA 4QU9A 3W5JA 3ICEA 2WT9A 1PT8A 4ZO6A 5IZCA 1V8ZA 3PHIA 4BNWA 4E15A 2JI7A 4R8KA 1F2UB 2FW7A 1E9DA 3AKDA 4CMHA 1NQVA 2HFKA 4XSHA 1U1IA 4Y30A 3KR1A 1AXGA 4JK3A 1DE0A 4KMRA 4NPHA 5TQ2B 3I2KA 2J9ZB 3IAEA 2I66A 2NUBA 2O5CA 3PC6A 1PBNA 2O2DA 3T9DA 3TSAA 5EXTA 3CVXA 5EJ5A 3PLNA 3EEQA 1VHWA 3A6PC 1CR2A 1V95A 1Y3AA 1NLUA 2H1RA 2R65A 2WJWA 2WSIA 3OZRA 4OK5A 4EJ6A 4MKZA 1Z22A 2R86A 4RV9A 4R2HA 3MWFA 1MJGA 3H0CA 5D1NA 4JP3A 4ETNA 3QI2A 1DQPA 4OXKA 5I7OA 2F3TA 2YIVX 3HCEA 2FRXA 4KO8A 5MN5A 4YIHA 3RHTA 1ZOIA 5JYCA 4IDOA 2Q4DA 2H7CA 4FB5A 1HC7A 4IUBS 4EBFA 5E1OA 5GGXA 1QYDA 5JRJA 2FWMX 2AOWA 1RKQA 2FE1A 2JB9A 1E5TA 4S12A 4RNDB 5E3JA 5D87A 5M29A 4M0UA 2B4QA 4MV7A 2BJVA 3LIPA 2BFWA 3A04A 1RHRA 2AD5A 1XTBA 1TJYA 4MUKA 3IR5A 3ABOB 4RD2A 2M6LA 4Y3UA 4MHOA 3WLEA 1OH5A 4I4CA 1AHHA 1N7IA 1Z07A 4YCBA 4YQYA 1P60A 3V2GA 4ZEVA 3SGLA 3FSEA 4OQEA 1U6JA 2X0FA 2GJ8A 1XZPA 2O59A 1TO6A 4C7MA 5AW4A 2H4ZA 1Y3CE 3UNXA 5YASA 5ILGA 5IP5A 3HCCA 4C9BA 4XW2A 4QGSA 5I47A 3PUVA 3AEUA 2BGNA 3RYTC 1V4BA 2PJZA 3T94A 2V6IA 2D0IA 2C8KA 5AD1A 3C4JA 1RQXA 3WB2A 5B1YA 1GZ6A 1IZYA 3EG9A 1YJQA 1R00A 1MG5A 1C8VB 2E18A 4J0HA 4AJOA 3O7MA 4RZ3A 4TTPA 3WLAA 4F04A 2KBFA 3Q5EA 5ICEA 4X65B 3FSRA 2NMVA 3CC8A 2H1LA 3MGGA 4F46A 5F9FA 4ROTA 1I1QB 2N0SA 2XZDA 3QXGA 4JQCA 4L4RA 3PFKA 5JNSA 1JQJC 1I10A 4B3IA 5A4MS 2G71A 1H8HD 1E2QA 3G2NA 4HLCA 2XMRA 2YL2A 2KHZA 4U3JB 5KWIA 2O1SA 3DMFA 4XTCS 1FPMA 3CB4A 3DWFA 4CTJA 4KV7A 3JW8A 2JG3A 1U3VA 3K0FA 2BSQA 3EEYA 5CMLA 2PBRA 4BLPA 1FYWA 3PPXA 3AO0B 3ZKWB 5CXUA 1NM5A 4PIMA 1M73E 1HURA 3AF4A 1J2UA 1DU4A 1G3RA 3DH0A 3HH8A 1Z56C 1C0IA 3M83A 2G9VA 3NFYA 5EMJA 2X5XA 4DDHA 3R3UA 4RSGA 1C1DA 4IJ6A 4ZVPA 1EX1A 2OHVA 4OA5A 1QG6A 4S24A 4HY3A 3LGXA 1S3GA 3N3BC 2XY4A 3BH7A 1O0BA 1MW8X 2BI4A 4FR0A 4H3HB 3ZDZB 1HLPA 3U37A 4X66B 3TLMA 5EHIA 2QV7A 3GMSA 4DUYB 4WIAA 3ZHRA 4TZ0A 1P3JA 3JSAA 5GADl 3JD1A 1AB5A 1P7YA 4PTZA 3HADA 2Q49A 1IU9A 1YVDA 1ZUIA 2I8CA 2R8ZA 5ALFA 2AN5A 1G21A 3AONB 5JSYA 3NHBA 5CXXA 5AHOA 1RPZA 5JXWA 2AJDA 5HF5A 3Q3GE 3MF4A 4HI0E 3GI1A 3GGCA 2BFDA 1JHUA 4U9HS 3GEPA 3W7VA 3N2KB 5ED0A 4DCOA 2NN3C 3AC0A 2NU8B 1D2AA 4ZK2A 1GTG1 4KHZA 2IE0A 4F1WA 1PQPA 4BO9A 1JPNA 3IBCA 2PUEA 1EFPB 3LA6A 4P4GA 4M99A 2CNDA 4E7PA 5CLJA 2IVFA 5AUQA 2Q9UA 2ZRPA 1YE8A 4M7PA 1YKSA 1QCYA 2IK8A 3VHLB 3ZZUA 1KSJA 5AHWA 5T41A 4R01A 4P32A 2CBGA 3H1BA 4UVEA 1NQWA 5EJ8A 2R97A 5JFTA 3ZTWA 5KKAA 1RKBA 1US8A 1SPXA 2FGJA 4EY7A 2PGXA 1PF7E 4P82A 4GO1A 4H6WA 4IBOA 1BXGA 2IF0A 3HMKA 4FOPA 1LFAA 3PRYA 4RLHA 4I1VA 2JHGA 1ODSA 1N2SA 4KFTA 1WUJS 4S04A 2V6JA 1I0ZA 1NQ5A 3VVBA 2R6HA 3MNFA 3U09A 3FFBA 3HBFA 2JK1A 1OR8A 2Q4EA 5IXSA 5P21A 1NLYA 5C5CA 2YIJA 2AW5A 2A92A 3Q9UA 4AO8A 4A0QA 4C2BA 2ZE6A 4E6PA 4A0SA 5B7NA 3P9KA 1TB4A 4OX9Y 2BP7B 5F4ZA 5FUYA 3D3JA 1IN1A 1E1CB 4UJ3A 1TJNA 3AF0A 3CXRA 3STTA 4EB3A 5C4IA 4HH3C 4DLKA 4FC7A 4Z4HA 1J0AA 2Z8ZA 4EQZA 4B35A 4H7FA 1JYEA 1A9ZA 4V2UA 3EPJA 1QK5A 2YJZA 4HMOA 3NBUA 4U8GA 5AYVA 1K08A 4EYQA 5FLEX 1QNFA 1A8HA 4P4UA 2JLAA 3S6JA 1ZJYA 3N0XA 2Q1WA 2CNNA 2VXOA 1ONOA 3A6GA 5FBKA 2QQFA 5DGXA 4MQ4A 2QR3A 2HKIA 2WTBA 4Y2RA 4E6EA 1X19A 1I7PA 5GTDA 1P7WA 3PUWA 4FZVA 2BUBA 4ZV9A 3A1CA 1PFGA 1PBTA 1T9KA 2ZUSA 1DIRA 1C14A 3DWGA 2VUIB 1FZQA 3H9BA 1FP4B 4P6VF 3AEYA 5JZBA 3TIGA 4RPHA 5AK0A 1LPAB 3UC9A 1H5NA 3OIYA 1CQIB 4KGXA 5L53A 4WN3A 2MJLA 3WP0A 1ZM9A 9ABPA 2OPHA 4NJMA 4QXMA 3K20A 1M34E 3GCZA 1PDVA 1ZJWA 3HBLA 1G17A 1M0EA 1JEAA 1TVKB 1QHEA 2VHZA 3SC2A 2SKCA 3CZAA 4RDXA 4DOMA 3ZQKA 3IAHA 2VP6A 3KD2A 2JLCA 1Z0DA 3GLHE 2OO5C 4X7BA 2QMQA 1ZU5A 3RAPR 3ND9A 4AP6A 1AKVA 1OIXA 5JCZA 2CD7A 2IEIA 3K0CC 4LXQA 3G2PA 3HHPA 5H9VA 4D6PA 4H4DA 3HB7A 1XQWA 2V7XA 3QKWA 5BT8A 4O4JB 2OQ2A 1FRQA 3BILA 3GN2A 4QUDA 1IY1A 4K9NA 5HJEA 2C7QA 2LXNA 1Q0ZA 4TL6A 4JOSA 4QECA 1M75A 1C3OB 3M1IA 4UU1A 4K8RB 4DM3A 3PHHA 2I2CA 3UJ7A 1JILA 1RWVA 4FEEA 3SF8A 4MEBA 5BNIA 1SKYE 4QX6A 3SYNA 4EMUA 1LW6E 1U5BA 1WUHS 4MYUA 4HDOB 2QUHA 4Z3OA 5J4LA 3WOHA 3WTCA 2PKRA 3PC7A 2C9YA 5AH0A 3JCZA 2Z6UA 3B9PA 3AM3A 2WINI 4LRQA 1PQWA 1OX6A 3DLCA 4CFYA 2D74A 4QXAA 3R3ZA 1I1OA 1GU1A 4KSYA 4N48A 3FTNA 3IAAA 4YWHA 4ZEWA 3UENA 4CQMB 2XD9A 4HZIA 1Q77A 3NHAA 4LHEA 5ESDA 1CB7A 1H2AS 1RRMA 2JZNA 4CIAA 1KK0A 1ZMRA 2JAQA 3S55A 5CXQA 3QWHA 4IHAA 1W36C 1SJ9A 2HY7A 4UULA 1W0KA 4UPDA 1JA9A 1LWNA 3ZV5A 4LHVA 1PUXA 1EWTA 3QKRB 4LIPD 5DB4A 4NG5A 4B82A 1IIBA 5JD6A 3DTNA 1L4YA 5A05A 2VP9A 1UJ5A 3AG5A 4IX1A 4DSUA 2Z5GA 4J0KA 4UCXA 4Y9UA 1BCRA 4GICA 1OHHD 5J2TA 2ZUCA 3A9CA 3WHLA 4UTNA 2W8BB 3Q41A 2J0EA 1RSZA 2PA3A 2QAIA 3A6JA 1AO3A 4MQBA 3VMMA 4AMYA 4F5DA 1TK2A 2WR8A 2JBWA 3HU1A 1QIKA 4HWOA 3E7PA 2G1JA 4YO8A 3UJDA 1OPXA 1N5DA 3QH4A 2VVTA 2NPIA 3T1VA 1ZNZA 3PJDA 3WMWA 1GN8A 4F0JA 1L9KA 4PE5B 2P5UA 4Q18A 1ODTC 4D46A 3CKKA 1UJMA 3RUHA 1X38A 4UE3S 3IKLA 1P0CA 3DVRX 3QITA 4B3MB 2I4LA 1PVDA 1F17A 3COPA 2MDTA 2X3FA 5AVXA 4HQFA 3ER8A 3NEYA 4R0MA 2Q29A 4IYJA 5F1OA 3IHKA 4I4LA 3IXQA 4DR1B 4G97A 1J4AA 4G5SA 1E2EA 1EGAA 1Y6QA 4KPUB 1MB2A 2PAFA 3CF6R 3C15C 1A69A 2W4QA 5BW6B 2XZPA 2OHXA 3ADOA 3HB9A 5JJ5A 2I6FA 1QP0A 4I08A 3KHSA 2OWEA 5EPOA 3GMDA 5TQJA 2AEFA 2J6CA 4HQLA 4EHDA 2EDCA 1G3IA 2XI4A 5GGYA 1QB7A 1GFWA 2BGMA 3DMTA 5BOVA 2RB4A 4OO3A 4LV6A 3QJ5A 4DC1A 4Z7NB 4TM8A 3DAGA 1OLUA 4UATA 3U6KA 1Z6GA 4F21A 4OQDA 3QBJA 2WFZA 4OHPA 3ELYA 1EFVA 3E2MA 1ZM7A 3PHJA 4J6FA 3DMYA 4BHTA 1NG9A 4IVQA 1R8QA 1FP1D 2NACA 5LLTA 4E0BA 4O4IF 3L0ZA 3NG1A 4IHJF 1X42A 4WKPA 2VNIA 4N54A 2QGNA 5DVZA 3UKDA 4LSZA 3WLLA 2C2GA 4JL5A 3N2NA 5H70A 1TU0A 1A8QA 3SIXA 1E20A 1W88A 4GGPA 4JT4A 4AW9A 3OQMA 4WACA 3IEMA 1J70A 3ANXA 3UJNA 2PD3A 4LZJA 4F60A 5CX1A 3PPWA 4CM7A 1J8YF 2WM3A 4UNPA 1DKUA 3PNMA 5FQOA 1GYQA 1ETHA 1Y89A 3LCMA 3OOHA 4GR9A 4I9UA 5F7XA 3TCNA 3AIKA 3LT5A 1DIAA 5ESXA 3HCOA 1MMFB 4AULA 4ZJYA 4AKGA 3WWOA 2C97A 1XNHA 1YOBA 4Q4AB 5FV4A 1GPH1 1QHSA 2ZAYA 1K6IA 3H99A 3MMSA 1PL0A 4DG8A 5HP4A 4YDHB 3DDCA 2I3DA 2Z9BA 4BPRA 2PPLA 3OPQA 1PO7A 3RAEC 1XRJA 3NP7A 3V8BA 5E7JA 3ICPA 5B4TA 3E9EA 4BTEA 1XT6A 5GINE 1TO1E 5CDFA 1P4RA 1AGYA 1NQUA 1O9HA 2R8EA 4WLUA 1H65A 3W5IA 1ILEA 3URMA 5DHQA 2BE7A 4JP5A 4OD0A 4GBED 5F12A 4NMWA 1Z16A 1FLAA 2E82A 5IJ9B 2QVGA 1NVBA 2Y8EA 2WJAA 4NBTA 2XIQA 2IEYA 3R3SA 5DHTA 3KEMA 1EZZA 3NKLA 1X0XA 4G2TA 3VTFA 3WHIA 1MXHA 2JFYA 3KTAA 3SXUA 4EWLA 1P77A 3I3OA 3A1FA 1QKKA 1PI3A 4OHCA 2Q2OA 4QU5A 2CLSA 3TIFA 4E5YA 3U5ZB 3ZHSA 2VPQA 4E46A 3AVXA 1L7VC 1QIHA 3I01M 3OJOA 2ORVA 2PY6A 1UZLA 3ER6A 1FFGA 4QA9A 1Z33A 4YRDA 5H82A 2AX3A 1JR4A 3LT4A 3OTGA 4ZT4A 1UUFA 2OO3A 3CHYA 3CPJB 2C2OA 3BXHA 3CZ5A 4MKRA 4CI0B 1N2EA 2JGKA 5D1HA 4BKMA 3MGAA 5CVVA 5GZ1A 2RC6A 3B5JA 3HCPA 4WQMA 1X7XA 2D1FA 5JJKA 2QTHA 3L8GA 3NBQA 4WNYA 1UFRA 3IJ5A 3AP1A 3VPBA 3L46A 1E7WA 2HCBA 4FYYA 3PQ3A 4ID3A 5KYKA 1NBME 4B6GA 4UVGA 4YAKA 2PWZA 5C81A 3IOBA 1QOQB 2AH5A 2FSSA 3AVTA 2PZFA 2QW0X 3ZU4A 1Z5GA 5BV0A 4UBMA 3WXMA 1ZKMA 3H84A 1PJ8A 5BNWA 2HXYA 3PC8C 1O6GA 4GP9A 4YONB 2QN6A 3UJ9A 4JUDX 5DBIA 2VRCD 3JQ6A 4MAAA 3LFUA 1UJ4A 3QG1A 4TMTA 4EVQA 3G6WA 2ZRJA 2GA9A 2DAPA 3I6QA 5FWYB 3ZU2A 4BRZA 1QSGA 4K2HA 4LFAB 3GVHA 3QKSB 2VJBA 2FWIA 4M88A 4B40A 3O0DA 4ESOA 2ZIUB 3SJZA 2YVAA 3CH7A 2ZEJA 1TADA 3X2EA 1WTAA 4LHYA 1K8RA 4LAFA 3WGGA 1KIMA 3GRUA 3R9XB 2CC2A 2AUMA 1NVVR 1VGQA 3Q8XB 3JYNA 4H7EA 2R5FA 6AT1A 1U0BB 2JAWA 3BG5A 4CLXA 3H9EO 4BL5A 4II7A 3TK1A 5C1IA 1IRIA 4PWYA 3CJRA 3O83A 1KF0A 5GVRA 3AR9A 4D9CA 2I3ZA 2XYHA 3O4GA 1RI1A 2A67A 4IFEA 3KKOA 1HG0A 2OHIA 1MW9X 3PA6A 4M53A 4WLEA 2OK7A 4IDHA 6NULA 5C52B 2J1LA 2FUG1 3S68A 5B7GA 3FCCA 1FYEA 3F3SA 3LV8A 1WU8A 2PRSA 2NU7A 2C96A 2X4LA 1Q7EA 3UBMA 3WJ7A 3LWDA 5J23A 1UBRS 1VTKA 2WPDD 4I5IA 1O54A 3S2SA 4RY8A 5AVVA 3JVEA 4U9UA 5KHAA 4ECEA 2VT3A 4Q1AA 1PFUA 1V6SA 3A9UA 1E89A 5AOCA 3IKTA 3GEMA 1GGHA 1P4SA 3OFJA 4L8YA 1K92A 2IA5A 3GH3A 4BNJA 4C76A 3MOGA 3EGDA 2CXNA 1PV1A 3R0ZA 1TCCA 4PG7A 3L7AA 4HDNA 1Z5UA 3S70A 4C0WA 5HM6A 1UH5A 2HB6A 3R8CA 4RJJA 1RHJA 4XWTA 3U39A 1RRCA 1AA9A 4YJKA 3OFND 2YR0A 5BRNA 2R1VB 4LRUA 4WZ6A 5F7ZA 1GNTA 5D5QA 1DKPA 4RMGA 4HHEA 2JJ2A 2CB0A 4NCIA 4DQKA 3GEDA 2EWWA 3NR2A 1HFJA 3UZUA 3GFTA 1Q2UA 1B16A 4KLRA 3ASZA 3P9PA 1LU9A 5BPHA 4Z1MA 3KZKA 1P1CA 4AKIA 5B30A 1ICIA 1NPTO 4HH0A 4QL3A 2F43A 2QZPA 5FADA 3VR4D 1JLLA 4BLTA 4EYGA 5K8UA 2WT4A 4Z3DA 1KO4A 1Q95A 3JAKB 2E4VA 4RL6A 1N78A 3CWCA 3CT6A 1UZMA 1FUIA 4DMGA 2H4YA 2UVDA 2X2PA 3A3YA 1VHTA 1QR6A 3A3KA 1T8TA 1VZ2A 1IY8A 4M1ZA 3V1TC 1USIA 4OEHA 3WKBA 1GRNA 2OOKA 5B3KA 1M5RA 4H77A 2AE1A 2P2DA 1CJTC 1AKQA 4LXUA 2Z6AA 3F1LA 1VXRA 2FV8A 3ZNOA 4QQRA 1OAOA 2BYTA 3Q88A 2XMZA 4Q3OA 5AHKA 5HHTA 1OFTA 2UXBB 2XGOA 3BCHA 1Q0LA 1VJRA 2BE9A 1SC1A 2ZXEA 4OQZA 4LYDA 4C78A 2RGGA 5CA1A 3ROTA 2XDWA 3R09A 4QGAA 1MJHA 1XMXA 3IOYA 1ADYA 4MUGA 3EPHA 4BTLA 3V1YA 1XB2A 2E4YA 3R6TA 2H3EA 5C37A 2QG4A 3ML1A 4L7VA 5U4QA 5IULC 1GQSA 2PT9A 3WKEA 5T3YA 1R8SA 3FR7A 4RJKA 3M6VA 1R66A 2BOVA 2LWIA 3K16A 4YACA 4D44A 2WHQA 3IBYA 2X5JO 5DI9A 1PVOA 3ZTTA 3HBAA 3JASB 1XV5A 2B8WA 3ZGVA 4E2YA 3C7DB 1DIGA 4ESEA 3G8YA 2R44A 3H4VA 4KLZA 3PB3A 2A2ZA 2V7QD 2J9GA 1MO3A 2BMEA 2BM8A 3K0FB 4LY9A 1X9GA 3O3OB 4UXIA 3HEBA 4PSDA 4RA6B 4DV3B 5KYYB 3KSDO 1SZPA 1QZUA 5H80A 3G02A 4I4IA 3BXEA 3C1AA 6ADHA 5EE9A 1O03A 4J0CA 5HQ3A 1Q6YA 1CULC 4P53A 3LCVB 2ZB2A 5IAEA 1N2GA 3LPNA 4DB4A 1XEXB 3GEBA 1GKUB 2IF2A 2FU5C 1CS4C 1SM4A 2QTGA 2YW2A 3LL7A 3VYRB 2RMKA 1PG5A 2BH9A 1ZISA 3BPSA 2ZE7A 1KFBB 3NB0A 1M1ZA 4J0QA 1GPMA 1W581 1CZRA 4BNXA 4G01B 2WJVA 3ORSA 1VMIA 1FJGB 3RBZA 4ZHSA 4RVHA 1EUCB 1U8EA 2FRVA 1ULBA 5BR1A 1AIPA 3FMVA 3PBKA 3TNLA 3RWOA 1Q3TA 3UTDA 1VJCA 2YHSA 1NVKA 1ZW1A 1C1XA 2R6ZA 5IVDA 3T15A 4BQIA 3IIMA 3ADBA 1G291 1EK1A 1QHXA 4Q34A 4KQEA 2AHOA 5J2TF 3RFUA 2B61A 4QTUB 3K0SA 1FMTA 2AGVA 2YC2C 3HZHA 3WVNA 4ALMA 2E5LB 4RY2A 1E1MA 2EJTA 1ZSNA 3WK8A 5KU1A 2WWXA 5CDHA 1L8OA 4MI9A 1V1MA 3U1BA 1UKYA 1Z5ZA 2OGWA 2ZYDA 1NHGA 4MHSA 3UOWA 1TKRA 2YCBA 1OREA 5DMXA 4BGVA 1X14A 4KWHA 1YRHA 4QD3A 4TYYA 2JLRA 3KAQA 5DULA 5KQRA 1MB9A 1TVCA 3CURA 4KH1A 1Z6XA 4ND1A 3OZBA 1VL6A 4OGLA 3ESZA 5BNFA 1A9OA 2VR1A 4M83A 4UKDA 4EI8A 2G88A 5EUMA 4ZVLA 5IDYA 3DGFC 1KE1A 3H5LA 5KUTA 5ARCA 2WU0A 3DQPA 3RASA 1OX4A 5B58C 5KTTA 1OB5A 3HY6A 4OB7A 1D7OA 2WMDA 5AW5A 1GR0A 1IBCA 5B3JC 1ZVQA 4RK6A 3O75A 4MNTA 3EXFB 4J0DA 3OCJA 4G5RA 4C03A 4DCSA 4ITUA 1X2EA 1XEWX 3G1TA 1BJKA 2QMUA 3OE7D 5CGZA 1FU8A 3KE9A 2PRJA 3KTAB 4AMZA 1KFCB 4D02A 1BDMA 1NJSA 4EKYA 4K0KB 1Y9DA 4U8HA 2YS7A 4OQLA 5U1PA 1VGRA 3BK2A 3K2EA 2VQEB 4JR2A 1ZO8A 4MUNA 1CF9A 1SPBS 5E6SB 4M1YA 4MLPA 4BJ5A 1O94C 3U3XA 2L69A 1V8FA 1WMSA 5CDFE 2EFEB 3HJUA 1ZFNA 3U4GA 3L3BA 4CM5A 1CF2O 3EZ2A 5K6AC 2VSXA 4HFMA 3QFFA 4A4DA 2ECKA 3CM0A 4QZVA 2L19A 1OWNA 2O0MA 3BBPA 2AKAB 4P8RA 4RMHA 2ZBQA 2PE5A 4JDUA 3TRFA 1YCFA 3BICA 3H0EA 4Y0VA 4OM7A 2EKQA 3WRYA 3FSGA 2Q21A 3QXSA 5HMLA 3HJBA 4PXAA 4GI1A 2O8DA 4ISCA 10MHA 1E2KA 1F14A 1RWXA 4PY2A 1QCZA 2ERXA 4ZAXA 4CMIB 1YO6A 3ABRB 2QV0A 4JI3B 1MVNA 1S8AA 2JJYA 2ZK7A 4QOEA 5HZMA 3CQ9A 2D1RA 4EW3A 2LTAA 1Z18A 1QIDA 1D6NA 4WNIA 2Z98A 5JZMA 3GPLA 5CA0B 4MUHA 2FTKE 1THGA 4X54A 3QTLA 2Z30A 3PXEA 1XZHA 1JT9A 3MRSA 3WZ2A 5FHRA 1P9OA 2QRHA 3GGOA 4Z7OB 4J90A 1SC9A 3EVAA 3OTQA 4B2LA 3IUMA 3NAQA 4G0PA 5FBZA 3RHSA 2VDQB 1Q12A 3REQB 4HVCA 2DTXA 2ISQA 2EC5A 2PDAA 1VSQA 3D3EA 4Q1EA 5JAHA 3K4HA 4HJXA 1XLTA 2PEZA 3F90A 4Y6PA 4TPKA 5J63A 3WLOA 5HR5A 3LBFA 4XH9B 5DIZA 1T3TA 2A1TR 3AHHA 3T4XA 2JDIA 2VJMB 3BOSA 3IO3A 4IDFA 3D8BA 4LZWA 4NOJA 3SY8A 3CSDA 4BQRA 4EHBA 5GV7A 5KEIA 1EE2A 4J29A 2OXTA 4B6QA 3N76A 3P0JA 4RZXA 4ZC8A 5J40A 3TLGB 4C3VA 2VBIA 1H0KA 2IYFA 2QD5A 2C7VA 4Q3BA 3EDMA 3OO0A 4I5FA 4I0WB 2ZKLA 5DNAA 2J45A 3GY0A 3NUQA 1MV8A 2Q1UA 1JDUA 2WG1A 3WV4A 2O8BB 3DTVA 2O7SA 3TBHA 6CHYA 3HDYA 4IG9A 4EG1A 4OTZA 3D5TA 4PZLA 1UQRA 1QO9A 1N8SA 1KAHA 3JR7A 3UAOA 3UJBA 3ONFA 4DFDA 4BNHA 3M4YA 3WBKA 4D9MA 4ZI2A 5CYGA 3DZCA 5J47A 1YJAA 5PGMA 1UBSB 4N0EA 4FYHA 4AXXA 1F7UA 4M1KA 4G85A 2BW0A 1UFQA 2ZBEA 3B3AA 3DL4A 4DUPA 3IEIA 1U2QA 1S0UA 3L5KA 3OE1A 1XZJA 1DIOB 3QPCA 3EZGA 1FRFS 1IULA 5GOZA 3VR2A 3Q5GA 2C1EA 3JWIA 2C03A 3DOOA 1FS5A 2BMWA 2P9QA 1R27A 1QG4A 5G0VA 3ZWXA 4QDXA 3THYA 3PCRB 1H6BA 3KX2A 4JJEA 1MG0A 2J0UB 3D7LA 1FP6A 3Q1KA 3JVIA 4Q4JB 3L8FA 3MS7A 3STWA 4ZI7F 5EJMA 3Q7RA 1NXVA 4RGBA 3EMDA 5G0UA 5TPZA 1RCUA 1FFWA 3NC1C 3ZWPA 1DKNA 2AB0A 1Y3DE 1Y4UA 3U4AA 5DXFA 4A8PA 3T1TA 3BCRA 2ZJBA 4CMIA 1MABB 1L5WA 3JWJA 2P4HX 5SV2A 2IIBA 4DR7B 1K6MA 1T5BA 4I55A 4N4AA 4IDBA 3FLMA 1NJ2A 3G0CA 1QO7A 3DOFA 1IC6A 4LE1A 4MWSA 4URZR 4D0GA 2Q3BA 2H2DA 2Y0BA 2Z5VA 1XZAA 2CEAA 3DAYA 3CA8A 3H9UA 3L05A 4BNYA 1H23A 3L6DA 3W04A 3BAZA 3AVOA 4MH0R 2P5TB 2JZCA 1BQ3A 2GCNA 1V8PA 2IUFA 4IIBA 3VR5A 3SMQA 1UBLS 2VOJA 4QGHA 4K1XA 1N3IA 1OVMA 3UHPA 3VZQA 3L82B 1EJ2A 2GVZC 4MMXB 2HBZA 4PU0A 4PZ9A 4Q6WA 3U9SA 5ABPA 5KO2A 5IS2A 4FBMA 2I8AA 1T0JB 5FI5A 1IBMB 1CRPA 1SKQA 4LVCA 2JW5A 3SZGA 2X6TA 4DVGA 1YH3A 5KJCA 1N2CA 1JTEA 3SG0A 1K7YA 3UCFA 1IJEA 2BM1A 5BP7A 4RZQA 3FWKA 3UAZA 3L49A 1XGKA 1SNYA 3WJ1A 2H31A 4KVZA 2RI6A 3LKZA 1ORRA 3UGKA 1GITA 3MQ4A 3OT4A 4TV9F 4V03A 2EZ8A 2GILA 2PBLA 3PD1A 1E9EA 2AC2A 1DX9A 3PGXA 4GKVA 4WZAA 4YROA 1L4UA 5F4BA 4QG3A 5LYJB 3IAXA 1QIFA 2IYUA 2ZDHA 2HWKA 2EQ5A 1A7AA 1VJ1A 1UEIA 2DHRA 1Y8QB 1YS7A 2O2GA 3SBDA 1OX4B 3E15A 1N5IA 4H7DA 1RC8A 4KYVA 3EIWA 4MCHA 4HLDA 4R1PA 4GRAA 2NUTA 1CDDA 4MI1A 2QVLA 4J4HA 4TS3A 3P1JA 4Q3NA 1XQ6A 1JR3D 4NWIA 4A6DA 4NBWA 4PXYA 4C5CA 4FNOA 4XWKA 3KEGA 5T4EA 2EBHX 2JJQA 5BN5B 1F3LA 2C8JA 1EFDN 4G5GA 1ZYUA 1IBRA 1Q7CA 1QIIA 3OUTA 3NV9A 1GPBA 1ZW6A 2X8AA 3VZBA 1AY0A 2R79A 4JT9A 3KVRA 3QKRA 4Q4HB 4NX2A 2ZIVB 1SKMA 2CUNA 3ESCA 1SG9A 3HHEA 3OHPA 3V6MA 3B1WA 2LUOA 2BZ0A 2X4DA 4LDRA 3NQ41 3BE8A 4UBKA 4HQOA 1GNQA 4U0KA 3S1AA 3ISJA 1PN3A 3M6AA 1TAUA 2G9NA 3JWGA 5TT1A 2Y1CA 1H93A 4OFXA 1I2BA 2IOFA 1NI4A 1G41A 4MRPA 1KJJA 3TFOA 1OV6A 1CEEA 4AMUA 2IHUA 3NFRA 3O2QB 3L7KA 1Q1BA 4QNNA 5AKYA 1P6XA 1JIXA 1RTTA 2HSZA 2F3UA 3CVJA 3HKDA 3P4XA 2PXHA 4IQGA 4KAFA 3SS9X 3UAGA 2FUCA 2XMCA 2GUGA 4CKEB 5DGTA 1TKCA 1PZEA 4I1IA 2CFTA 3KKZA 3UOGA 2C9DA 3OLQA 3STHA 3HYCA 3STUA 4M9QA 3TMAA 5HQTA 3W79A 4V24A 2GN4A 4KJZA 1E6EA 4OHUA 4EEZA 2QLFA 1X1CA 4H27A 4KMOA 5K01A 2ZVJA 3WJAA 5I3ZA 1QQ7A 1V1RB 1NDUA 4JL6A 2VLIA 1RC1A 2OE2A 2IY8A 2QI9F 4H3VA 1IRXA 1MJFA 1KJ8A 1G6HA 1YBAA 2GM5A 4PAWA 4XQEA 2P0YA 1JPUA 3SSAA 3B7PA 1DXOA 2Q5QA 4KACA 4OU5A 5JNRA 5I7HA 5DTRA 1II8A 1MZPA 1JEYA 2GBGA 3GT4A 1XD8A 1H85A 3P26A 1KZHA 3F7TA 2ZB7A 5DEIA 4L27A 1R7RA 2X40A 1UPAA 4MS3A 3UKOA 3KQWA 3ZLJA 1WZCA 2V6GA 1IIRA 3T1OA 1O95D 3D3NA 3EDYA 4ZQCB 2GPWA 1KMHB 5B5SA 2CYBA 3B5IA 5EIAA 3Q9LA 4KR6A 3S40A 4S35A 1XRSB 1BQ4A 1KDZA 3THOA 4D6XA 5AQ1A 3IERA 1G2PA 3BK7A 1W4BA 2K87A 3P9YA 4UBJA 4YRTA 3AUUA 3R3XA 3D8TA 4B81A 2FPRA 1HA3A 4UHFA 3ZYZA 1O8CA 1M2VB 2G7ZA 3CZQA 1GXSB 3LUPA 4C5AA 1OASA 3HJRA 1YA8A 5JDCA 4RO0A 2J8ZA 3LW7A 4A15A 1GGEA 4R71A 3WRVA 4R2XA 2X0RA 4PC3A 4PO9A 2DF8A 4X85A 2P27A 4ACBA 4NTZA 4DBLC 3ND7A 1QTQA 4V0KA 2QGFA 4D3SA 2VPXA 3K0HA 3PI7A 2PWAA 4LJAA 3PX3A 2ZR8A 4DIBA 5LQNA 4A0FA 4N47A 1G6KA 2I3AA 3D0KA 3HRIA 1QLHA 2R5WA 5L3SA 2EJVA 1QLWA 3AV0B 4YRSA 4IJMA 4RHUA 3H83A 4RHYA 4WK4B 3VR5H 2QGZA 4R2KA 4CKWA 2B34A 1U94A 3WGLA 1N2BA 3C3CA 4BNFA 2XDQA 3JV7A 1KDRA 5FUWA 3OSUA 3SHQA 4PYLA 3TIVA 1GJRA 1MFPA 3TMYA 3QV2A 4H7IA 3VVCA 4ND5A 2BEWB 1C30B 1OBOA 5I9TA 1NN0A 5AVKA 3PQ6A 4ZHQB 3GLUA 1UBEA 1LLQA 2Q07A 1CCWA 1JIJA 3PUZA 1QUEA 4K88A 4N65A 4ZVRA 4CKCA 4REOA 3IR6A 4HUJA 5FYDA 5HIIA 5K8LA 3O8OB 4MIOA 1ND5A 2BD0A 3TBKA 3QLUC 1E6KA 4BKUA 1QPZA 4E13A 1B8OA 1KEEA 3EODA 1OC4A 4LCBA 4XFKA 1MAUA 4ZT5A 2A1IA 5TS2A 1MQAA 2PRYA 3KPWA 4X6LA 1JQ5A 1YS4A 3R75A 1Q0PA 4TWZA 1Z2DA 1E0DA 1YDEA 1FUKA 1HE3A 3BD9A 3BCSA 3PL1A 4ALJA 4ETWA 3EHEA 5K0SA 2DQSA 1SA0B 2GZDA 3B1FA 3P96A 4R1OA 3L1IA 1U3UA 4U7GA 5LL6P 2I71A 3RF6A 1G5IA 1OFUA 4PLPA 3QF7A 2YMPA 2GK6A 2IBMA 5FQNA 3JAMA 2AZXA 3D9QX 4EA6A 4C2TA 4TWIA 2DT8A 3W9UA 2WEKA 1I7LA 1YR7A 1EIWA 4BLWA 4L57A 3OIDA 1K9SA 1Q91A 3F6SA 1P5FA 1Y9JA 3LBAA 1WB4A 1T6YA 4WVLA 1DKLA 3IIJA 3IUQA 3PPVA 3J81k 2R751 3FHLA 4IVRA 3EVTA 3HBJA 4PEVA 3ZE8A 4B6JA 3LQ2A 3MSCA 1VPVA 2XDYA 5I9MA 2QB5A 4DYVA 3UMMA 1S2MA 3GPCA 4DEVA 1ZSVA 2O8VA 3GRRA 3LCJA 2EX1A 3T4UA 1TEZA 3NDJA 4QAQA 1M8GA 4JN6B 1T6NA 2O2YA 1LPOA 3GT7A 3QRWA 3R0VA 1RD4A 4RVNA 4G0UA 2PD4A 4X8LA 3ADKA 2YZ7A 3I6YA 4TX1A 1DBSA 2D4HA 5LMUB 2XE7A 1TRKA 4G56A 2X76A 2OV8A 4TS9A 4EHIA 3KKNA 1QOZA 5K4HA 3QE4A 4RMJA 4M9UA 5A1JA 5J4VA 5H02A 2PVSA 1H42A 1UK6A 3TSYA 2WMOB 3RC9A 2DULA 2WM2A 4YA6A 5E7QA 4E4RA 4EG4A 4ZDKA 3ZVMA 2J46A 1Z2EA 2IPAB 1EGQA 1JKJA 2ECOA 3FTPA 5EXXA 1MBZA 3BRWD 2VPTA 4KQIA 4EM6A 2W48A 1UBJS 1U99A 2F3RA 4KXUA 3CNNA 2UUBB 2PMEA 1VL2A 2FZ4A 4Y6QA 3UK7A 2PL5A 1ECPA 4OLJA 4AECA 3LQ1A 4GI2A 5KSWB 2YXNA 2FXVA 3K1TA 5DTMA 3UEOA 5LP6A 3QWIA 3S1LA 3RRMA 5BR4A 2JA1A 4JLDA 3QK7A 4OQMA 3SZRA 3Q8WA 5CYFA 4I3HA 4LDZA 1QB8A 5EJIA 1JEYB 1L7RA 1MQ8B 1P5RA 2NYRA 4JEHA 4HGNA 5BY2A 5JXHA 4MOWA 4D56A 3CTMA 2A9OA 2ABWA 2F64A 4RF3A 4LOLA 3PQ7A 3SAJA 3EVNA 1B8NA 1UODA 2PGNA 1GTVA 1NBIA 3HXTA 4G2NA 1IJBA 4QBHA 1ONNA 5T8KC 3O92A 1UPCA 2OZPA 3C85A 2HWUA 3GXOA 3L6BA 3P9QA 2Q9AA 1FFCA 3MINB 2C4TA 4RLQA 4M6WB 1RQ7A 4OAOA 3HVHA 3OZUA 3R0QA 4LYEA 3E7XA 3L8HA 4X6YA 3LSTA 1P19A 5F3RA 3RRZA 3OBIA 4XFDA 4B4VA 4NZNA 1MCZA 5JT1A 4CNBA 1XD9A 5JHGB 4JV5B 1J0XO 4YMWA 2CLLB 3FFWA 3PF8A 1ZUNB 1M1YE 5FA8A 3M33A 1DAKA 3RCBA 2YNMA 1H5UA 1IVYA 3KB1A 4X44A 4PX3A 3HLTA 3NTRA 4RDHA 3PXGA 4OHYA 5CYOA 4WBNF 3CBQA 1XQ9A 3U44B 1UDRA 5L45A 1XWIA 2QUKA 1SXJE 3A6DA 3OZIA 3UFBA 1J07A 2DPMA 2FPLA 3UMJA 5BV7A 2WM8A 3VTZA 1KAEA 1YBVA 1JR3A 5J9FA 2B1JA 4CIWA 3X1MA 1ZGHA 4KJXA 1SY7A 2FUEA 2J3JA 2ZUBA 3VR6A 1YHNA 1TTQB 2C9BA 1RZVA 1SUBA 2AXPA 2GJ4A 2YJ3A 4C0KA 2VTBA 2ODTX 2QD2A 1JHYA 1G63A 1GV0A 3O8BA 2W6MA 3HR4A 3B6EA 3Q2IA 2VP3A 3IP5A 4JVOA 1YZKA 1HH4A 4I66A 1D3AA 2ALJA 1NJ1A 2YQ5A 3JS5A 2EXXA 3WL7A 2JFBA 3NMUF 2ISCA 3P2YA 3WWEA 1Y6FA 1P0MA 2FNAA 3J7TA 3G5AA 1ZGGA 2O3UA 4DABA 3JSXA 2BMAA 2D0OB 2IEZA 2EZUA 5B37A 4ZICA 4C88A 3I39X 1C7EA 2XAUA 4P08A 2JLXA 3KQSA 3O2JA 4QVGA 4HDMB 1WVGA 1AK2A 5AIAA 4UQPA 1WLSA 3R7WB 1EJ6A 1G3QA 3K8OE 1F0KA 1OLOA 2F4NA 3TNDA 1I9GA 1HSOA 1QK4A 4BZXA 1UK7A 5GJVC 1YK1A 3UHOA 4FX5A 4NAVA 3CX7A 1XU9A 2ZT6A 4DLSA 2AFIE 3RC2A 4QGFA 3FFTA 1F5SA 1P6QA 3M6LA 1OZAA 5F3DA 8ADHA 4JJ8A 4GM1A 1UBOS 2CFIA 3I6IA 1RRPA 5DHRA 3KE8A 1SIOA 3H9GA 4IOKA 3U61B 4MTCA 3A9SA 4G4IA 4DA9A 2CW5A 4IHJA 2PGAA 1S2OA 1D8TA 2R48A 4IJVA 1ZRSA 1B42A 3CUWA 3M9LA 2UUPA 3A1WA 5DU2A 4JASB 4G09A 3IJPA 2M6SA 4PFQA 1HDEA 1MAHA 2E1RA 1DFGA 1RYEA 1RZUA 1U2EA 3GLTA 4TUYF 3U7JA 1QV6A 2FUNB 4B33A 4M9ZA 4CMEC 4F91B 2HBRA 1B3RA 1LRKA 2ZI5A 4FE4A 1J90A 1MH9A 4L6CA 5L8VA 5JEDA 1LQUA 3L84A 4X62B 2H0QA 1L5NA 1WXIA 1NTOA 3IP7A 3GBSA 3OETA 3KLBA 3HXKA 4FCTA 2CHEA 2COUA 1YCGA 3U81A 3R74A 3AUXA 1CR0A 1V8OA 1S2NA 3I5MA 3ILSA 2AK2A 3QWBA 2YDYA 2GBCA 1FFEA 2IKQA 2PBFA 4QTYA 2JHFA 4L5YA 1Y4DE 1ECLA 2AFVA 3NHWA 2A5LA 3EY9A 5JAIA 4C6HA 3O0TA 1U9CA 1XI2A 3D64A 1ACJA 7ADHA 2AX4A 3NIFB 1GGFA 4NPAA 3KDPA 4RJLA 1KI3A 1RKXA 4L6IA 4OHBA 2VNHA 1LKZA 4PYQA 1KR2A 3A4IA 4FK8A 4AMGA 1XX6A 5KTMA 3SS8A 3D0OA 4KPGA 2NSJA 5ICSA 3M1LA 3GFPA 4DR4B 1RAAA 2C3YA 5HQJA 1E4YA 4REQB 1OZHA 3BXOA 5IVKA 3FFXA 1WE2A 3I76A 2OAEA 4N40A 1A5AB 3HYTA 4UOQA 2ZRBA 1TZBA 2WYHA 3TSWA 1E66A 1Z83A 3D5QA 3IUNA 2ZWOA 1RKUA 1HL3A 1LH0A 1EZ1A 2D2VA 2I03A 1M2JA 2BPOA 3O73A 4OMDA 4Q4AA 4XM1A 4KLNA 1XCBA 3GDHA 4N76A 2LKCA 3VDNB 3NUGA 4LJLA 5CNKA 4MITA 4U5XA 3VHXA 5CB4A 4GOMD 3EBPA 5EYPA 2Z4TA 4X1IB 4MJ7A 1FIUA 1MF7A 5CX4A 1JR3E 2N42A 2GM3A 2IYSA 1ZRNA 4FQ7A 5TEWA 4TN5A 4FOTA 2PSHA 5CH3A 1JB1A 4D0NA 3DBIA 4RVGA 3BSFA 4O4LB 2ETVA 4A03A 2VYNA 4S2UA 1EE1A 2C88A 5ITZB 1NZJA 3OZXA 1KZGB 5LOVB 3HWX1 5BW5A 1T4CB 1A95A 4D5GA 5FEUA 4FU0A 1NUQA 1PG2A 2GQ0A 3A6FA 3ETNA 4WBXC 3TR5A 3W8NA 4M0MA 4G0ZA 4S1PA 4X93A 1S4QA 3WX0A 3LBHA 4E33A 4E5MA 1E0AA 5BXQC 2IHTA 2KI5A 3BQ9A 1XMQB 3CE9A 3B70A 1XXHB 2WILA 4MQMA 3H6GA 2O4UX 2K4MA 3AIOA 3LNTA 3MCZA 1I1HA 3AX6A 3OZSA 1E1RD 3A1VA 3ZVLA 3IJRA 2HRQA 5KYUA 4FOOA 1JFRA 1CK4A 2JFGA 1UMDB 2TMKA 2ZE5A 2A88A 1WUKS 3K6SA 1T4CA 2IEAA 4FXPA 2C4NA 4WUTA 2I34A 4CIDA 3BMOB 1FU7A 5A5DA 4TQGA 1L4FA 3LBIA 4C3UA 3QYAA 1ZIDA 5B6PA 1HFKA 2HTFA 2HHAA 2OLJA 2JC3A 3GHYA 3CVVA 1QAQA 1TA4A 2CXUA 1FLVA 1NULA 3OEED 1KE2A 3AU8A 4JBXA 3AVWA 2ORWA 4EGSA 4MB6A 4ERXA 1ZL2A 1Q0RA 1RLTA 3VR5D 4CM4B 1TLFA 4R8LA 2HJGA 2EFGA 3KJQA 1YZHA 1O08A 4L8VA 3ZX4A 1SC3A 3HCDA 1G20A 4O4HA 1WG8A 1D4AA 1Z7WA 3DFMA 4MR8B 1WHSB 4UUBA 5G3ZA 4C0BA 5AVTA 3MTJA 4U6NA 4IV5A 5FO0A 4DLZA 2EKPA 1I5RA 2REOA 1X74A 1EFLA 1WM1A 2IYZA 1T2FA 2BGUA 4RZ2A 5KVSA 2H3HA 2VYND 2QUAA 3ZEIA 4DL9A 5JAUA 2GF9A 3K30A 3BMXA 1R9JA 2G1AA 2GLTA 3IE2A 3D2AA 4I9NA 1Z88A 2Z09A 2ZGVA 1V2HE 3A2LA 5LCXA 3U7HB 5D6NA 3NVKI 4D9BA 1W48A 2HEGA 3AY0A 4GNKA 4EATA 1FSPA 4HDKB 2WI8A 1IATA 1PJ4A 2NYUA 5EHGA 2QX7A 1S2LA 1F48A 5HILA 1JS1X 4Q66C 3AB7A 1GT91 1PTJC 2MYPA 3EW7A 3OMLA 4DLUA 3L5OA 3GELA 4ETIA 3BC1A 2XWJI 3TRJA 2ZUVA 4NYIQ 4RH1A 5KCZA 4YB8A 5BYKA 4ZEMA 4PGFA 2IUTA 3RH0A 1VPTA 1Z13A 2FG5A 3RS3A 4MVJP 4V3CA 3UJHA 3SFZA 5LLDA 4IQ4A 1TI7A 1SFRA 1O6FA 2VH2A 4TL7A 1RPNA 4HMQA 2QZZA 1KXJA 3T7KA 3LZCA 3TFWA 5EJEA 1NSYA 3OUUA 5LDHA 4JYZA 1QF9A 3R41A 3DXYA 4M60A 4AWAA 4B34A 1FFBA 4EUKA 1GZVA 3UJCA 1VCHA 5B53A 1U0FA 3DFFA 1X87A 2I9PA 3OTOB 3HEAA 3L6OO 4GQAA 3STXA 1YZGA 1AUQA 1BA2A 3TWOA 4IFIA 3TZQA 4NBSA 4N3AA 1PW5A 4G1EB 2GJAA 4YDSA 4FFBA 5J59A 4M9CA 2ARKA 2ZWVA 4BFWA 1OAOC 3QVJA 3RM3A 1A9XA 3KOUA 1JKXA 1NE7A 5JD3A 4CL3A 1LDNA 1WNTA 3FCUB 2IPLA 1ZN9A 4AMBA 1ECFA 1ZCZA 2Y71A 3A37A 3GB9A 3T7IA 1XQ1A 3M2TA 5EP4A 3FOEC 5JMPA 3UTCA 4C4OA 1ISRA 2A0UA 3TEJA 3H16A 4OLBA 5F98A 2KMLA 3A1EA 2XXBA 1YKGA 2G76A 5CLFA 3V8NA 3C3XA 1UC5B 4A27A 1H6DA 4E5NA 2VZ0A 3JZIA 5AJHA 2AS0A 3ZDYB 3LC2O 3DB2A 4PNPA 4TGLA 2GZSA 4FMDB 5DTEA 1QRTA 1NW5A 3N0TA 1KJNA 1QJCA 1VIAA 4LK2A 1CUDA 2Q2QA 3HI6A 4BU1A 2ZSEA 3IQWA 4R8SA 3K71B 4KVGA 1GDHA 5T67A 2EX4A 3OLWA 2GPSA 4RF5A 3W5CA 3C1OA 3FOFC 1UC9A 5G1NA 3F3MA 4ON9A 4NEQA 3AL2A 4NYIR 5KB3A 3F5QA 2B4TO 1UR5A 4XM0A 3MTQA 5FKJA 4YT2A 3UUGA 5A5FA 2WIDA 3KSZO 4A6PA 4PCUA 2GCPA 4AWBA 1JWAB 3LVQE 3GFRA 4FHDA 1U3TA 5IKEA 3GLIB 3R6DA 5EHNA 2OG1A 1XRNA 1N1MA 3PTLA 3JALB 3NIGB 4RANA 2H4FA 3LQRA 5G0WA 3C6YA 9ATCA 3HEMA 4MVJD 3AZQA 5EE1A 3B6JA 4YQEA 3RVBA 3QVXA 2Q5EA 2XBUA 4V0SA 3QQPA 3D8SA 2PXCA 1IK6A 2QPLA 5CJPA 3ZCXA 4CM9A 5CD9A 1ZN7A 1SZJG 4Q37A 4JI7B 1VYTA 2JBAB 2HA5A 1NF3A 4N18A 5LWHA 3WGIA 4X8OA 2QJOA 3LRPA 1ZUNA 1BJTA 1DEKA 5EWLA 3K0BA 2XVXA 3W4KA 3ZBPA 4N0DA 2H17A 1JPVA 1RLUA 4UAJA 4LBYA 4ED9A 2AG8A 2QS9A 4FOLA 3MJRA 3NJ4A 4A5OA 2ETXA 4TKLA 1X94A 4HUTA 2EHJA 2HYIC 2WUGA 4KYIB 4Y9RA 2ZW9A 4D1YA 4FWBA 2ZPAA 3OPYA 4BRSA 1Z74A 1EQ2A 3ZD8A 2P65A 2YHBA 5FOUA 5AM4A 3ZIUA 1SIWA 4ME6A 5AKJA