2QYSA

Structure of eugenol synthase from ocimum basilicum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
310
structure length
310
Chain Sequence
GMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eugenol synthase 1
publication title Structure and reaction mechanism of basil eugenol synthase
pubmed doi rcsb
source organism Ocimum basilicum
molecule tags Plant protein
total genus 113
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature ec 1.1.1.318: Eugenol synthase.
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2qysA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2qysA02
1IE3A 3I9MA 1LLUA 1E1MA 1ZKMA 3BHIA 2I3GA 3KB6A 1KC1A 1ZK0A 1BWSA 1I3KA 1YE3A 4EDFA 1P1HA 1SC6A 1LQTA 4FJ2A 3GN2A 5T8KC 2B69A 4RLHA 3N74A 3ROQA 3TZHA 3I1JA 1GD1O 3INGA 4KQXA 3QSGA 1VSUA 2ZTUA 3JD0A 3PIIA 2QQ5A 4HKTA 4YQYA 3NKLA 5CDGA 4IDCA 5KTKA 2I65A 5A9SB 4JLWA 1X0XA 2HUNA 2AHRA 5FWNA 1NQTA 4J6FA 1ENPA 3G1UA 3ETEA 4Y67A 4DLBA 1NBOA 2DM6A 3PFFA 1LLQA 1SOVA 2H5LA 5K9ZA 3AUTA 4QX6A 1QXSA 2X4GA 2O2SA 3ZU5A 2EJVA 4BKUA 2FZEA 4RPGA 3I83A 2W2LD 3D64A 4O6VA 1OZAA 4I9HA 1E1NA 5BSEA 4EJMA 5A4DA 4M54A 4O0LA 3V2UA 3WNVA 3RFTA 3ONDA 3BMOA 1JW9B 3RBXA 1I0ZA 3IKVA 3JQBC 3N7UA 1MLDA 3O8QA 4RDHA 1YXMA 1YBAA 2DVMA 3VPGA 1KBZA 2C59A 1XSEA 4XGIA 1BSVA 1WZIA 2GLXA 3GVXA 1RM0A 1E77A 1QR6A 4ID9A 1HYGA 3UFXA 1E6WA 5AXCA 4JNKA 4R1SA 2TMGA 3SLKA 1LNQA 1FXSA 4OMUA 1DRWA 2YYYA 1I5RA 4BNNA 4YB8A 5C5IA 1VE9A 3QHAA 4XB1A 3WFIA 4B4WA 1CQJA 2OBYA 3MOIA 4GPD1 2ZTLA 1NQ5A 1PTJA 1SOWA 4I5FA 4IS3A 3TQHA 2HK8A 2PD4A 3ZDFA 2VTEA 4AG3A 4IJUA 3HZZA 3RC2A 4AJLA 3M2TA 2HMUA 4GLLA 2E4AA 3PWSA 1QG6A 3HB5X 1SCUA 3OETA 1NAHA 2G5CA 5JAZA 2IEDA 3QQPA 2EP7A 1RPNA 1G1AA 1DHRA 4NFSA 1QMGA 1Y5MA 1DB3A 3IOYA 3OEWA 4OH1A 4R5MA 2P4QA 2OBNA 1YOVA 3CTMA 5DBGA 5JMPA 4CV0A 5C3MA 1VPDA 3PVZA 3H5RA 3U5TA 3Q9UA 3KV3O 3OFSA 1SB9A 4AFNA 4EI2A 5TQVA 4OL9A 1B0AA 1XWFA 4NQZA 4BNIA 1ADCA 1R16A 3E6AA 4KWIA 2GO1A 3LSYA 4LSMA 4E6PA 4JP3A 3VPFA 4IQ0A 3OICA 4ZU3A 3BYZA 2W4QA 4PVCA 2VYVD 4CM4B 3UKOA 3TNLA 3RVDA 4BNTA 2QG4A 3PHJA 2JJYA 4PG7A 4EBFA 2DBQA 3LU1A 1GPJA 3ST7A 1CDOA 1LA2A 1PJBA 2NM0A 1NHWA 2RAFA 4FOOA 4KOAA 1HLDA 2YHUA 1BVUA 1PL7A 2G0TA 1EVIA 1FMCA 5EJ2A 1O95A 3FBGA 3S55A 1DOHA 1CQIA 4DBVO 2CVQA 1XQ6A 1JDJA 4K6FA 4L0QA 4NBWA 3ANMA 4ND3A 3UAGA 1ADBA 2EKLA 2SCUA 3H5NA 2UDPA 2ZTVA 3HFGA 1KYQA 3OJEA 1HTBA 2YQ4A 1WP4A 4UUPA 1KEVA 3AY7A 4GX2A 4E5PA 3KSDO 5H81A 5JCJD 2CF5A 2B4TO 1UXKA 3QWFA 4JJIA 3ZI0A 2Y05A 4R5HA 4BUCA 4B4VA 5AXDA 2VZ8A 4B8WA 5B1YA 3AK4A 5CEEA 3I9JA 4IIVA 3DZHA 2HMTA 4N5MA 2V6MA 2JHGA 3FN4A 4DIFA 1O9BA 3RKUA 3DFZA 2O3UA 2Y1EA 4LSWA 2VHZA 3BHMA 1I2ZA 2HJRA 3QVWA 1NQOA 1HEUA 1WMAA 3DAPA 4OOFA 3MJSA 3WBFA 1WDLA 2WMDA 1NPYA 3VKUA 1PEDA 3JQ7A 2BHLA 2Y0EA 4NIMA 4A27A 1JWBB 3ENNA 4IJVA 2O4CA 3VH4A 1V6AA 1KEWA 3OJ0A 3Q11A 3GVCA 2XXJA 1GFSA 3ZU4A 2E48A 3IAHA 4CQMA 3N58A 5KKCA 3VVBA 1A7KA 4LCJA 3JD2A 3BHJA 1U7TA 5DCWA 3UOGA 3W6ZA 4CM1A 2POQX 3QWIA 5KNLA 3WGTA 2I9PA 3IS3A 5H83A 2NV6A 2X5JO 1ISGA 1PZFA 5L4NA 1E1KA 2ZB3A 3JYPA 1ML3A 3PJFA 1F8FA 1PS8A 4Q3AA 4J1TA 4LGVA 1XLTA 1BW9A 3E8XA 1DO8A 1Q0LA 3TL3A 4XWYA 1QKIA 2OFPA 1K6JA 4LMPA 2BF7A 5JDIC 5TT0A 2FR0A 3VTZA 1ZFNA 4BL5A 3G49A 3PJGA 1R0LA 4DIBA 3DHNA 3EVTA 3RUFA 3NEPX 1KY5A 1EVZA 1PL6A 1CYDA 4E5NA 5G0UA 3TZKA 4J49A 4U7WA 3LF2A 5A3VA 3RSHA 5LDHA 3ZWBA 1EVYA 3RFXA 3GZ4A 4BOYA 5A04A 3D4OA 3ICPA 3GDGA 2R2GA 3E48A 4L76A 1MV8A 3KUXA 4J90A 4YRDA 1YRLA 1PJ4A 4BB6A 1XU9A 4BO0A 3GRKA 5T57A 4OHUA 1RYDA 3MJEA 4AL4A 2EXXA 3O8QB 2VWQA 1O6ZA 3RJ5A 1Y9EA 2JCXA 4YEDA 4OSPA 3T7CA 2O3QA 4M87A 4BNKA 1BXGA 1W6UA 4D43A 3G1TA 4N18A 4BGUA 4BVAA 2YY7A 3TZ6A 3C8MA 4D7AA 9LDBA 3CMMA 2BFPA 1DC6A 1SNYA 2ZYAA 1HL3A 1IPFA 3DBHA 3W8EA 1YKFA 4BNLA 4CQMB 5I7SA 1AHHA 4OIMA 3EZLA 3FTPA 1X13A 4ZICA 5TIIA 3ZHXA 2QZZA 4RQUA 1X15A 1YB4A 2Q49A 1TT7A 3ZV4A 3GNTA 3MTGA 3K31A 3Q9NA 1KVQA 2IYPA 1DHTA 3ZHZA 1ZZEA 3V8BA 4WGGA 3WLEA 3PJEA 4CUJA 3IDSA 5LC1A 5JNLA 1ENZA 5K6AA 4Z9XA 3TN7A 4YT2A 1PL8A 2PNFA 3WXBA 3EGOA 4H16A 1P1FA 4ZQBA 1VM6A 3UCFA 1QORA 1IUKA 1E92A 2BFOA 4LRSB 1ZEMA 4L75A 1C14A 2B36A 4DYDA 2FR8A 4BKRA 4PRKA 5G0VA 3ZNOA 3C7CB 2TMDA 4OXKA 1R6DA 1UH5A 3HDYA 4J16A 4XD2A 2CY0A 4KQWA 3BMQB 2NUAA 6ADHA 4KP7A 4XR9A 2JCYA 3BMCA 5JBIA 2ZYGA 4MDHA 3ON5A 4YJHB 3UF0A 4TRNA 2Q46A 3OP4A 3GZNB 1V3UA 4I5EA 5JS6A 1WW8A 4PLPA 3B20A 2CDAA 1DLJA 1SPXA 1GV0A 3PWZA 3PIDA 3ZV3A 1GY8A 3QWHA 4YYZA 1R37A 4XQCA 4E32A 4AVYA 3W6UA 1YGYA 3EVNA 4ZQFA 3I9LA 5TF4A 1YL7A 3INRA 4IJWA 3NX4A 3MCVA 4R3NA 1GU7A 4JK3A 2JFFA 2GCGA 2EGGA 5T67A 3NGLA 2AEMA 2BELA 3ZW9A 4N7RA 1PJCA 3LZ6A 2JHFA 5BNIA 4UULA 1VL8A 3C7DB 4YT5A 4B4OA 4MVJM 1HKUA 1P31A 4CUKA 2O48X 1GL3A 3G79A 3PHIA 1ZXBA 1I01A 1Z45A 4IDDA 3MZ0A 2I5PO 4GAEA 2H6EA 1M76A 4YRBA 1K6XA 4PG8A 1K2WA 2W90A 3AWDA 4ALKA 4IIUA 4WCFB 3WYCA 4MVJG 3RUIA 2ZB7A 3WDSA 4BKOA 1HE4A 3MJ4A 1JKFA 1DRUA 1LRKA 2Q1TA 1BDMA 4LMRA 1HYEA 3C3XA 5JLAA 3V5NA 1Y8QA 4FOSA 3CUKA 1NAIA 1ENOA 2DTDA 2EG9A 3DBHB 4EITA 4YBZA 1EVJA 1WLYA 1NFQA 3K2EA 1UDBA 2A4KA 4NU6A 1DC5A 2DFDA 4HXYA 4CLOB 2YJZA 4OKIA 3H6KA 1ZK1A 4YDRA 4GLOA 4ZN6A 2WYVA 2C29D 3DZFA 1PQUA 4WKGA 4WE3A 3MWEB 1TB4A 4RVGA 4PGFA 3HWRA 5DP2A 1OAAA 3IUSA 4UEJA 2O23A 4Y8VA 4CM8A 4D3DA 2ZCVA 1IULA 5TNXA 1ADFA 4UAGA 3VC7A 4PLYA 5DCYA 4AJPA 1QP8A 2EERA 1AGNA 4UVIA 3F1LA 2YV3A 4Z0HO 4BGIA 2EW8A 4G5HA 5CDYA 3K5PA 4CLRA 4JXKA 4PLVA 5JE8A 1AUPA 2C82A 3OMLA 1SBYA 2Y1CA 3FWZA 4LN1A 3TL2A 4OM8A 1ZBQA 9LDTA 2H63A 3GEGA 1LEHA 4B4UA 4UVHA 4BQPA 1QLJA 2GF2A 3GUCA 3D3EA 3KZVA 1B16A 4IDAA 4MINA 8LDHA 1LU9A 4MVJP 4XZ3A 1LTHR 3FNHA 1TT5B 5EQDA 1E3JA 2D8AA 4DRYA 3EYWA 1P0FA 3RAJA 1PGPA 3IMFA 4BO6A 4XIJA 3RCBA 1W4ZA 3U4IA 4MVJD 4Q3NA 4UUNA 1QYWA 5CP8A 2YFHA 3AFMA 4M1QA 1QRRA 2UUPA 1GZ4A 1Z74A 2E49A 3ONEA 4GWKA 4J1SA 3GC6A 5GMOA 3RC1A 1PZEA 2BFAA 4J43A 4IZIA 4JIGA 3HQ4O 4M89A 1LSJA 5K6AC 2HO5A 4R51A 1M75A 1N8KA 3OQBA 1HE5A 3H3JA 3BXXA 3OIFA 3ORFA 1YL6A 3I3OA 3QVOA 1D7OA 2DBRA 5EMHA 3E82A 4FBGA 4MVJI 1ZK3A 2JFGA 4ZVVA 1X0VA 1B8VA 4AICA 2J3KA 4Q3BA 1E5QA 1PGQA 3JQ9A 1KETA 3O9ZA 3W1VA 4BKQA 1TXGA 5IN4A 3GUYA 3UCXA 5IDWA 2PLAA 3EUWA 2ZB4A 3V1UA 2NACA 5KVVA 4D44A 4LVUA 5I7EA 3TOZA 2BGLA 4AJOA 1BG6A 1WDMA 4XGNA 4XDYA 5IN5A 3VPHA 5JC1A 2NU7A 4XCVA 2X23A 1DIHA 3P19A 2HRBA 4UEKA 4MIOA 3FNFA 2Q1WA 4XYMA 3MTJA 3MOGA 4ILKA 4U8GA 3U62A 2YDXA 1PSDA 4GMGA 2EKQA 1AXGA 4MVJH 2OOSA 1UAYA 1VJ0A 1ZMOA 3AOEC 3STHA 4CMCA 3F3SA 1UZNA 3MJVA 1U4SA 3PHLA 4PLCA 4CM9A 4XRGA 2C5EA 4CMEC 2FN7A 3JD3A 3H9GA 4GVXA 4XQEA 3SEFA 1CEQA 1VLLA 4H15A 2X9NA 3IQDB 2VWGA 1J4AA 4GX0A 1ISJA 2XAAA 3IP1A 3ZWAA 1H2HA 3LC2O 1EMDA 1X14A 1Y81A 2C5AA 3ZWOA 3SX2A 2GYYA 1B2LA 4Z0PA 2PZKA 3TRIA 3K2BA 2IRWA 3WGHA 4DVJA 4RZHA 1ZW1A 3P7MA 3ZV5A 1NQAO 3K8ZA 5T64A 4CR8A 4FQ8A 3PLRA 3ADPA 2B0JA 5JO9A 4ZQHA 3CZRA 4A5OA 3S2EA 2JCVA 2BI8A 4B7CA 1Q7GA 3DONA 1GUFA 3EW7A 4DTIA 3WYEA 3D0OA 2GZ3A 3JQGB 4GL4A 3DQPA 4ND4A 1NVTA 3VOSA 4DWVA 1DFHA 2J3HA 5IDXA 4GGPA 1NNUA 4QQRA 4UEOA 4YT4A 4KDFA 1VRWA 4CR6A 1CWUA 1OFGA 1OC4A 1A5ZA 4CR7A 3OJLA 4CMBA 1SEVA 1T2FA 4MO2A 3PK0A 3RC9A 3HADA 1DFGA 2VWPA 5JAMA 3W4IA 5TLSA 4FR5A 3VZQA 1WXDA 1ZVMA 1TT5A 4CM7A 2QW8A 4IBOA 4RVFA 4DC0A 5AYVA 1XA0A 4UVGA 2GRAA 4CM9D 4C7JA 1GYQA 3ASUA 5COBA 2E82A 2WTBA 3GDFA 4P8RA 3DBLA 4X54A 2X0RA 3NTOA 3F1KA 3JYLA 1Q2XA 2UYYA 3LYLA 1MG0A 3NUGA 1LSSA 1B7GO 2W98A 2DPGA 1LSOA 5B4TA 1FDWA 4L4XA 4WLUA 3ASVA 2J3JA 2VOEA 5F1KA 4B3HA 3PP8A 4DMLA 3BTSA 4BO9A 1WWKA 1A4UA 5ICSA 4QUKA 2WYUA 3DO5A 4RZIA 2C2YA 1ULUA 1P1JA 4YAJA 3MJTA 4Y6RA 4XJTA 5ES3A 3GNSA 4PZEA 3DBRB 2AQHA 2DT5A 3WG9A 4W7IA 3VZRA 2ZTMA 1GEEA 1OC2A 3C24A 3ABIA 3AUSA 3QV1A 5L7TA 1C3VA 4HNHA 4QO7A 5BSGA 2X0JA 1G0NA 1Y8QB 3LT1A 2CF6A 4D0SA 3K30A 3KSUA 2WE7A 3AOGA 5EERA 3QVXA 2FSVA 3U9LA 4RORA 4ALIA 4W4TA 3FR7A 4WLOA 2DC1A 2O50A 1SAYA 3CINA 5FYDA 4EW6A 5L45A 3GGGA 5ICMA 1DIBA 3RUHA 4BO7A 4YRAA 4CMIB 4GKBA 4WCFC 2R6JA 3BZUA 1TEHA 2PH5A 4F3YA 2PZLA 4GX5A 2AEJA 1L1FA 4OYRA 3UH1A 2D0IA 2EJWA 5JAQA 4AJIA 2DTXA 5L40A 4D3FA 1RJWA 3R6DA 1KC3A 4R9SA 3L07A 4I1IA 5JY1A 1PZGA 3DBVO 2W8ZA 1PS9A 3E9MA 4E4YA 1T4BA 4E33A 3H2SA 3JQ8B 1QYVA 5IG2A 3P2OA 1EDOA 1H6DA 4W9NA 1DIRA 3ETDA 4BO1A 1MB4A 3RASA 3S2FA 2ZIZA 3INTA 3KTDA 5IJZA 2ZKLA 2J5QA 1WNTA 4ZD6A 4EUEA 4IGEA 3E9NA 1TVEA 3W8FA 4IGFA 4HP8A 3NDJA 5I7VA 4HFRA 1ZCJA 1HE3A 2B37A 4RVSA 4C4OA 4DUPA 4O63O 4MIYA 3ZWPA 1IPEA 3L6DA 2GASA 4CMIA 3M1AA 3UHAA 1R12A 4XGKA 3CPSA 5U1PA 1UXHA 2HCTA 3V2GA 3GVHA 5FEUA 2AQIA 1TLTA 1DAOA 4JJFA 4G65A 2QZ9A 2VQ3A 1WVGA 5G2OA 1R4NA 4YAGA 2Y99A 2FHSA 1YDWA 3WS7A 3AI1A 5HS6A 1EBFA 1ZUD1 3D1LA 2BGMA 3GR6A 2AE1A 4HY3A 5BSFA 1MFPA 4WJZA 4YPOA 4XYGA 3OBBA 2IE0A 3WQQA 3H65A 1QYCA 2VTDA 4BS9A 1KERA 1P33A 4E13A 1Z7BA 5A02A 4IMRA 2NADA 1P9LA 2DUUA 1HDOA 1F0YA 3V2HA 3JQBA 2ILTA 4N5NA 2RHRA 1O89A 3RU7A 4KZPA 2I3AA 5T8KA 5U4QA 4IINA 2AQ8A 1UJMA 3TSCA 1PJ3A 3DC2A 4XKJA 2GNAA 3U49A 4BO4A 4J7CA 2VZ9A 3SC4A 3ZWXA 3PFWO 3G3EA 4NJMB 4TROA 1P0CA 5JYEA 1YH3A 4CL3A 5ADHA 3KYCA 1F8GA 1MC5A 2YZ7A 1A4IA 1BXGB 5JDIA 4XIYA 1CIVA 3PZBA 1CERA 4XEHA 3B1JA 2GSDA 3ZU2A 1C1XB 5KVSA 4PLZA 4TKLA 4HUJA 3DXFA 3JQAD 3GA0A 4J7UA 3JQ8A 4CL8A 3O26A 2Y67A 2UAGA 1DJNA 1H2BA 1N9GA 3AY6A 5KJ1A 4PG6A 4Y6SA 1ISHA 2FWMX 1V3VA 4JCOA 5MGBA 4N54A 4CQMD 2AA3A 1NPTO 3RC7A 4S1VA 4FFNA 2NQTA 2FPPA 5FI5A 2X6TA 3ADOA 2O7SA 1M6WA 1PJSA 4ND1A 3U09A 1H9AA 2Z1NA 4FSHA 4RPJA 4TMFA 4FGSA 4KUHA 2HAEA 4DA9A 2CNBA 1R66A 1E7MA 4AJ4A 3ROKA 1F12A 1LQUA 2VNSA 1N1EA 1CRWG 3IP3A 3NT4A 4HNGA 3JTMA 1DLIA 3FPCA 2PR2A 4A2CA 5A03A 3WMWA 4RGBA 2ZQZA 1AN9A 2IZ1A 5JYDA 1GCUA 3C1AA 3SXPA 4R1NA 4NH4A 3VAZA 2OMEA 5A9SA 4ESOA 1U9JA 5GY7A 3TJRA 2DLDA 2DBVO 1NYTA 2YFQA 3RI3A 3ANNA 1X1TA 1UR5A 5JFOA 2UVDA 1LDGA 3JQFA 3ZWYA 5KJ6A 1EZ4A 2G1UA 2ZJ0A 4II3A 2DQ4A 4CV2A 3QRWA 1N7GA 1F14A 2Q2WA 4NDNE 3UICA 4WPGA 2Q1UA 1JU9A 2NU8A 4JJGA 4C7KA 3I52A 3FD8A 2DFVA 5DOZA 1I3NA 2X5KO 1K3TA 2JFHA 5A5EA 4II2A 4YVFA 2PV7A 4W7HA 4E0BA 4YQZA 3GFBA 3ICCA 3OA2A 1WMBA 4LISA 4M8SA 4QXMA 5AXBA 4UVEA 3GAFA 2CFCA 4DMMA 1ONOA 1HDZA 2VOJA 5G4KB 2EHDA 4MKRA 1HF3A 4FIZA 1J0XO 4ITUA 5CHEA 2NU6A 1J6UA 1K5HA 3VZSA 2J5RA 2GN9A 1X7HA 4J7XA 4LVCA 4R9RA 3WGQA 4YT8A 1GDHA 4JGBA 3S8MA 3OEYA 4LK3A 2PKQP 3VPXA 1YQXA 1C1XA 1YJ8A 3UGKA 3ZW8A 5DF1A 1ZK4A 3IC5A 4YJGB 2CSUA 2GD1O 1T1SA 2QX7A 4IDEA 1EE2A 3GF4A 5JDCA 1IYZA 3SC6A 1LDYA 4BMSA 4D0RA 5GZ3A 3NTRA 4BO3A 2UUOA 3PDUA 3PGJA 1Q0HA 2AG5A 1DFIA 4OOEA 1EFKA 1WZEA 4XR4A 3F5SA 4F6CA 3GRPA 4XQGA 1G6KA 3PGXA 3L0DA 1GZ3A 2QRJA 1PJTA 3K73O 2VUTA 1Y8RB 1E3IA 2CUKA 2R00A 1MFZA 1E7YA 4MP3A 4Y9DA 4XYLA 4PZCA 1IB6A 4B7XA 4S3MA 1E0DA 5DULA 2Y66A 3DMTC 2BH9A 3W8DA 4NK5A 3WX0A 3PXXA 4YTEA 4P38A 5C37A 5CAEA 2FMUA 3JQ9C 4L74A 1I10A 4MKZA 1I3MA 2Z1MA 2EEZA 1I33A 1JVSA 3TFOA 1MXHA 4UVDA 4TZTA 1E7QA 1QLHA 1D1SA 2ZB8A 3F47A 2HDHA 4LCEA 4Z9FA 1BRMA 3H4VA 2P68A 2QRLA 1GQQA 3K96A 4K26A 2NVBA 5AQ1A 3OSUA 3NRCA 5JPIA 1JKJA 1YVEI 1NTOA 2GGSA 1MGOA 3R0IA 3VPSA 2DKNA 2OUIA 3WTCA 4RDIA 2HMSA 3GMDA 4FFRA 1K6IA 1SMKA 5G4LA 2FR1A 2WJPA 3H2ZA 3ZNNA 3DZIA 2NWQA 3QJ5A 2B5VA 5IZ4A 1SO8A 1I8TA 2VWHA 1Z73A 4U0KA 2WEKA 4R4JA 3LT0A 2O4UX 3HDJA 3GN1A 4NI5A 3A9WA 4FJ1A 3VKVA 4QFDA 2A9FA 5ITWA 1U3VA 5KCZA 5BR7A 2BLLA 3HJAA 4P4NA 4CM6A 4WOJA 2P9CA 2XOXA 1LUAA 2D1YA 3JQ6A 1L7DA 4B79A 1T24A 2VZ0A 2ZYDA 3BMOB 1LSUA 1KOLA 1BW9B 3JD1A 3Q3CA 1ZNQO 3E1KA 2GUGA 2YW9A 1H6BA 4DC1A 1C1DB 1CJCA 5ENVA 4R16A 3WB9A 3DZKA 3PQEA 2VHYA 4KWHA 1T2AA 3RU9A 4EZBA 1JAXA 2HMVA 4GGOA 4L9RA 2Q4BA 1C0LA 3JCZA 1YWGO 4W9NC 4H7PA 4OAQA 3OJOA 4I08A 4U6SA 4CMAA 3SLGA 3WJAA 2Y68A 4MIEA 2HLPA 2X9GA 3QLJA 5JW6A 2CZCA 2QHXA 3DBRA 2QIOA 3LT2A 1QYDA 4CMJA 2WE8A 3BTUA 3HN2A 7ADHA 2IEBA 2E6UX 2OO5A 2PKQO 3HE3A 1Z82A 2DAPA 4FS3A 3UVEA 4U6QA 1IOLA 1ONPA 3LK7A 4BNGA 3ZZNA 3DAFA 4EGFA 4HWKA 4PLFA 5A5FA 1LDBA 2NVWA 4GSKA 4E2XA 3S2IA 2BRUA 3ZV6A 4CPDA 5F1PA 3GAZA 4EUFA 4ALNA 2AE2A 2PH3A 2VN8A 2FSSA 4RPHA 3TWOA 4ALLA 3FPLA 2ZCUA 5DBIA 3DB2A 3L4BC 1M66A 3LLSA 5G0WA 4A10A 1LC3A 1C0IA 4WLFA 1U28A 1ARZA 3RUCA 1M2WA 4CLXA 2Y93A 5CDSA 1T2EA 3WICA 5KVCA 1MA0A 4WEQA 4BNMA 3QA9A 3OHSX 3ITDA 1W0CA 3EAGA 1NVGA 3RUEA 2I76A 3KSZO 1ZK2A 4MP6A 3RKRA 3NYWA 1HDYA 1PJQA 3HDQA 3X2EA 3OJFA 3OA0A 4E3ZA 3ITKA 2PGLA 5ILGA 5LDGA 4O1MA 3U3XA 5JO0A 1LJ8A 2QYTA 4J91A 1MP0A 4RQTA 2HQ1A 1P44A 3FCOA 4GQAA 2XXBA 4BNFA 1GPDG 4IPTA 4XYEA 4F6LA 1Y6JA 3DAGA 5G0TA 3C85A 5EIOA 2GZ2A 2CD9A 4BKPA 4EEXA 2C20A 2D5CA 1DPGA 1J49A 2XF8A 3WIEA 1MC4A 1CF2O 3NJ8A 1VC2A 2HRZA 5KVQA 1EFLA 2YV2A 5KJEA 2I6TA 1MXFA 3AW9A 3JQ7B 4FB5A 1YB5A 3JQGA 1T1RA 3R3JA 4YJFB 1ISMA 3GVIA 1M67A 1B8UA 3LF1A 3GMSA 3F46A 2GDZA 3WQRA 3I9KA 2PA3A 1RWBA 3ZH2A 5B12A 3BMNB 2CVOA 1ZO8A 1RM4A 2X0NA 3I5MA 1UAGA 2BI7A 3B6ZA 3WGGA 2P5YA 1A9ZA 3DMTA 4Y6PA 4BMVA 1YO6A 2YDYA 1F06A 1U3WA 4OGWA 4U5QA 3UUWA 3WYBA 1PWXA 4BO2A 2NSDA 3O4RA 3P2YA 2O3SA 1XCBA 3VDQA 3FBTA 3NTQA 4XX0A 4Z9YA 3L9WA 4RLSA 4JBIA 1I2BA 1VSVA 1XELA 3AM3A 4CMEA 3VH2A 4U0JA 3LT4A 3RUDA 3NDRA 5COQA 4Z3KA 2HSDA 4FC6A 4CMHA 1DDOA 3ZU3A 2P91A 3JQAA 1XU7A 2WD7B 3GZNA 4LRTB 2X1HA 2C7VA 1ZSVA 1T25A 5EQFA 5CFZA 2NU9A 3BMCB 4JN6B 1G0OA 4BNWA 1QV6A 3AI2A 1IZ9A 5EPOA 1U3UA 3FNGA 4QT0A 1UXIA 1ONNA 2JKVA 3FWNA 1LI4A 3JQDA 4XB2A 3TPCA 1K89A 1EK6A 4BV9A 4FDAA 1DIAA 4HV4A 1PJ2A 4ZQGA 1H0KA 4BIIA 5B4VA 4DIOA 1JAYA 5IZCA 1PGOA 1NASA 1V35A 3TFQA 1OBFO 1Q7CA 4AJ1A 4Q39A 4WLNA 1GTMA 1ENYA 2AMFA 2Z95A 4R3WA 3RROA 2VT3A 2OP0A 1T26A 1P1RA 4RL6A 5G0SA 2Q3EA 1DAPA 1EK5A 3GPDG 4CQLB 1ID1A 1FF9A 3EMKA 3OIDA 3GEMA 4DGSA 3VVCA 1R4MA 4L73A 3H9EO 3L9XA 4QO8A 1YOVB 1AXEA 5JXWA 1OOEA 1PX0A 2W2KB 4PLWA 2VHVA 3G17A 1FDSA 5ILOA 2P9GA 3ZWWA 2RCYA 4Y98A 5TSDA 4IDBA 4GWGA 2YHIA 3Q0EA 1C1DA 3CE6A 3NJ4A 4ZRNA 2C54A 2G82A 1HLPA 4IUYA 1VJTA 4I5DA 2VHXA 5BNTA 1GEGA 5A05A 2ZATA 1CETA 1E3LA 1PJLA 1UXJA 2F1KA 5I9MA 3IL2A 4GVLA 1HYHA 1EEHA 1QYXA 4PG4A 5THKA 4BNVA 4RV9A 1PR3A 4NMHA 3A28A 4DPMA 5IF3A 4UUOA 4ALJA 1ZEJA 2VT2A 3HB4X 4J0FA 3UXYA 3RD5A 4D45A 2B35A 2VYVA 1JTVA 4CM8B 4FW8A 2CMDA 4KUEA 3T4EA 1LDEA 4E5MA 4MP8A 4RF4A 1Z75A 4MVJA 2G17A 3PZRA 4BHTA 2JD1A 2WD7A 2NVUA 3JYQA 2Z5LA 2HKIA 4E21A 2B83A 2Y1FA 3R3SA 3IKTA 1N1GA 5HS4A 2EW2A 1H5QA 4PLTA 4MPDA 1U2GA 5F5NA 1IHYA 3DHEA 4K1LA 4E5KA 4G81A 2EF1A 2DUWA 2FZWA 4BNUA 4MJLA 3PRJA 4D41A 4ZA2A 5A1TA 4YA6A 3KOUA 1YJQA 3HG7A 1HDXA 4BO5A 1DRVA 1KVTA 4XA8A 4CJXA 1KVSA 2GN6A 1P77A 3CMCO 1UDAA 1Z6ZA 3SVTA 4EUHA 1E7RA 1JVBA 5EESA 1LBEA 2I99A 4WCFA 2ZK7A 1HZJA 5AVOA 3PPIA 2X22A 3AOEA 5CDTA 3WGIA 3FF4A 2YQ5A 1IHXA 3W4JA 1Y8RA 1DJQA 1ZJZA 1VJ1A 2JAHA 2RH4A 3FHLA 1R4NB 1RKXA 5K0ZA 1YS4A 5C7LO 5JC8A 4IXTA 3H8VA 2DPHA 4IM7A 4YXFA 2H1SA 4FFOA 1VL0A 3IJRA 3D5TA 3KBOA 4CLHA 4J3FA 4MKXA 4NBRA 4CLEA 1Z7EA 2JL1A 3RBVA 1HETA 2HK9A 4ZQEA 2VRCD 3TOXA 1BXZA 1ADGA 3EK2A 3QY9A 5JCXA 2YUTA 5A3JA 4KUGA 5I8ZA 4NBVA 1U4OA 4ALMA 2LDBA 4QSMA 3QWBA 4WNIA 3A1NA 3AU9A 5DNAA 4O5OA 5FI3A 3EC7A 5C7IO 1U1IA 2Q99A 3AU8A 4YJGA 4HFNA 2D2IA 3ZWMA 1PQWA 4CV1A 1B8PA 1PGJA 1ZSNA 1O94A 2VNAA 1MUUA 4EJ6A 1LRLA 1GZ6A 2VCYA 4MVJE 1U7HA 3FNEA 5TC4A 4JBHA 1E7SA 3GEDA 3A14A 1UXGA 2PD6A 3C1TA 2W2LA 5DN9A 3D3WB 2C7GA 3AI3A 5T5QA 1RM5A 1J5PA 1BXKA 4WK6A 4EYEA 2OHXA 4OSOA 3RIHA 3WGZA 1TI7A 2H9IA 3PTZA 3ROMA 1E3SA 4N5LA 1A7AA 3BTVA 1JN0A 2P4HX 3D4NA 3NT5A 3Q6IA 1U8FO 3KM0A 1L7EA 3AM4A 4R1TA 3GT0A 5CEJA 3KEQA 5I8WA 5L51A 1EBUA 2O3RA 3FR8A 4EEZA 3X2FA 3PDJA 1NR1A 2X0IA 1U5CA 2B4RO 2X9VA 1BDBA 1K0UA 3KLPX 4NZ9A 4RVHA 5CDUA 3D5QA 1D8AA 4EJ0A 5KJCA 1XEAA 3F4BA 3BIOA 5L95A 4RF2A 4FFLA 3TZCA 5I9LA 3QW2A 4J1NA 1EQ2A 1VKNA 4H3VA 4WOKA 3RUAA 3VZPA 4DLLA 2Q4EA 1IL0A 3WWYA 4AJJA 2RIRA 1HDCA 1EUZA 3GK3A 3I4CA 4CM3A 4OQZA 3ONFA 2D5AA 2O3JA 4Z0TA 5T6BA 5B4UA 3LLVA 4IJKA 4PIVA 5TJHA 2IDZA 2PD3A 3FTNA 1XGKA 5DT9A 1NVMB 1Q0QA 4CODB 2Q1SA 1QSGA 1NWHA 1NP3A 3I6QA 3RJ9A 1U2DA 2WM3A 4NBTA 2FRDA 4Z6KA 3QWAA 3C1OA 1PGNA 1WPQA 3VH1A 2IXAA 1E5LA 2NNLD 5MDHA 2Q2VA 3D3WA 4GBJA 1IZ0A 3DR3A 4XYBA 2V7PA 4TRMA 4NNJA 2FY8A 3DL2A 3RQSA 1GV1A 5COAA 4INAA 2PY6A 1HZZA 4OXNA 1TA4A 5JY6A 4J4HA 4K6CA 5TS3A 1U8XX 4ND2A 1FK8A 2IZZA 3D4PA 1PWZA 3CKYA 1DC3A 4E5YA 3JQAB 2HJSA 4RPLA 4BGEA 1T2CA 1H9BA 4PFJA 4RF5A 3KYCB 4DYVA 1XQ1A 1A9YA 1SEPA 3C7AA 4FGWA 4NFHA 4DL9A 4DXHA 1UDCA 3ZNQA 4BO8A 4ZGWA 3IUPA 1NHGA 2UV8A 4YJDA 2J6IA 3K92A 1P1KA 1EUDA 4ZHSA 3U4DA 3O03A 3OQ6A 2PGJA 4IZHA 4K9DA 1E3EA 5CPFA 3SJ7A 5JAIA 3PHHA 4MOWA 2FPIA 4NFYA 2EWMA 2OZPA 4YAIA 3E03A 4FJ0A 4WEOA 3COSA 3KLMX 3KYDB 2D4AA 5C7OO 5BQFA 4A7PA 2CDCA 1ISFA 4QFCA 2V6GA 3PYMA 1NPDA 2OXIA 2B5WA 1H94A 4KMSA 1SZJG 3I23A 1GAEO 2A35A 3E5RA 2OORA 5F21A 5F3RA 3F9IA 1QV7A 3ZGYA 1DBVO 8ADHA 2AG8A 3PJDA 1E3WB 2D59A 1PQPA 4KTTE 4E2ZA 4YAEA 4G2NA 3K9QO 4L8VA 1LX6A 3H7AA 4LW8A 4Z3DA 1JWAB 3A06A 3GHYA 1FDUA 3TDKA 2VYNA 1I30A 2DBZA 4AJHA 5IXSA 2BKAA 1B3RA 3JSAA 2WDZA 4JBGA 3CZMA 1HWYA 2QYSA 4WNCA 4CV3A 1IY8A 4GMFA 1E6UA 5GZ1A 3ENKA 5EN4A 3LC7O 4IQGA 3VDRA 5KKAA 4ZRMA 4FC7A 3QP9A 5IXYA 2PTGA 4M55A 2QRKA 2X8LA 1ZJYA 1NFFA 1D1TA 5L7YA 2DTEA 1Y9AA 2A94A 4BGVA 4WLEA 5G4KA 5CPBA 3EHEA 4YACA 1N5DA 4AJEA 1P45A 3PLNA 4CM4A 4TRRA 3GG9A 1H6CA 4TVBA 5BSHA 3JD4A 3GHHA 3GGOA 1PIWA 4I8XA 2D3TA 5THQA 3HFSA 4QTZA 4PZDA 1JQBA 3TZQA 1KS9A 4E2WA 4HBGA 1DXYA 5ENDA 1FJHA 3WNQA 4D46A 3VTFA 4NK4A 1U5AA 4NR0A 4YAKA 1EDZA 1UP6A 5L7WA 4ONEA 1D4FA 2B4QA 1C0KA 3GY0A 3NV9A 4L4SA 1JKIA 2A92A 4J4TA 3MEQA 3M2PA 3DZGA 4J0EA 5JCJA 1XDWA 4DPLA 3WGOA 1YDEA 3S1LA 4PRLA 3ZHBA 3WOHA 1EQUA 1FDVA 2WYWA 2Q2QA 5TX7A 1R0SA 4F46A 2W2KA 5J23A 2IZ0A 4R54A 4IDFA 5CEFA 3KYBA 2PZMA 2GZ1A 4AJKA 7MDHA 1P74A 2J3IA 5BT9A 3HHPA 1R15A 3GGPA 2CVZA 2C2XA 1PZHA 1S6YA 4OJNA 3WBBA 2YHIB 5A9RA 3WLFA 4XJSA 4Q3EA 1YL5A 4NHEA 1S7CA 1V3TA 2O2YA 3S2GA 2WSBA 1F17A 1ZMTA 3OIGA 3WGYA 4J9UE 1R4MB 4I9NA 4E12A 1EE9A 1B26A 4FN4A 1B14A 5DDIP 2C07A 3LDHA 2RBEA 5EL0A 1I3LA 2CDBA 3QIVA 2GERA 3T7EA 2EIHA 3HDHA 4A26A 1UZLA 5IZCC 1VI2A 2PFGA 4IXWA 5ER6A 5I9NA 1E6EA 1RM3A 5CG2A 4BB5A 1BVRA 2BFMA 4BV8A 4CUZA 4HFMA 3OM9A 1NXQA 3MWDB 3M6IA 1P1IA 1A71A 4TKMA 4DLAA 4J2HA 4NBUA 5LCXA 5EINA 5DZSA 5HWSA 2F00A 1BMDA 4A73A 4DBZA 3ROPA 2BD0A 2J5KA 3BA1A 5HTOA 2I67A 3CEAA 4QECA 3DBLB 2ZQYA 4P22A 4AJNA 3KHUA 4IQ8A 5DCUA 1GQ2A 1LLDA 1M6HA 3KEOA 1YBVA 1N9GB 1P3DA 4RVUA 4QEDA 1UP7A 4FPXA 5JMWA 3ZWVA 1N92A 5KOIA 3L4BA 2AEFA 1GQYA 3MJCA 4TSKA 1KIFA 4WASA 2DU8A 3EDMA 2Y0CA 3UW3A 1WDKA 4UREA 4W99A 1GADO 2Y0DA 2O3TA 1ZIDA 3HNPA 4BMNA 1KVUA 1KY4A 3IIEA 5GZ6A 4R1UA 3PHGA 4WECA 4CMKA 3DEYX 1UUFA 3G0OA 3CH6A 1A27A 3L6EA 4HADA 2V65A 3ZN2A 1XYGA 2Q45A 3JYOA 4TRJA 3W4KA 2Y1OA 3BMNA 3Q1LA 3FSRA 1OMOA 3SJUA 3AFNA 3GVPA 4FFPA 2J8ZA 2NTNA 3ZHYA 1V9LA 2GR9A 4TQGA 4E2YA 3DWFA 2G76A 3PQFA 4NG5A 3NGXA 1D3AA 4D3SA 3E18A 1ORRA 3I9OA 2V6BA 4RJTA 4UUMA 1AE1A 1Y7TA 2V6FA 4NPCA 3GLQA 5A9TA 1UZMA 3KVOA 1DEHA 1PS0A 1ULSA 5AOVA 1PR9A 3RFVA 5L9AA 4TWRA 5A06A 3H9UA 5TJ9A 2ZJ1A 4WCDA 4FD3A 3U0BA 5ITVA 4HFJA 3V1YA 2X7HA 4RF3A 1LC0A 4BNJA 4DQUA 3DZJA 5U9CA 1Y5RA 4WUVA 3PEFA 2Y1DA 3L4SO 3DOOA 1MX3A 3AJRA 4CMGA 2BMAA 4IDGA 4IS2A 1BHSA 3UCEA 3ETGA 3SBOA 4JQCA 5FF9A 1JLLA 2IYOA 2VUUA 4PCVA 1KEPA 4OXYA 4ROSA 4PLHA 4YR9A 1X7DA 1VL6A 4B8ZA 1RYEA 4BNXA 3HN7A 4J4BA 4OKNA 3AY3A 1HDGO 1NR7A 3BTOA 3CIFA 1O5IA 2Y1GA 3E5MA 4B3JA 5L4SA 1FDTA 5BNFA 3BMQA 3WSVA 4KTVE 1X7GA 2X58A 4E30A 3H9QA 1LLCA 5KWEA 4I5GA 4OQYA 5HBRA 1GUYA 1E7WA 1XKQA 3B70A 3VH3A 4XDZA 1GUZA 3OQ1A 3PWKA 3DOCA 4NU5A 5KIAA 2PZJA 4GI2A 3Q2IA 3KXDA 3GOHA 5IDYA 4DQXA 5CG1A 5DBFA 4J1QA 4XQ9A 3DMYA 3DTTA 3WR5A 1HSOA 3R1IA 4NJOA 4FCCA 1N2SA 3ZNPA 4GKVA 3NAQA 5IDQA 2RHCA 3CSDA 3B1KA 3PI7A 2JD0A 4IY1A 2LDXA 3WFJA 3ZWCA 4DQVA 3LVFO 1YB1A 2P5UA 3KYDA 5HA5A 1I32A 3WIDA 3I4FA 2OP1A 4B7UA 1HT0A 1OI7A 3JV7A 3B1FA 3PQDA 2PK3A 3WMXA 2Q50A 3A4VA 2VRCA 3EZYA 3F6YA 3GQVA 3GH3A 4F45A 4I9UA 4ZJUA 4GH5A 5IAAA 2JAPA 1ISIA 1W73A 3FRJA 3T4XA 5TT1A 3QVSA 3UN1A 1DC4A 4JX8A 5I7FA 4RVDA 1C0PA 3D7LA 2NTJA 2X86A 2OGUA 1N7HA 2FP4A 1A72A 3M1LA 2JD2A 2EP5A 1GYPA 2PWZA 3CXRA 1T4DA 5F5LA 4A03A 1NX6A 4J9VA 1EUCA 1DSSG 5TRTA 3I6IA 5JDCC 3QVTA 1Q7BA 1YONA 3JQFC 4RPKA 2X5OA 3Q2KA 3OECA 1X1EA 4BNHA 4GX1A 3DZBA 3QE3A 2GN8A 3H9JA 2P9EA 4YCAA 2VRBA 4R69A 1HDRA 1NFRA 4D42A 5L4LA 3I9NA 3KRTA 3OF2A 2VUSA 1ZH8A 5F1OA 1U3TA 3DOJA 3ZCXA 3DFUA 3U4HA 2R00C 4JROA 3WWZA 3WQSB 2HMWA 1GYRA 3JYNA 5ER9A 3RBZA 3TF5A 1HRDA 2XPCA 2HU2A 4K28A 4YWJA 4CLRB 1V8BA 3NDIA 4IMPA 1LDMA 1O8CA 3ZWNA 1SB8A 1JA9A 5HM8A 3JQCA 2WD8A 3DDNA 4DREA 1BTOA 4P4LA 5HRUA 3U4CA 3GDOA 5DOVA 4M49A 1ZSYA 4CLOA 4HX5A 3OH8A 1YQGA 4NJMA 4M86A 4CLDA 5KJFA 3L6OO 4O59O 1ZXLA 1BGVA 2EKPA 4RCVA 2OL4A 1Q1NA 1I2CA 1YBMA 2FOIA 4AJ2A 3H5AA 3LQFA 3V1TC 2EV9A 3DTYA 1H6AA 2NTVA 3HUDA 1LXCA 2AXQA 3ANLA 4PG5A 4RO0A 5DP1A 1VKOA 3FI9A 4R01A 2FPGA 4XRRA 5AXAA 3AUAA 4ND5A 5L53A 2E37A 3H3FA 2IXBA 3JQEA 4CM5A 5H82A 1XIVA 3P5SA 2NQ8A 1WAMA 3VHRA 5FFFA 1LRJA 4R68A 1B15A 4PVDA 1UP4A 2P2SA 2C0CA 3WSWA 4CQLA 1H93A 3NT2A 2YV1A 2PKRA 4YJFA 2PGDA 4JP2A 3GFGA 3BAZA 3WTBA 1DIGA 4R41A 3WJ7A 1I24A 3L77A 1LDNA 1KVRA 2BGKA 4J2OA 3E9QA 4URFA 1HSZA 3LC1O 3HSKA 1E1LA 2I66A 4BNYA 5JSFA 2AQKA 2IODA 5TGDA 4MVJF 4TVOA 4FFMA 4A0SA 1PU2A 2RH8A 4BNZA 4P4GA 6LDHA 1HXHA 1YQDA 2ET6A 4OO3A 4D79A 3F5QA 1HE2A 1NM5A 3GPIA 1I36A 2GN4A 4Q3DA 1MG5A 2VYND 4E31A 1XG5A 2VHWA 1T2DA 2O7QA 1GR0A 2NVUB 3ULKA 1GCOA 1W8DA 4L4RA 4PLGA 3RWBA 3AM5A 4KDEA 2AW5A 1NWCA 4B3IA 4GSLA 1XR3A 2EGHA 1R0KA 4WLVA 4PN3A 3GG2A 3DHYA 2WWRA 3IJPA 3O38A 2GPTA 1Y1PA 2NLOA 3PYLA 4W6ZA 3F4LA 1V0JA 3KETA 3GNQA 5IFLA 1XHLA 5L3ZA 4YJHA 4DPKA 3KO8A 1B3BA 3K6JA 4BQRA 4TZKA 5B37A 1O0SA 1E3WA 3EY4A 4Q3CA 4Q9NA 4W82A 1AHIA 2HK7A 1KEUA 3PYXA 3AUUA
chains in the Genus database with same CATH superfamily
1IE3A 1ZKMA 1RI3A 1SVWA 5DRYA 3D31A 3LXUX 2KM1A 5EVJA 1BWSA 1LLFA 4OHFA 3QENA 1VMKA 1X42A 3RE1A 2WWHA 2VPZA 1AT1A 4KE6A 4HT3B 4XDGA 2GYVA 3MUNA 2XJ9A 3DMGA 2VPQA 2B69A 3TZHA 4LE1A 3W6PA 1GD1O 2OD2A 4KN6A 4OP3A 4Q16A 4TYYA 3I4LA 3DL7A 1M2GA 3S28A 1V8DA 4HCJA 3PIIA 2QQ5A 4HKTA 3SF8B 4OHRA 2FRDC 1B1AA 1IXYA 3QV2A 2QVCA 3IQXA 4IAOA 4Y1RA 5DLQC 3SX4A 2I03A 4UUAA 4FB4A 2I2BA 2HUNA 1U0BB 4HAVA 2PQMA 5AI8A 1KEEA 3A1VA 4LJ9A 3WB2A 3CJTA 4M2LA 1NKSA 2DM6A 2C0QA 1L5KA 2YKGA 1PYOA 2CBGA 3V48A 1DMSA 2H11A 3EGDB 3FCCA 3AUTA 3ZD8A 4EQ6A 2X4GA 2O2SA 3GYGA 3PC8C 4RVCA 4R7ZA 1ZR4A 4DDMA 4BKUA 4NULA 2FZEA 6Q21A 5EZ6B 2W2LD 3D64A 3FHTA 1WP9A 1GO2A 1UODA 2MT9A 1JHPA 1E0SA 1FP4A 4H0CA 3S7ZA 3WIUA 1P8JA 2ZI6A 3MM4A 4X7RA 3VAAA 4PGAA 2ZWVA 5FDFA 3WLQA 3IHLA 1I0ZA 3IKVA 2GETA 2CXRA 4H0NA 4TWAA 2A0XA 1M6VB 1MU0A 4JCCA 4Q9DA 1JAHA 1MLDA 2GD6A 1GSAA 1M54A 2QRUA 2XWBF 1ZAYA 5CU7A 1L4YA 2A30A 1KBZA 2A9RA 2C59A 2NGRA 2PSFA 4LA4A 4Q15A 1WZIA 2GLXA 3GVXA 3L4JA 6REQA 4OUDB 5KNBH 4F12A 1NYRA 1WCXA 2ECPA 1CHNA 3RVBA 2R97A 4JNKA 3HY4A 2AW3A 2ZYRA 3W5HA 4RTQA 1YI0A 2G4LA 1K6MA 3QEJA 5LXTA 2P6NA 5CURA 1BH6A 4XW2A 4OAOA 2OQRA 1OYOA 3ZIAA 4DCGA 3NP9A 1UQRA 2XIJA 1HT2E 1M0TA 2R84A 3CEJA 3FWHA 4BLRA 4EL5A 1PTKA 2QAJA 1EWKA 3SVZA 1I5EA 1YS1X 2V45A 3T3DA 1P7WA 3R76A 2J4FA 2PZEA 1ZUNB 3GUHA 2WKQA 3K32A 2FDCA 4EQZA 1KRWA 3MOIA 1VYUA 1FUYB 1PAUA 1PTJA 2YIJA 2Z8XA 2GOYA 2ZRLA 2C4WA 4O2AF 3UWPA 4DUGA 2PD4A 4UTRA 3ZDFA 1W36B 4AG3A 4IJUA 3HZZA 5ALKA 2CJYA 2IU4A 1TMOA 1NM5C 4JU8A 1X1DA 3C43A 5C46F 1BAPA 2E4AA 3R0QA 2BM8A 1G3MA 5DYYA 4TYQA 3R3VA 3AR5A 1OFUA 4QRIA 1QG6A 3HB5X 1XZQA 4S1TA 5FXMA 5TB5A 3ZJ4A 4YRMA 4BQOA 1PFUA 1UOEA 2FPOA 1FNMA 3QQPA 2ODTX 4IVPA 3PXAA 2R8ZA 4HN9A 1RP1A 2OHIA 4FUQA 1DB3A 3IOYA 4R5MA 1YOVA 3A2MA 5DBGA 2AFHA 5JMPA 3ZGVA 3HK2A 1V41E 1ZOOA 1QVRA 1UKEA 1E5TA 4N5IX 3S2SA 5C8YF 2C4UA 1PT8A 2I87A 4HTAA 2BEUB 2DPMA 2AZ4A 5D6OA 4E22A 2Y77A 1C2YA 3DHWC 2DSTA 3KLBA 4BDSA 3RU2A 1IDOA 2M98A 1HKHA 2P2ZA 4U02A 5HQ3B 4BGPA 4G5GA 1R5NA 3BA6A 4NQZA 1ADCA 1QTNA 3E6AA 2WNHA 4JYCA 4P53A 4TL9A 4ETMA 2MOKA 4RTSA 2GS9A 3QU5A 2P8SA 2V8OA 2EC5A 3FUTA 5AW3A 4JP3A 4X1OA 3VPFA 1LBIA 4RKRA 3BFPA 3LX5A 3OICA 3BYZA 4QHTA 3TMYA 2X6QA 1QE5A 2GF0A 4PG7A 1QTIA 4X93A 3ILHA 3OY2A 3L05A 2IX9A 2NO1A 1JFVA 3EIEA 3KE9A 1LF5A 1GPJA 4CF6A 2Q2NA 1NHWA 3U26A 4FFBA 1RI4A 3QXGA 3JALA 1N3BA 1BVUA 1PL7A 1GP2A 1RI1A 2G0TA 1J09A 1RDFA 1D8TA 2ILVA 2VLIA 3AEKB 2HOQA 4OF4A 4PAWA 4ZVOA 5K1ZA 1GRNA 2HCJB 1J0CA 1W25A 1XQWA 1CQIA 3ELUA 3QOWA 4TLMB 1JDJA 1X80A 2D62A 2Z9DA 5EEGA 3V4ZA 1E8NA 3BEOA 4N5DA 4LFCB 5JI3E 4KYVA 3HFGA 3HHEA 2GZAA 2MTBA 3OOEA 3U16A 1Q6YA 5IC5A 3VX3A 4UUPA 3EBPA 3EJWA 4URUR 2GD2A 5BSWA 4GX2A 2I4IA 2QDXA 4QREA 4W9MC 2G25A 2AUNA 4UUBA 1CUZA 3EISA 1U7OA 3ANXA 3GLFB 2PNJA 3QWFA 1PV4A 2J0UA 2Y05A 1XC7A 2VKQA 3CLSD 2XMRA 3Q9SA 3FFTA 2R47A 1QFSA 5CLQA 1R4AA 5FPYA 4CIAA 2OQ2A 4Q1FA 4EW2A 4KBYA 4Q21A 3T7SA 4L8YA 1HFJA 3I8SA 2J0VA 4Z4HA 2MMGA 2TECE 2Y1EA 4LDZA 2VHZA 3K6SB 2WTMA 3I2IA 3PX7A 1ZJWA 4OOFA 3KFVA 2ZRGA 1WDLA 4YP6A 2XLBA 4TQAA 2PZAA 3NI2A 3I53A 3UK6A 4NIMA 3EIXA 4A27A 3ABZA 5AQEA 2YJ6A 4IJVA 4EHJA 4QC2A 4OH7A 3A2KA 2OG1A 3ZU4A 1MB0A 2E48A 3N58A 5KKCA 4UNSA 1KFCB 4BFCA 2F62A 1Q1ZA 3ZCTA 3BHJA 4F8JA 3K9NA 2AD5A 5KNLA 2A3RA 3QWIA 2A5FA 1KDPA 1YBFA 1ZQ1A 3FZEA 5H83A 3VDNB 2NV6A 4UTNA 1WOMA 4ENRA 1ISGA 1PZFA 3AG5A 1P4RA 1Q1BA 3GCXA 5FOTA 2FWAA 2WQZA 3U7QA 1ZIOA 2VL7A 3L4EA 5DHPA 2VSOA 4LQDA 2H92A 1ICEA 2OBLA 3X3HA 1XLTA 2HUPA 3ZK9A 1BW9A 4ACBA 1KQFA 2IU0A 1XJCA 2WWFA 3CV3A 4NYJR 3SKVA 3ZH9B 1TJPB 3OQMA 4K3UA 4OXQA 1QKIA 1K6JA 2XZPA 3HJCA 2ZULA 3I09A 3N6VA 1VYTA 5DN6A 5LZ7A 2A1TS 2C92A 2FR0A 4J75A 2BAGA 4Q4LA 5TT0A 2EFJA 3VTZA 2QAGA 3G49A 3PJGA 3GA7A 1R0LA 2B7LA 3OFND 4JT8A 1L0BA 4PSDA 5LXTB 4YY3B 3RUFA 2C5SA 2OR3A 2QD1A 2HY7A 4LVOA 3NEPX 1U2EA 1PL6A 2CHFA 4E5NA 5G0UA 4U7WA 3LF2A 1H0HA 3LGAA 1IZZA 1JIUA 1EX1A 3ELWA 3F97A 2IYAA 3RFXA 3QF7A 4AZTA 4Y2PA 1OF1A 1XCPA 3GZ4A 4I8DA 3TLMA 3FPGA 3Q10A 4BOYA 2I33A 2XMQA 3RQIA 4YQFA 1Z6XA 1MV8A 1U2DC 1Z06A 3KUXA 1YRLA 4J7AA 4YRDA 4C6HA 5HJ5A 1PJ4A 3IEMA 2F8TA 4WZBB 5C7YA 2VHQA 4UJ3A 1ZIYA 3N8IA 1TF2A 4I50B 4OHUA 3MJEA 1FP4B 3E2IA 3ESBA 2EXXA 1Z2AA 1G20B 1P2UA 1KQNA 3VHXB 3W5BA 1O6ZA 2HSZA 4D81A 1QO0D 2VAWA 4B6PA 4GXNA 1BQEA 4JNGA 3WAKA 1GCAA 2O3QA 2ON6A 3RSZA 1XK7A 5E2AA 4BNKA 1Y0BA 1NULA 1X92A 1MKYA 3VM6A 2O14A 3KKQA 3LX6A 4CDMA 2P79A 1FFHA 2REQA 3CMMA 4NCJA 2CVFA 4C01A 5HW0A 4AYTA 2V55B 3P9YA 2PUFA 1HL3A 3H1FA 2GN2A 4BX8A 1IQRA 1INLA 1YKFA 3P2IA 5JMOA 1AHHA 1U04A 1F3OA 3EZLA 1L8XA 1NRXA 1DCFA 1X15A 1UFRA 1Y8AA 2Q49A 1TT7A 3G13A 2B1QA 3RYCB 2XZTA 2IYPA 4DMHA 3S8YA 1V39A 5AHRA 4WGGA 1JHAA 3ER6A 3WLEA 3F71A 1FSPA 3IDSA 3RVKA 5JNLA 5K6AA 3TVTA 3DMHA 1TADA 4H35A 4QU9A 3WXBA 3M81A 4ZVMA 4D6XA 4DABA 1P1FA 1VGRA 3UCFA 4C7OB 2BBTA 2VRNA 5TXGA 1B74A 4DLUA 4G0XA 4S2UA 5EVCA 4NE7A 1IUKA 2BFOA 3LE8A 2D2FA 4DRXB 3BILA 1C14A 2B36A 4KXMA 5IKEA 1BA2A 1O77A 2PE5A 4MW7A 2FR8A 2RONA 2IWRA 1R6DA 1N6OA 3CA8A 3EEBA 4BAGA 2ABWA 3HCBA 3Q0TA 2EDAA 4KQWA 1G41A 3BMQB 4Q47A 3IEKA 4KP7A 1MENA 1C30A 2JCYA 3HBJA 3KQPA 3ZDRA 5JBIA 1T6YA 5FNVA 2DYKA 2HJGA 1TKCA 1DP4A 1E1CA 5H3LA 3UF0A 1ZGZA 4ARBA 3FUUA 2J3QA 3CVVA 4M0FA 4Q9LA 5L3SB 2Y8EA 2BM1A 1CK4A 3B20A 2Q3LA 2XECA 1NI4B 1YNOA 4MW1A 2DERA 1GV0A 2W71A 3PWZA 1GY8A 4YYZA 3UHPA 1D5WA 4JT9A 2LKCA 1BQ4A 4QNNA 4E32A 1G8KA 1J2RA 4AVYA 3MTDA 3REGA 3EVNA 3NB0A 1JEQA 1N2CB 2CBZA 3I9LA 5EQJB 5T3UA 2D5BA 4AY4A 4CBVA 4IJWA 3ROZA 2F9MA 3NX4A 3MCVA 4DYHA 4JK3A 1YCGA 5EIBC 5HIKA 3E9ZA 3K9GA 1H2AS 2PT9A 2BELA 3NGLA 2PYZA 1TK2A 3NUZA 4H6PA 2ORIA 2PX0A 1COWD 2HJWA 4UULA 1VL8A 3AF6A 4YT5A 4B5KA 4CT4B 4MVJM 3ZVMA 4OTZA 4Y2UA 1KDRA 1CW2B 1P31A 3QEKA 4JASB 4JLUA 3G79A 1ITZA 1R9GA 4ML3A 5LQUA 2VZEA 2H2IA 5BSTA 4YONB 5KTTA 2NP6A 5CFLA 2ONCA 5B6IA 1DDGA 5IC4A 1M1YE 4D1YA 4RHXA 1FL9A 5GV8A 4YRBA 5KMGA 1K6XA 4DA4A 4V0NA 1SXPA 1QGUB 2O05A 2MSKA 3OX4A 1RW4A 3KZ1E 4IIUA 2JGRA 3IQWA 3O21A 1OVGA 3GLIE 4JX9A 4OCZA 1JKFA 1M8GA 1LRKA 2VT6A 4LMRA 5BUSA 1JJVA 4HPXB 1DS6A 4BMPB 1Y8QA 1ZKDA 2PX2A 2EHJA 2FGJA 1DINA 3CUKA 3QLUA 4OPMA 1ENOA 2AOVA 1N5JA 1RYNA 3DBHB 3KSRA 3RVRA 1SHUX 3SXJA 2XTZA 3KTAB 4YBZA 2A2ZA 5E4TA 5JYCA 1WLYA 1B76A 3FOAA 1K5DA 3K2EA 5F12A 2HLHA 3S5JA 3IIIA 3PKJA 5ALRA 1O97D 2YX1A 2Z4RA 2JBAA 2VP4A 3BSFA 4EUKA 1GN9A 4OBBA 4YIKA 5JJIA 2WT4A 3H6KA 1GGFA 2QUZA 3CJRA 4HH4A 3S2YA 1DUIA 1WKCA 2C29D 2CN1A 3DZFA 4WKGA 5EE9A 4LQLA 4C0BA 2Q6KA 3CVWA 4RVGA 3ANTA 3ELYA 4DADA 2Q27A 3IUSA 1HYBA 3D2CA 3K9LA 4TS1A 4UEJA 3C3KA 4HLCA 2GEFA 2RGNA 4HMPA 1T6BY 3TDNA 4CM8A 1IULA 1J99A 1A4XA 5FBRB 1RHQA 3ZIUA 3OO1A 4ZOAA 3VC7A 4Z9BA 2X7JA 4KIUA 5DCYA 1QP8A 3QI7A 1E2QA 2QWXA 1FZQA 4BGIA 2PZBA 4XFDA 1VIAA 4G5HA 4R6XA 3ZDQA 4PLVA 2I55A 2QYOA 5LQJA 5ECDA 2QLBA 3UXMA 1VB3A 3FWZA 4OM8A 4AS2A 4CIYA 5TF0A 2EARA 1FRZA 4RABA 4B4UA 3B3GA 3ER8A 3TJMA 2GF2A 3GUCA 3IUNA 3U39A 3RHTA 3TW6A 4ZQIA 3DEIA 1IWPB 4ZI7F 4MVJP 3OMWA 4WGFA 1U63A 2ZT5A 3FNHA 3ROGA 1E3JA 1DJPA 2D8AA 4P33A 4OHKA 1FCJA 2Z83A 3AKDA 3MINA 4DRYA 4KFRA 3IMFA 2FFJA 4DLKA 4XIJA 2IS1A 5FOSA 3CLSC 2P3LA 1MPXA 4IO0A 4UUNA 5CP8A 4C2UA 2W2VA 3VO2A 1QWSA 4GQIA 5KQPA 4MV6A 4M1QA 3N0TA 4Y2QA 4TV9A 3ONEA 3RC1A 3ICWA 4J43A 2GBPA 1XAGA 2FV8A 1AS3A 1NXVA 3HQ4O 4O1HA 4L07A 4M89A 4R8LA 3ZZ1A 4EB6B 5J2UA 1L7NA 4O02B 1HLFA 4ZEXA 2A88A 3TQCA 3D6MA 4NWIA 5KTPA 4J0CA 1HE5A 3H3JA 1L5SA 1RZVA 3BXXA 3JZFA 1YKGA 4PZYA 3TNDA 4UDOA 4ZEWA 3PF8A 1D7OA 1S9HA 1KHTA 5FUXA 3E82A 4DCMA 2A0FA 4HLDA 4F6RB 1KRHA 1XTPA 2AF4C 2JFGA 4F3TA 1X0VA 1YZLA 4ZV7A 2WZDA 2OCKA 3VGPA 1Y1LA 3KALA 4XCXA 4NZNA 3UUGA 2C99A 4KO3S 4Q3BA 4A8JC 3O9VA 3U7EB 1E5QA 2V9CA 1CZHA 1JIVA 3JQ9A 4N5HX 4A3SA 3HKDB 1XZMA 3OLYA 4Y18A 4K9MA 5DGHA 2WT9A 3W1VA 1CSEE 4BKQA 3OPNA 2OBXA 1RZRD 2VDRB 5JEDA 4BP1A 1XXHA 2NACA 4RTOA 1Z4NA 1RXSA 3J80A 3EVBA 3CNHA 3MGGA 4LVUA 4Z9AA 1GKKA 3OJWA 3TOZA 2WWXA 1AK9A 1RU3A 3FMGA 4JT2A 2WWYA 1BG6A 3WISA 1WDMA 2XQIA 4XGNA 5E9WA 2GJSA 1QH8B 3IAM6 1KDYA 4JY7A 1O87A 5B55A 5G1NA 5JC1A 1VIMA 2X23A 1Z0IA 2O6HA 1ZL2A 2HRBA 3HR8A 3PDIB 1MIOA 4UTVA 2O0JA 2ATEA 2BCJQ 1JQEA 3AFOA 4H4DA 5KCMA 4Q3LA 1ZHFA 3ZV7A 2G77B 3KHSA 1N32B 4JD5A 4PZ0A 2Q5QA 3AIOA 1Q57A 1E4OA 2QPAA 1P7ZA 1PSDA 4MR9B 1LV7A 5EWJA 4AN4A 1AXGA 1W75A 1AMNA 2OOSA 4KRYA 5MN4A 4RMHA 1TVKA 1ETUA 3E84A 3IV9A 3WLJA 10MHA 3I9V1 3UYKA 4KBGA 4XRGA 5AVUA 2OWEA 2DZDA 3WRYC 2FN7A 3JD3A 4XQEA 5KOJB 5AMXA 1CQXA 3KT0A 1SVMA 5IYZA 1ORWA 1VLLA 3H1BA 3Q7QA 2QTBA 3FTDA 2R8YA 3IQDB 3VU8A 4NNPA 4ENSA 4J3JA 2XCLA 2Q5JA 2XAAA 2ZUUA 3RHZA 5AVZA 3I34X 5EMNA 2KW5A 5J4YA 1H2HA 3LC2O 3P71T 4K86A 2C5AA 3ZWOA 4RFSA 9MHTA 1HRKA 4INZA 2ZI9A 2WVHA 4KO1S 4RD0A 3TLAA 4DBLC 1DJOA 2SICE 1BN6A 2PZKA 2CV0A 5G53C 3CZPA 3FE2A 4PY2A 5KWSA 4RJLA 3TLGB 4L8GA 1U3DA 5TQ2B 4OSEA 5ARBA 4G86A 1CPYA 3IQEA 4GI5A 1Q0ZA 3CZ9A 4FQ8A 5KSPA 5FIUA 2VDJA 4Z4GA 2OAP1 2VP6A 4A5OA 4KNYA 1YOBA 1XL1A 1U2RA 2PX4A 4OREX 1Q7GA 1CKEA 5LP6A 3KB1A 1FFDA 2QD5A 4LV8B 2IV7A 3AP3A 1QNFA 2ZR0A 4G4JA 2X9LA 4HQ6A 1W2GA 3D0OA 4CG0A 4F4FA 4WBNA 4DFDA 4B6JA 4DWWA 4F5YA 4EF4A 3TG2A 2IS4A 1KO7A 4HR7A 3WGKA 2QN6A 4MUJA 4MWEA 4QIHA 1K68A 1NVTA 3P4UA 3VOSA 3M6VA 3MCUA 1DFHA 1J0EA 4OHXA 2J3HA 1XDUA 4LI3X 4DMRA 3S5UA 3IPXA 4AKEA 2GYWA 2IHYA 3H17A 4G4SO 3UMVA 3HU1A 3UKDA 1WKVA 4CR7A 3FCEA 4OK3A 1SEVA 4TQ9A 1T2FA 2JS7A 4MO2A 5GP1A 2BFNA 4YDQA 1EZ1A 1DFGA 3BZWA 1SQSA 1EWVA 2VWPA 2ZM6B 5TLSA 3BAFA 4MQEB 4YO8A 2GCNA 5FTJA 3A8TA 2QZSA 2YN2A 1PE0A 2QW8A 4IBOA 3LBNA 1FRQA 4UM9D 4UVGA 3DE1X 3HBFA 2AGVA 4TMZA 2I6FA 3ESRA 4C5CA 4CW7A 3T1VA 4LBWA 4OG2A 3LPCA 1NU8A 1EJ2A 3BS4A 3CKKA 3QEMB 2E82A 1S3SA 4PAOA 2HA2A 4I6EA 4P8RA 1FX0A 5E6UB 3ROXA 5AVQA 1XCOA 3O8CA 2AZXA 3IEIA 3AV3A 4JP8A 4ABTA 4F93B 2ZROA 3NTOA 1ZLXA 4LXHA 4RY2A 3RO7A 1AD2A 1CUSA 2R0QC 1FFAA 1KZ1A 3NBKA 1JFFB 4OQLA 1U7PA 3C5EA 3IEPA 2Z5FA 2DMRA 2HIAA 1J8QA 1UJ4A 3UHOA 4KQGA 4AX4A 5A2GA 1NT2A 3DQQA 3RG8A 2QEQA 3KD2A 1FDWA 3GZJA 3ASVA 1ST2A 2IF0A 2R7AA 4S2EA 1EFPB 3FWPA 3IA2A 4LXIA 1OWPA 1L7OA 4ZAYA 3UAOA 4B3HA 4BO9A 1HTTA 2WIBA 1Q6ZA 1SCIA 2WJYA 3SIWA 3T35A 3DKKA 2FE4A 4L22A 1ULUA 2JLWA 4EG3A 1YVUA 4FZ5A 4BLOA 4OL0A 5SV2A 4B2PA 1IBSA 3TB6A 1N75A 2O8EA 3GNSA 1POXA 1N5IA 2AQHA 3HO8A 3CBQA 4Q4JA 2DT5A 3Q8XB 4QQKA 2Q5CA 4MTCA 2HTFA 2WJVA 3ABOB 4JUIA 4W7IA 5ALTA 1U0EA 2VJKA 2ZTMA 5ALFA 1NOIA 2GTHA 1KH1A 3B5EA 4GI1A 3D8NA 5CYGA 3KBBA 3PNBA 3E1GA 3QVGB 2XD9A 3QV1A 5LBTA 3GLIB 4HF7A 3M34A 2QT1A 5FULA 1VPEA 3UJ7A 2I78A 4TZ0A 3DEAA 1YUMA 1JYEA 3K30A 2OBMA 2WE7A 5D01A 3KB2A 3QVXA 1G17A 4TXHA 1U0LA 1YCFA 1R3UA 2FSVA 1HH4A 3G0CA 3NAGA 3TE7A 4H27A 5HJ2A 4AECA 2O50A 5L3QB 4BVBA 4PYMA 4JBXA 5CA1F 3OKFA 4PC6A 4UAVA 2P9YA 1UJCA 3M5WA 4O8ZA 1DIBA 3COVA 4JAVC 1VP3A 4GKBA 4QYTA 4NBNA 1ULZA 3SHFA 1T8WA 3O0DA 5LWQA 5FD8A 2PUAA 2PZLA 4OU5A 2AC7A 3AZOA 4B2LA 4QFMA 1GG8A 3F7TA 4YRFA 2OO5C 2WZQA 2D0IA 2XIQA 4LXXA 3ZGLA 3OTIA 3M5CA 3U3OA 4R9SA 4I1IA 3I5XA 5JY1A 1JQKA 4H18A 3R7FA 4B87A 1OH5A 1RJDA 1UMBB 4E4YA 1GAQA 4WH0A 1UC8A 1EDOA 2D8MA 5J40A 3ZUPA 2GTPA 4C87A 4DCUA 2RGDA 4PIMA 3IYLW 3ZTYA 1Y7IA 4OYHA 2QD4A 2XUOA 1NJ1A 3S2FA 3INTA 3KTDA 3V4RA 2WHQA 3MAJA 1WNTA 1K0FA 4KMOA 2IH4A 1F38A 4OQEA 1AK1A 1OJ7A 2BPOA 1BNCA 3HDTA 3W8FA 4DMCA 2P90A 3NDJA 2KMLA 2VA9A 4OQMA 4U2GA 4EJ2A 3L82B 1ZCJA 2G4CA 3WJ2A 3AF3A 4KAAA 1PNQA 4KO2S 4C4OA 4JSTA 4MIYA 1U81A 4A6EA 2J7PA 3L6DA 2GASA 4Q9HA 1S89A 4FNOA 4RWZA 3M1IA 1R12A 3FH0A 2ZT7A 2JFNA 1XT6A 2XT9A 4XWOA 4BZZA 4IIYA 4JJFA 4G65A 3TSWA 2QZ9A 2J08A 4L02A 1JB1A 3DNFA 2NO5A 2X3FA 3C4VA 2CNDA 2Y99A 2OB1A 3F5MA 1KDVA 1ZVVA 1NU6A 2R96A 3AI1A 3OF5A 1T4MA 1ZUD1 2BGMA 3SJAA 4L8FA 4HY3A 4LHXA 2D0OB 1SC9A 4XYGA 4R9VA 1SU6A 4NXMB 3H65A 3GLIA 2BEKA 1P33A 2EJBA 1Z7BA 4QJ5A 2Z58A 4IMRA 2BY4A 3VX4A 5EHXA 1P9LA 1XZAA 2R8OA 1HDOA 4GMHA 3V1LA 3V2HA 1R2QA 3AJ9A 3GX1A 3PD7A 2XMGA 4YCCA 2RHRA 5E6RA 3FZGA 3EPPA 2AS0A 2OILA 4D02A 5U4QA 2VNKA 5M29A 1HTWA 2V6JA 3R77A 4UE3S 5EWLB 2GNAA 1JIIA 4BO4A 3KQMA 4AWXA 3LBIA 2JLCA 2VZ9A 1UZAA 1XFAA 2QSZA 1JHVA 2A9VA 2RSLA 4JQOA 1P0CA 3I05A 4JA0A 1PDOA 5JYEA 1OFHA 4CL3A 2EP8A 4U9IS 4RGYA 1F8GA 1E1DA 2C8JA 2YZ7A 1A4IA 1XMXA 1U80A 2QQFA 5FLEX 4F4CA 3U7GA 2WVGA 3ED5A 1CIVA 3PQ6A 4J16C 5P21A 3N0XA 2PLWA 1V37A 4UQOA 3RVOA 4AUNA 1C1XB 4DNQA 4X66B 4HUJA 3DXFA 3JQAD 1CRPA 4NVRA 1N3LA 5ALDA 2UAGA 5H7XA 1DXHA 1H2BA 4E14A 1XV5A 1RQ7A 3NNDA 2JGFA 4JI4B 3IVGA 1TAQA 1BYUA 4JL6A 5C5CA 5DYGA 1XAJA 4E1AA 1YRBA 4KLZA 3E9DA 4N54A 3K2QA 4WKPA 3HKBA 5FJIA 1KO4A 1Y4UA 3NOQA 2AA3A 5LQKA 4ENVA 4O4IA 5T7BA 1U0HC 3RC7A 4S1VA 3E05A 4FFNA 3DG9A 3B12A 2JNWA 5JNVA 1X2BA 2GFQA 2O7SA 1MO3A 1I4EB 3VPCA 1LBTA 3NC0C 4FMCF 4ND1A 3U09A 1QB7A 4CF4A 4GSYA 3QEAZ 3PE3A 2Z1NA 5HE9A 4DSTA 4RPJA 4TMFA 3R5HA 2WA1A 5AIAA 4Q19A 3BXFA 4KUHA 4KLNA 2BHNA 2CNBA 2HA3A 4Q4HB 1R66A 1F48A 2B3DA 2PUHA 3HVKA 1E7MA 4US0R 5AVSA 3Q8KA 1PX2A 1T43A 5I7RA 4R2HA 5DGXA 1Z0AA 3SS7X 3UATA 3WNBA 2MHCA 2PR2A 4A2CA 1BU8A 3C3MA 4QUJA 1NJ5A 2QP3A 1E0JA 5CJPA 4NHOA 2HQSA 2BKXA 4RGBA 4AYXA 4CTMA 1FMFA 1KEEB 2TRSB 3ZCSA 4R1NA 1N3IA 1XO1A 1T6ZA 4FOPA 2RG1A 4NH4A 4UAUA 4EA9A 3LFTA 4ESOA 3IP8A 5GY7A 1H3NA 2WF9A 4BPBA 4IX9A 2O59A 2XUZA 2LV8A 3LUHA 5AW0A 1NYTA 1VPTA 2JGEA 3I45A 1HNZB 3P0RA 3RI3A 4J0KA 1O4VA 4CT5A 1KA9H 1X1TA 3R5TA 1AGPA 4I66A 3THWB 2W37A 3OCZA 1KNQA 1KEZA 3ILSA 3LP8A 3BE6A 4TUYB 1V7QA 4BC0A 8OHMA 3D4BA 4F2GA 2ZJ0A 3ZY4A 1I14A 1CP3A 1YASA 1T3TA 3UM9A 5ED0A 3I12A 1GTRA 1CQWA 1F14A 4JFAA 3UICA 1HG1A 2XMDA 2KJQA 2Q1UA 3K9BA 4MROA 3T9EA 4DR3B 2C3OA 3KWLA 3KKNA 1BX0A 5KC8A 2YZ2A 3RT7A 2IS6A 4C7KA 5DCLA 3I52A 4FBMA 3FD8A 2DFVA 4RS4A 5BMOA 1K3TA 1MC8A 1NVVQ 2JFHA 1ZWKA 1I4DD 1BS2A 3JS5A 4OI2A 5CGQB 5A5EA 4ND8A 5B2EA 1E3QA 4LHVA 1YI8A 3C74A 3A6PC 3URMA 1VDZA 5AXBA 4QUEA 2CMHA 2CLEB 2P9ZA 3AL0C 1TVKB 1M73E 1L7AA 4M0CA 4YUAA 3SWWA 4N0PA 4DUZB 4K46A 3LPLA 3GT3A 4LWZA 2PX8A 1VKZA 1PLLA 5CVCA 4IJSA 1PCXA 3W5CA 5DBHX 2IKSA 4D9NA 1WTAA 1J6UA 3C3EA 2J5RA 1XRQA 2UYOA 3WGQA 4F3CA 2JH9A 4G8DA 4JGBA 4YJ2A 3VPXA 1OVMA 1P7PA 2PKQP 3UGKA 4GNKA 4M9SA 3K15A 1ZK4A 4LXTA 3E1SA 1QGED 4YJGB 1OWLA 1DARA 1C7RA 4NY1A 4TLDA 1MQ9A 2CSUA 2HMAA 2QX7A 2OLEA 2VSNA 1R50A 4YJHB 3L7DA 4IIJB 5JDCA 1U28C 2O52A 3SC6A 2E7ZA 2JVIA 4QU8A 3D8UA 3NIFB 1XXHB 3CISA 1PZNA 3NNSA 1K8XB 3Q1KA 3ZQ4A 2AG5A 1DFIA 1ES9A 3N2ZB 3LUCA 4JXJA 3UK7A 1AG9A 1W2WB 4XR4A 5B36A 1UBKS 1E60A 4M38A 3T1HB 1M2FA 4RHTA 3W0LB 1A4RA 3TGWA 5ECYA 2FJPA 3D3NA 2OM6A 3K73O 5JS6A 4QODA 4EYSA 5AI4A 3FJYA 2Q0XA 2L69A 1YMQA 2ZYUX 2PU7A 3NMUF 4PNHA 4Y9DA 4CFYA 4XYLA 1H1LA 3FROA 1IB6A 1TCUA 2P0YA 4S3MA 4B7XA 4YMVA 3BWYA 5H4HA 3SYNA 3MTIA 4CCYB 3LAWA 2H2WA 3IJEB 3MCWA 4KXFB 3W5IA 1JLSA 4EO4A 4IZOA 2GM9A 5GM1A 5EA2A 3WX0A 3PXXA 3T3NA 4M1KA 1TGVA 4S1OA 5K8VA 2VH2A 3T4PA 4YRIA 1CLEA 3IPYA 1JE0A 3ZY6A 1G5FA 1H65A 4BMYA 1E3DA 1GTG1 3RUPA 2EFEB 4WMLA 2Z1MA 3LCJA 1EDDA 2BEWA 4AS3A 1JVSA 1QHHB 3T38A 4CFSA 3GRVA 2QDKA 4TZTA 1W9MA 1YR3A 3WAJA 4RC9A 5LU9A 3MJDA 3DV9A 4A36A 3F47A 1TFUA 3HL0A 2HDWA 3OJXA 4LCEA 3SE0A 2HCFA 3FUXA 3THYB 2QI9F 2CUNA 2PMBA 1PV2A 2IX3A 5J63A 3EVGA 3PC3A 4V3CA 5AQ1A 3T5TA 2BGRA 3OSUA 5KOHA 3LQ2A 4FWTA 4N6OA 1JKJA 5EIXA 2WD9A 4EO7A 4UBLA 1GN8A 2DKNA 3OQPA 4IKOA 3DH0A 5IJ0A 4G5RA 5HKOA 2NPFA 4KFCA 2HMSA 3V33A 2FFBA 1WVMA 3GMDA 4FFRA 5K09A 3T1TA 2B61A 1E9BA 3Q4GA 3AKYA 4HBZA 3UB4A 3PICA 4JWTA 3EMBA 1CUIA 3RK1A 3B9RA 1QANA 2TMKA 1M0WA 3I5YA 4Y9UA 1KYXA 2TSYB 3PDIA 2I4MA 2JJMA 1KYWA 2MR6A 3PC8A 4UKDA 4HNAB 2W70A 1USIA 3A6FA 4IFIA 5F2OA 3AG6A 4NMLA 3VDXA 2W83A 3VR4A 3NXSA 1UMDA 2ZVQX 2XD4A 2O4UX 3CM0A 2HO4A 3HDJA 3LT0A 3NORA 4NI5A 3A9WA 2O0LA 3SP1A 3EVEA 5IFKA 2O7RA 4QQNA 1G8GA 4LOLA 4FZRA 1ATZA 5CCXA 3NTVA 2X2PA 1VJRA 3DE5X 4QYXA 1CY4A 1E58A 2D1YA 1HORA 2V8BA 4F85A 3C16C 5C5DA 1T24A 1VE7A 2HRQA 1K63A 3DLBA 5I3ZA 2O8DB 1XNJA 2QG6A 5DI3B 1ILEA 3FFWA 2XGMA 1ZNQO 3QPBA 5F7ZA 3O8RA 2QNBA 1T0BA 5C18A 3D43A 4Y2VA 4R16A 3FGPA 4XPIA 1ZC3A 4HVLA 1ZMXA 2VHYA 1JB9A 3AHIA 1VXOA 3CUTA 4KKXB 4XPZA 2PMEA 3FIJA 4LRQA 3RU9A 3UWKA 4CKCB 1QRSA 1N4AA 5BUQA 4KG7A 4DB2A 2JEOA 3M33A 2OK8A 1IIBA 4F8EA 3LD9A 3B6EA 1CYEA 4NU8X 2V9PA 1V5IA 2RGRA 4I08A 1PJRA 4QZVA 3HKEB 4U6SA 3SLGA 1B93A 2E4ZA 2CD7A 2RK4A 4ON9A 4J0GA 1Z25A 2RI0A 3A3KA 4XPIB 5ARDA 2WQ6A 5AFSA 1AB6A 2HLPA 2RB5A 4C7MA 2Q9BA 1M5UA 1QK4A 2CZCA 2WU0A 3DBRA 1LBQA 3QK7A 3TIXB 4D6YA 2QIOA 2R5FA 3LT2A 1M0EA 5LSAA 1T2NA 1DTWB 5KWIA 3Q88A 2OO5A 3CN7A 5ARCA 4LI0A 2DAPA 3W2IA 4MR8B 3HABA 3PUVA 1IOLA 1K75A 2P4EA 3H5WA 3KP1A 3DAFA 4IDNA 3JVIA 4G9EA 4HWKA 4C3ZA 1XI2A 2NVWA 3DP9A 4GSKA 4L6AA 1NBEA 2BRUA 4HGRA 4OB8A 5AKKA 1K8QA 3F5FA 4MITA 4UTZA 5F1PA 4BLTA 1LPOA 1QH1A 4RVNA 2OV8A 4QTYA 1R0YA 2VN8A 3FA2A 3RVPA 4I1PA 3L4BC 2WDPA 3CRVA 2XTJA 1RADA 3HCPA 2W6ZA 3PE4A 4G0NA 5T4FA 4A10A 2ASVA 1SPBS 2J3LA 1ARZA 1L4GA 3CWQA 4TX1A 4NS1A 3RUCA 3QPUA 2I7DA 2Y93A 5IKMA 4PGMA 4B48A 4KJZA 5CB4A 3WICA 4V24A 1JA0A 2B99A 5KVCA 4W5RA 1Y4AE 1LK0A 2CXQA 1T9ZA 1JG2A 3OVMA 4GOOD 4MV9A 3SZUA 3ZBPA 3OHSX 4E70A 5DLPA 5A5GA 2HSGA 1W85A 1JBQA 1L5QA 3FJOA 4P58A 3C3CA 2QJTA 3CZ5A 1WBBA 1JV2B 3AEUA 4NMXB 4MI6A 3CCBA 2YBEA 3GDHA 4E3ZA 3OJFA 5KUTA 5ILGA 5LDGA 1W34A 1TPYA 3EQ6A 1E4VA 1LJ8A 4J91A 2OGWA 1MP0A 3GJ5A 2IV2X 4MQUA 4WOCA 3KKOA 2ZIFA 3BCSA 3FCOA 3NWEA 3QH4A 3W5DA 1C9EA 1X1RA 1G7CA 5C8XA 1UBGA 3W2HA 3W9BA 1WL8A 4P34A 2ZI5A 4XGRA 2VFAA 3MVEA 5EIOA 2FSVC 3KTAA 3U37A 1U8CB 2GZ2A 3O92A 4JP1A 3R74A 1Z47A 4QWWA 1SHJA 4EEXA 1NX9A 1O9GA 1V43A 4J3NA 3MYRA 1DRJA 2BBSA 1GFIA 4Q48A 3O1IC 4XIGS 2HIMA 1J49A 1C3OA 2GKGA 3SIPA 3TTWA 3WIEA 5LZ8A 2HRZA 4R81A 3NCTA 1KO5A 2E1RA 1TKAA 1MXFA 3JQ7B 5DMXA 5DYIA 3Q7IA 2CFTA 4R05A 4HDQB 1AQYA 4H4EA 5EHIA 1XX6A 1NUSA 3FY4A 4JI6B 2ZZNA 2POCA 2YJ4A 1JU4A 3WQRA 2O5CA 2XW6A 1FS5A 2NSYA 5KSYA 4F7DA 4M9UA 3T1YB 1G5HA 1RWBA 4G23A 4Z7NB 2ZYSA 5HKBA 4HQOA 1TYBE 2EFGA 1N6RA 1OAKA 4K9RA 2X0NA 2ZUTA 3HR7A 3I37X 3CX8A 5G41A 3WGGA 1S2GA 3HBAA 4GXQA 4IDPA 2XXAA 4YFYA 1APBA 1PFYA 1L7XA 2HEIA 4MWDA 1W94A 1JG4A 2H8KA 4E03A 4KV7A 1CVIA 4JDPA 4OGWA 3EGVA 3H16A 1G6Q1 1PWXA 1WOYA 5A4JA 2H4JA 2NSDA 1IAVA 3K0BA 3TR5A 4TSFD 4JYBA 3WBKA 4QUAA 2JCSA 3CH5A 3HZOA 3OOJA 1Y48E 1WABA 4HTFB 2J5XA 1I2BA 1PEYA 1JEJA 4HN2A 4P9NA 4BP3A 1XPUA 3HP1A 4Y2RA 5CLGA 1JQDA 3LT4A 4N3AA 3HJFA 1PKEA 2RGEA 4I50A 1RAAA 1KJWA 4UHCA 5HGJA 2J9GA 2P91A 3M89A 4RFLA 5KYYB 3K16A 1MVOA 1MAVA 1IWOA 1Y6ZA 4WTOA 1AMUA 4LJAA 2OESA 3E3OA 3GEHA 4X95A 2X1HA 4ZODA 1I3CA 1WBJB 2C7VA 3M4YA 2WSMA 1XZLA 2NU9A 3V4VB 1QV6A 1VSTA 3UJCA 1U3UA 1FDIA 3FNGA 1NLUA 2D74A 1UXIA 2JKVA 3FX2A 4FYVA 2XMCA 3DKVA 3JQDA 3MNFA 5DVZA 3U3RA 1M2VB 3TPCA 1TQ2A 1K7XB 4YHHB 2XB8A 1CJMA 1JPUA 2XWJI 3AZQA 3DHVA 3R6TA 4Y2YA 7AT1A 4P4SB 4Q7MB 5B4VA 2QY9A 2PUVA 4R6WA 4D98A 1Z9BA 2Q0HA 4LDQA 3VO9A 1BDIA 1JAYA 2O0HA 2YXBA 4OD0A 2G0NA 5LZ2A 3CX4A 1DCMA 1Q7CA 1T9KA 2O2EA 3AL3A 1ZRHA 3PX3A 5ALLA 3OBIA 1GTMA 1ENYA 3A6KA 4F4UA 1T0IA 3TSOA 1NDQA 1NN0A 3RROA 4Z7QB 4J1GA 4PSKA 1RKBA 1CQPA 2H57A 4NSNA 1F0KA 4JOSA 4KAJA 1NXTA 3G9ZA 4ZMSA 5IT4A 1A8PA 1DAPA 1EK5A 2YOGA 1MOQA 4G2TA 3T34A 5JEEA 1LKZA 4F4IA 2WJHA 2WP8J 3OIDA 4L9SA 3GEMA 3GLGB 1DCKA 2BIFA 3A9TA 3L9XA 4RH0A 3TD6A 2W42A 3WYAA 2VHVA 3NBXX 3UO8B 3K71B 4QM6A 3U44A 5KQRA 2Q3HA 1CFJA 4P4UA 2RGYA 3I04A 1C1DA 3CE6A 3NJ4A 2LCIA 2C54A 3QIAA 2XGGA 4MKIA 1RMQA 4MCAA 1R0RE 2C98A 2YS7A 4U2FA 5E3HA 1D4ZA 3JU3A 2X5XA 5EKUA 5BNTA 1GEGA 3N6XA 4UTPA 1JZSA <