2RGGA

Crystal structure of h-rasq61i-gppnhp, trigonal crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
159
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Transformation Efficiency of RasQ61 Mutants Linked to Structural Features of the Switch Regions in the Presence of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein
total genus 59
structure length 159
sequence length 166
ec nomenclature
pdb deposition date 2007-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2rggA00
2VBCA 3EC2A 1OLOA 2D06A 4KFTA 2H8KA 2XZLA 2ZJ2A 4Z54A 1OPXA 5EP1A 2WMOB 4P32A 2ZE5A 4DBLC 2DY1A 3B1VA 3H84A 1G4AE 1M74A 3PIRA 1J70A 3SN6A 1CJVC 2PEYA 2VSXA 1ZM2A 2NZJA 1IOZA 1A5TA 3T35A 4JYBA 2WOJA 5JHHB 3U6KA 3P32A 4HAXA 3FMOB 5JS8A 2ZR9A 2QPOA 3MWLA 1MKYA 3CX7A 2ZYVX 4X8OA 2F1RA 2W58A 3R7WB 3EWAA 1MH1A 1KJWA 3OEEA 4H9GA 1ONBA 4PSKA 4A4DA 1E1QA 2JEOA 2Z4SA 1CULC 1KI1A 1GDDA 4Q7JB 2IF2A 5FOWA 4B3FX 1KO5A 1XMSA 3MD0A 3NIBA 4NCKA 4JVLA 1G6OA 2ONKA 4FMCF 3FFAA 4DHEA 3QJYA 3MSXA 4Q1FA 3L0IB 4Q4AA 5HKKD 2EYUA 3SU8A 1RE0A 4OL0A 2GJ8A 5KPJA 2J0UB 1T3SA 3IUYA 1GSIA 1WRBA 4PZZA 3ZVRA 3BRWD 1VCIA 1SVOA 4ESVA 3GLHE 1G3MA 5JSZA 2WKRA 2HV8A 3B5JA 4C7OA 3FKSA 4FN5A 221PA 3VFDA 4EFNA 5KDDA 3NDBB 3LNCA 3REFA 4POAA 4Y0VA 4M1TA 2YNMA 4HI0E 1IY0A 3GEHA 3N5CA 4NCNA 4CEJA 1N6IA 4QBGB 1ZIOA 1NN0A 3A1SA 2ZI7A 1UEIA 1OIWA 3FHCB 3Q9LA 4JBXA 4MH0R 3TSOA 4B73A 1COWA 2ZSAA 1OE0A 1X1SA 1Z08A 4M1YA 4GDFA 4QM6A 2P5SA 3TAUA 4BGDA 2FFHA 2W6JD 1AS0A 2FNAA 3KKQA 1E0SA 3HU3A 4LHYA 3ND8A 3RLFA 2BMJA 2WWGA 1GUAA 3ZVLA 3O8CA 3MG9A 3HPRA 3EZ2A 1OH7A 1XMVA 4B48A 4N1AA 2RH5A 4HUQB 1KDOA 5DYGA 4XWAA 4B74A 4IDNA 5FOVA 2RHDA 4IKEA 4LJ4A 2BIFA 5C18A 3GQBA 1UAAA 5JEDA 4C2TA 1BO6A 4JS0A 3KXLA 2JIZA 1QZXA 3GLGB 1E79A 3EX7C 4OYHA 1Y63A 2VSFA 2B7BA 2J7KA 4P31A 4KHZA 3A4LA 821PA 3G0HA 1XTRA 1PLKA 3OF5A 1II9A 5EE1A 1VG0B 3OHMA 3OIUA 2QP9X 1E9AA 2IUTA 4B75A 1Z3IX 2V7QA 4F4IA 1GL9B 4DCNA 4GT1A 2G0TA 3AVQA 2NGRA 3TR5A 3WMEA 5IK2A 3ZIAA 1ZM4A 3C16C 5AJXA 1OHHA 1SXJB 2CLSA 2F43A 4A15A 1Z0IA 4MGYR 3AKEA 2WSSD 1E96A 2WM9B 2VIIA 1DG1G 4IHQA 4HB4A 4HZUB 1G3UA 1DAMA 3Q5DA 4QHYA 1UBGA 4B35A 2KBEA 5F9FA 2J9RA 4KI0A 3X1WA 4D82A 2GF0A 1II8A 2IHBA 1SKQA 3LXRA 3I5YA 1EFRA 1CU1A 2DPXA 2R6AA 5KSYA 3TUZC 4FCVA 2FZLA 3T1VA 2C96A 1NVVR 1P2TA 4BWYA 1XTJA 1U8AA 4MGKR 4P33A 3K09A 4AURA 1P9WA 2OHFA 5G3ZA 1NLYA 4R9UC 1VG1A 1Z8FA 1XTKA 2ODEA 2VEDA 4NYMR 1XJCA 2IBMA 2QPTA 3K70D 4OHVA 4OHZA 1ZP6A 3K70C 1S1MA 1T91A 2V8OA 1XTQA 1OF1A 2NTYC 3GLHB 1N3BA 1G9XA 3THXA 2IWRA 3A4MA 4B33A 4GBMA 1RJ9A 1KSJA 1YZGA 2IYTA 2QTVB 4OJKA 5C46F 3SJCA 4X8MA 1JR3A 1SVWA 4PR0A 2HF9A 4EPXA 3M6AA 4HATA 1WDTA 2GCOB 1E98A 1G17A 3LAWA 3ZS8A 4A36A 4Q1CA 2E1RA 1DARA 1HYQA 1NIPA 1Z47A 2RCNA 5EP2A 2KB0A 2QT1A 3TKLA 5KHOC 3GD7A 2GETA 1AKYA 1MV5A 2XJ4A 5AWFC 4DLYA 1E1QD 2F9MA 2GAOA 2QQEA 4IVRA 3W5IA 3KQHA 2GK7A 4ZI3A 2ZPTX 2FV8A 1EX7A 1G5TA 1X3SA 1XJQA 5E3HA 4HDOB 5IRCD 5K8IA 1ZJ6A 2XEXA 5AK0A 2IYUA 2WKQA 2QMEA 4DUGA 4JJKA 1SVSA 1Z83A 4Q4LA 4C2UA 3WXMA 2YWEA 3B1YA 1J90A 3QF4A 2XNSA 1AS3A 1W4AA 2QAJA 1XD2B 2LCFA 1XXHA 1ZMXA 2PMKA 1GM5A 2BEKA 3EXAA 2R65A 5E4FA 1R10A 2O8BA 1D6JA 1GFIA 3LFUA 4DKXA 2A7QA 5AUNB 1G41A 1RIFA 3QPVA 4WA7A 1WA5A 2QZ4A 3W8RA 2ZI9A 5JRZA 1KDRA 3E70C 1XF9A 4LJ9A 4TLCA 5GJCA 1N5KA 3UIEA 2R6GA 4A0RA 4PPNA 4Q9JA 4DLUA 5FFMA 4MYTA 1Q57A 4LYAA 1E2EA 4MDEA 5J5CA 1RKBA 4JVNA 1E9RA 1W5SA 1OH6A 1BIFA 1FMLA 2RHMA 1E2QA 4LBVA 3K9LA 1G1MA 4ITRC 1G8HA 4PHHA 4DT1A 4V0KA 1E2HA 1GWNA 3I72A 3LBHA 4MKHA 1IY2A 2NO0A 4P4SA 4YMWA 1VIYA 4EKDA 1JI0A 4AKGA 4Q19A 5BN5A 1CEEA 2VYFA 5EXTA 1D5CA 5AJWA 3AB3A 2WJIA 1GRQA 2W6IA 1FOEB 2GKSA 4XVQA 1ZU4A 3BC1A 1TAGA 1JQLB 2ANCA 2WVJA 4KVAA 2FWRA 1T3HA 3M1IA 3VR4A 1KI9A 2Q0HA 2ZJBA 1F3OA 3SQWA 521PA 2D7CA 4HLUA 4D0NA 2R9VA 3CW2A 1WQ1R 1A82A 2R6DA 3RS7A 3IGFA 3WHKA 1LB1B 1IN5A 3RVBA 2F3TA 5TVKA 5TB5A 1CKEA 1DPFA 3TSZA 2XXAB 5JI3E 4DB4A 2ZRGA 1AGRA 1P2UA 2ZVQX 3CZQA 1VECA 5BYJA 4D81A 3TGPA 2WJGA 4KJZA 3A1TA 5AJZA 1W36B 3LQRA 4TYWA 2QL6A 1I4TD 2PZFA 3BB3A 3CF0A 1EFUA 1RRPA 2RGCA 5FTNA 4ASUA 1TEVA 2CLDX 3L0PA 3TAHA 3DMNA 2GXQA 2WKPA 1GG2A 2J5XA 5CITA 4F4JA 3K9HA 3BJIC 4BECA 2O5VA 3MRSA 5CDFE 5FPKA 3THWA 4EJSA 3ZVNA 2N42A 1KGDA 4NYJR 2B8WA 1G64A 1KJYA 1G8YA 2OCAA 1X1RA 3R8CA 3FDIA 5EQTA 3T12A 2PT7A 1VPLA 2V3CC 1KMHB 2VLIA 2ZR7A 1IJFA 3TUJC 4PAOA 3EPKA 1HT1E 2GBLA 2WWXA 1TQDA 1WP9A 3CR7A 4MGIR 2LKDA 1UF9A 3QNUA 1IBRA 5DI3A 2P6RA 1PVOA 1M34E 1SVMA 2QE7A 4MRVA 3WP0A 4U7DA 3IO3A 1YR8A 3VX3A 3TW4A 4EPRA 2FPKA 1PV4A 1TADA 4BQSA 4HUTA 4MRSA 1JEEA 4TYNA 2BCGY 2ZI4A 4I1SA 1XB2A 4DXAA 5F3WB 4YC7A 2IC5A 2QT0A 2RGXA 1OT3A 5K8TA 2DHRA 4CRWB 2IS2A 2G1KA 2I1VB 1DELA 4WW0A 1F2TA 3KKNA 4JMPA 3PQCA 2WJVA 2J45A 1L4UA 2RGNA 1OKKA 1IM2A 1GNPA 1G7CA 1R0ZA 5DHAA 1D9XA 1Z2CA 1U90A 4M1KA 3SC3A 1KKLA 2B21A 5GJWC 4DCTA 4MYHA 4M9QA 1YJ5A 3IILA 4OHWA 4A92A 4LJ7A 4LJAA 3CX6A 1XEFA 3NEJA 2CVHA 4LBWA 3GEEA 4HAZA 1TQ2A 2H18A 4PANA 4TLDA 2CCGA 1RW4A 2QTHA 3VU9B 1OFIA 1W4BA 3L82B 2ONJA 1TTTA 1KMQA 1FTSA 4DCSA 2WWFA 4RCYA 1Z6YA 3ADDA 2G0NA 2N1BA 2NIPA 1JALA 4BFSA 3C5HA 5SZHB 4F92B 1OIVA 3MCAA 2AK3A 1W36D 5HZHA 3W90A 1FQKA 2C78A 2OCBA 4XH9B 4ACAA 6Q21A 1P4SA 1WCV1 1G7TA 2KWIA 2O0JA 3HYRA 1QBKC 4CDGA 3QSYA 4GRAA 4US0R 3HPQA 4TSFA 1KO4A 5FH9A 1FQJA 4MUAA 2DWPA 4B2IA 3NG1A 2ZJAA 3CPJB 1OXXK 1EWRA 2R8RA 1S9DA 4UQOA 2WHXA 4NYIR 3KUCA 1YR7A 2ZE6A 4HEJA 2YWGA 4F91B 2I4IA 3NH9A 2ZU6A 5D3MA 1EFTA 1RJ9B 2RKOA 2IYRA 2UZ3A 2ZRDA 1W5TA 5CJ2A 2NMVA 4Q9IA 4V03A 2FPLA 1N2CE 4IOJA 1YRBA 2QP4A 2ZS8A 3TBKA 1F2TB 4B6FA 4DLZA 3PCRB 1EK0A 4JLNA 1US8B 5EZ6B 3QXXA 4D26A 4GPTA 2Q9CA 1JBKA 5HR5A 1OYWA 1F2UB 3OIVA 4BFZA 3SBDA 2O8CA 5B30A 5DGXA 2B92A 1UPTA 2QSZA 3GJ8A 3OESA 1G291 4V0OA 1GKUB 1U9IC 4TQ9A 3VHXA 2IF0A 1T0JB 4LSGA 4MDFA 1S8FA 1AN0A 4FMDB 3W6NA 3NHBA 2XSZD 1ODFA 2IT1A 2XOKD 4YLGA 4LBZA 1XXHB 4Q01A 3KJIA 2PBRA 1EWQA 3A8TA 2IYQA 3LV8A 3BORA 1NJFA 3VTKA 4QKQA 4IXMA 5E7IA 3HP1A 3WNCA 3W6OA 1TQ4A 1G4UR 1NG1A 1QRAA 4TL9A 3QVUA 2ASEA 3MGCA 2FPMA 1K5DA 1NRJB 4LUCA 5KNCA 4ZO4A 2IK8A 4QJ4A 2YVUA 3UG7A 2FA9A 3BK7A 4EIWA 1DAFA 1NF3A 1VG8A 2E87A 2GZHA 2CL6X 2WWIA 3HR8A 2OUKA 3IIJA 3VKHA 1GKYA 2ZRKA 5LBIA 5HKKA 2QE7D 3UWKA 3QBTA 1YVDA 3U60B 5ANRB 3U6BA 4W9MC 3ZH9B 3AKDA 4TTRA 1KSGA 3IPXA 5EUQB 1UKZA 4TYYA 2GK6A 3IEVA 2ZIAA 3UMFA 2IYSA 2J0VA 2GHIA 1T8TA 2RGNC 3KJEA 1G7SA 3KUDA 4US1R 1ZUHA 4D2IA 2OAQ1 3NEYA 3OAAA 4TL8A 2P65A 3MLEA 2F7SA 1N0WA 4AY2A 1JECA 1FTNA 2GAAA 4E22A 3QY0A 1NP6A 1XRJA 3UMRA 5FBRB 3PUYA 1E94E 3AGPA 3GJXC 1NI3A 4KAXA 3MMPA 3CRMA 3AUYA 4AYWA 3LBNA 3PENA 2VL7A 5L3VA 3LRPA 3V00A 2ZUBA 2X2EA 2GCNA 2O52A 2PLFA 4HB0A 4TLAA 3ADKA 5JHGB 3SYLA 3WYAA 4FXPA 3L8ZA 4LY6A 1J99A 3GMTA 3WBJA 3O8DA 1UKYA 3EZ6A 4JZKA 1M1YE 4LJ8A 2VQSA 1EG7A 4DCVA 2X2FA 3E5HA 4ASUD 4Q4AB 1NBMA 1E2IA 3CH4B 2H16A 3B9PA 4WXPA 3VR6A 4L9WA 4DSOA 3GJ5A 1E69A 2O0KA 5L3RA 4DRZA 4DC9A 4JJZA 4HAYA 4LJ5A 1PJRA 2D3WA 3WNDA 2JGNA 3ZZ0A 4Q47A 1SKYE 4LC0A 2KE5A 2O8DB 3FTQA 3B60A 3OIYA 4O2RA 4WVFA 1SQ5A 1W47A 1M7GA 4URWR 3CIOA 3H0KA 3RWMB 5FPTA 3RRZA 3TIFA 2QUZA 1NMYA 3PUXA 1JXMA 4L8GA 1KI3A 5CYPA 1VYUA 2O8EA 2FH5B 1DBSA 3ADCA 5IHPA 1IN7A 3FMIA 3FMPB 3NXSA 4A0GA 2UKDA 1JPNA 1ZD1A 5CDFA 4ZI2A 1CJMA 3U3OA 1KI4A 4YMUA 4UKDA 3R9IA 3DO6A 3LX8A 4JVSB 2ZRJA 5J4LA 1E9BA 4Q4HB 1GNQA 2Q3FA 3QKRB 5DE3A 1YQTA 5HZKA 2ZXUA 1PUIA 4PQRA 4D0LB 1MABA 1P62B 5G53C 4V0MA 2BKEA 1P75A 1PUJA 4GZLA 5EE0A 4XTCS 3AVOA 5FUXA 3GFTA 4NYMQ 4QOSA 2WSMA 4O0MA 1KZ7B 4QGHA 3HJNA 5KDLA 1DTSA 3EC1A 2EVWX 4TZ6A 1LFDB 5LPNA 4ZCMA 2MMCA 3CX8A 2A5FA 1F5NA 4TMXA 1JNYA 1XP8A 1E2PA 1TF2A 2HEIA 2X77A 2VP0A 5SZJA 2RGAA 4DLXA 5CIWA 2ZAOA 2ZRCA 2SHKA 1NSTA 1I4LD 3PVSA 4A6XA 1LTQA 721PA 2ZUCA 1LW7A 2ZI3A 2JAQA 2ZITA 2WIAA 1BYIA 1XX6A 1HTWA 2C99A 1TMKA 3UMSA 2PX0A 1N5IA 2YJTD 2IXGA 4G5QA 2ZRNA 2NPIA 1XCGB 2RB4A 3WP1B 5CJPA 3K09C 3PITA 4XWKA 4I1OA 5F98A 2AN9A 1TL7C 2NPFA 3QIAA 4A8JC 1Z07A 1E1RD 3X1DA 1KY3A 3PR1A 1E9FA 1GKIA 4PPGA 4QGAA 3VNUA 1G8GA 2A5JA 4FCWA 2QA5A 2CCKA 3THOA 4W5WA 5H70A 5B58C 4Q00A 4LYJA 4PPQA 4PX9A 3I92A 3W8NA 3X1XA 3TLXA 1SXJA 4G5SA 3FFBA 2W00A 3FMFA 2EYQA 1TUEA 2J87A 2BBOA 2QEQA 4GOXA 1C9KA 1TF5A 4YDSA 1E3MA 4NP6A 3GJ6A 4V0NA 4JLAA 5ELXA 5KSPA 1AKEA 4Q18A 3QQ5A 4IXNA 2J59A 4PC7A 5J4HA 4I1VA 1NN5A 3B9QA 1KNQA 2Z4RA 1RC8A 2OFOA 2ZJ5A 1Z0JA 1JR6A 1CRQA 2IWHA 1ZNWA 2VP2A 4PC2A 5HTKA 1KK3A 2QAGC 2J0QA 1XJ0A 3TVDA 2BOVA 4NYIQ 3AVUA 4OQFA 4OKSA 3CPHA 4KLZA 2BMFA 2ZI5A 4IDHA 3ASZA 4L5BA 1SXJC 3GLFA 3OE7D 3EZFA 1Q1ZA 3F3YA 2DYKA 3ASYA 3LXXA 1GOTA 4ZDWA 3AVVA 2Y8EA 2OBNA 3JVUA 5J4KA 1WMSA 4HLUC 4N0DA 3CONA 1KK2A 4GI7A 1ZCBA 3T1TA 2AKAB 3MWYW 1AM4D 4AG5A 1ZC3A 2JJ8A 4IW3B 1YR9A 2ZQ5A 1N6OA 1G5PA 3DPUA 1NMZA 1QHYA 1NJGA 4R98A 4AIIA 2AX4A 1Q21A 3RABA 1LS6A 3GLGE 1A7JA 3W6PA 1H65A 2KSQA 4EPYA 3D3QA 4Q02A 4JL5A 4XJXA 3THWB 1FFHA 3JZAA 4PFSA 1N25A 3I8XA 1OXUA 1TQ6A 5AJYA 4D4MA 4M1OA 3AVTA 1RRGA 1FP6A 3RHFA 4DIDA 5C1BA 1NKTA 3BB4A 1YKSA 5DN6A 3REGA 1HE8B 3VHLB 4DWJA 1WF3A 3GJ7A 5E7JA 2AXNA 4FIDA 5CB8A 4DLVA 2ERXA 2FX3A 3N2EA 3TMKA 1KK0A 2XTZA 1D2NA 2PEZA 3VAAA 2FF7A 4BZXA 3AM1A 5JCZA 5JRJA 3RS2A 3AQ4A 2VHCA 3QF4B 4KVGA 4MKGA 5L3QB 4MRRA 1E2MA 3NH6A 3UWOA 1JAHA 4F93B 4IOLA 5AUQA 1GP2A 3W3ZB 3OAAD 3UKDA 2EQBA 4B43A 1QF9A 2OT3B 5KPDA 3GLGA 5J4YA 4Q7MB 3IO5A 2OLKA 4BFVA 4E5UA 2C95A 2HXSA 1TUIA 2ZAMA 3QXCA 1VKJA 3QPUA 4M8NE 4B2PA 4YMVA 2XX3A 1G8PA 1L7VC 5GJBA 1G8FA 3AP1A 4PC3A 4PXAA 1LF5A 2ZYUX 3GLIA 3A1WA 2HXYA 1CJUC 5FBQB 1KO1A 4JLVA 1NN3A 2P3SA 1H8HD 1N6RA 1VG9B 4OQXA 2QPAA 4IJMA 4DJTA 4JLOA 3LW8A 3CRVA 3QKTA 2QN6A 3DOFA 1KI6B 2DFKB 1GAJA 1W0JD 2G1JA 2F6RA 4HB3A 1P2SA 2QQ0A 2ATXA 2FEMA 3KQNA 3B1WA 3CWZA 4O25A 2H5EA 2BMDA 4XVRA 1Q3HA 4C0AC 5C2JB 2ZRBA 5FL7A 2A30A 1BYUA 4Q9LA 4AKHA 4GMDA 1QG4A 1DO0A 4CIDA 3S1AB 4E09A 2JLSA 1VHTA 1XTSA 2IXEA 1OSNA 4HZUA 5LB2A 2D62A 1E0KA 1W4CA 2YYZA 3FWYA 4RY2A 3D7MA 1E2KA 1T9HA 4HZIA 3CUEF 4PQYA 1I2DA 4WIAA 1IN8A 2ZROA 1YZLA 1XZPA 4QXAA 4D0GA 5FBVB 4JLKA 5HE8A 1VCNA 3RAPR 4P0TA 3RRNA 4URUR 5A4JA 1PZNA 2IL1A 2IYVA 2ZVPX 1AZTA 1TX4B 2AD5A 3B85A 4JSTA 2A2ZA 5TXGA 1S0UA 4CGZA 1X8JA 4BLOA 3QKRA 3SE0A 4MGZR 1M7HA 3H2YA 3GPLA 1VYTA 4B34A 1Q1EA 1CJKC 5GVRA 5KSZA 3IHWA 3IPYA 5KTYA 3BFKA 4B76A 4C0KA 2CLCX 2ZRAA 1TU4A 4TWZA 2HT6A 3GJ4A 3KQUA 1E9EA 1KAOA 1FNMA 3KFXA 5KO2A 5KOYA 4Z51A 3HU1A 4C7OB 3I1FA 1W49A 2CHQA 4PHTA 4LHZA 3W3AA 3ZGXA 4A2WA 1OXSC 3NDPA 3FE2A 2YHSA 5FI0B 4UJ5A 4QHTA 5TV2A 4TMKA 3R9WA 2FGKA 1DAHA 4YMSA 4G5OA 3ZS9A 1MT0A 2X8AA 4TL6A 5FOXA 1HH4A 2FZ4A 1SZPA 3A4NA 4LX0A 1CR1A 3U61B 2WJYA 4JLPA 2VF7A 3RS0A 2XB2A 3AVWA 2AD1A 4KLNA 2HCBA 1XDBA 1UADA 1CTQA 2FSHA 2VHUA 2WAXA 1QG2A 3T1OA 1ZNYA 1FZQA 2Z0MA 2R6FA 4LV5B 1G19A 1KK1A 3A6PC 2R62A 4RCZA 3I5XA 1E2DA 5BQ5A 1NY6A 2WIBA 4S35A 4JIMA 3ND9A 4H1VA 5FOTA 2QMUA 2D74A 1D8TA 1W1WA 4TMTA 1E4VA 4NMMA 3EWSA 3AP3A 3RSLA 1G3RA 1JB1A 1X8LA 3AH8A 4ZKEA 3ZVMA 5H68A 2BDTA 3WYGA 3ZZUA 4JSYA 2VHTA 4URVR 3N2IA 3KZ1E 3V9PA 5JCPA 5SZIA 4PQFA 1Z0AA 3VKGA 3ZQ6A 2QRNA 1XBTA 3HWSA 4QRHA 4CZ2A 3MJHA 4Q48A 2WSSA 1HA3A 3D31A 5TDHA 3DVLA 4QFMA 1NMXA 2RAPA 1ZM3A 4A8JA 1U9IA 3SHWA 3LVRE 1RVDA 4MQBA 2O8CB 2P2LA 2GZDA 2FJUA 4TYQA 1W0KD 1ZNXA 2ZJ8A 1ZYUA 3K8YA 1P3JA 3JVVA 1S1CA 2OCPA 1G18A 4Q9HA 4CEIA 3RS4A 3T15A 2QBYA 5DISB 1AJEA 3EIEA 3TH5A 3W5JA 2JLWA 3LQQA 5FOSA 3T06B 2AR7A 1IY1A 3ECCA 2LWIA 3TE6A 4OBEA 1Y3AA 2IS1A 5CLQA 2IUUA 1TU3A 4GMXA 3K70B 1MRSA 5F2EA 3I3SR 1Z6AA 1G16A 2GCOA 3BH7A 5G3YA 3FVQA 4Z1MD 3T5DA 4ZCIA 3IBYA 3PXGA 2CNWD 4M21A 5IT5A 3ZIAD 4A82A 5IK2D 1LV7A 1Q1BA 3WRYC 4NZYA 3L43A 5EE9A 4YXWA 2D2FA 2O8DA 5FI1B 4R7ZA 3RRMA 1G3QA 2D7DA 1Z6GA 3RS5A 1KI7A 1U94A 4LYFA 4UJ3A 3CRW1 4LHVA 3U7GA 2JJ2D 3BERA 3KXIA 4GOKA 4RD1A 4MRNA 4ZV4A 4PZLA 1EGAA 5JJKA 5L3QA 2HDNB 4KODA 2OE2A 3GJ0A 4V0ME 2AHOA 4OK3A 2VHQA 4F38A 4RFSA 1DE0A 4EJSB 2QSYA 4IRUB 5DHFA 1D2EA 4B32A 3CF6R 2REOA 4JLJA 4XOIA 4HAWA 3TJZA 4L15A 2PX3A 2XXAA 1QHIA 3K0AA 4IOKA 1SXJD 2JLRA 2BJVA 3KX2A 5DLQC 3RC8A 3K0CA 2YZ2A 3DDCA 2QI9C 3DM9B 4BFXA 4G5RA 1R2QA 4DLRA 1RFLA 4NHOA 3SDZA 3EA5A 2VP4A 3KFVA 2V54A 4NPHA 1NG9A 1SVLA 3O8RA 3A58B 2JDIA 1MO4A 3K0FA 3T34A 2ZJZA 2GJ9A 4KYUA 1P7CA 1N6NA 4CYMA 4M9XA 2FN4A 2QGNA 2L0XA 3R20A 1UBCA 2DWQA 5E95A 4ACBA 4URYR 1TNDA 2X1VA 3QKSB 4CEJB 3AP2A 4WZAE 4PPFA 2ZYTX 4BEBA 3IQXA 1R5OA 2JLVA 1L8QA 3SFZA 1IXSB 2CK3D 4F4CA 3D6TB 1BH2A 4HSEA 4LWZA 4EJSC 3GP8A 3B13B 5JSZB 1E32A 2GEVA 2C8VA 3SEAA 3H86A 5J40A 2REXB 3SOPA 5FTMA 4I99A 1IXRC 4JKIA 4Z8YA 2FSIA 4HDCA 1KDPA 4BLSA 5EZ5A 4BFUA 1KZGB 2C77A 2W2VA 5DO9A 4DT1B 1XPRA 3BFVA 3F8TA 2EWWA 3HYTA 2WPDA 1X86B 1YZQA 3BH6A 1E4YA 1E2JA 1FUUA 4KFSA 4N3NA 1IAQA 2OG2A 3QOFA 4HLQB 1FP7A 3L2OB 3OIWA 4ARZB 3QF7A 4KBGA 3AF0A 2XNDA 2TMKA 3IEUA 4TZ0A 3BE4A 1ZNZA 3AV0B 3HDTA 3PEUA 1VMAA 1P6XA 2HYDA 2ZS7A 5BN4A 2GXSA 1XEWX 3KTAA 5FUYA 5L8VA 1YRAA 5K8LA 3K1JA 2UVQA 2QRZA 3U4QA 1W7AA 3CH5A 3Q5EA 3KXKA 1II0A 3CZPA 2V55B 1E2GA 3K0EA 5G41A 3PV0A 5JZVA 3RRYA 3ZJYA 5TARA 1TEXA 2EFDB 4R71A 1KI8A 4OHXA 1P2VA 4W7SA 3DHWC 1EX6A 3T5GA 2QP3A 4RSGA 4A9AA 3AKYA 3U5ZB 3FHOA 1W0KA 2XAUA 4A0FA 1R7RA 1F2UA 3ZD7A 4MUBA 3QENA 1P73A 2PH1A 4WOPA 1DS6A 2BWJA 1KJZA 3LDAA 3B8HA 4KFUA 4DLWA 3BXZA 2YV5A 1AQUA 2IYWA 3CM0A 3RANA 1S3SA 1P72A 3C8UA 1Z63A 2Z83A 2EU8A 3SR0A 1RRCA 3MWJA 5EXSA 2QORA 4WZBE 1IXZA 3BS4A 4B44A 5UKDA 1R0XA 1II8B 2PT5A 3QXSA 4Q21A 4Z1MA 5FUWA 2FFAA 1S3GA 4WAUA 3IIKA 1VYVA 4EFMA 1CRPA 2HF8A 3Q3JB 1AQYA 1UM8A 3L8YA 3BIFA 4D25A 1BOFA 3CR8A 1Q20A 3CNOA 4DLTA 4UNQA 5C4MA 4BRWA 2BBSA 3NBFA 3OE7A 2GTPA 1Q1QA 4QC2A 5JWRA 5JECA 1Z28A 2ZREA 2JLUA 2RGEA 1BS1A 5DH9A 2V1UA 1KAGA 1JQJC 2BC9A 1OB2A 2ZYWX 3OFNA 2I3BA 1G5RA 3THXB 2ZRFA 1XNJA 2NO6A 4LHWA 4XSHA 4M9ZA 5C4GB 1SVKA 3GLHA 3TR0A 3K0SA 1I2MA 4RZXA 1SHKA 1K6MA 1R0WA 4MRPA 3GCGA 3RWOA 1NVWQ 1A1VA 4A8JB 3CKLA 5AUOB 1OB5A 2ZTSA 2QGZA 2GJKA 4IFEA 2ERYA 3KKOA 2QMOA 2DFNA 1F48A 2P6NA 1G3IA 2WZQA 1BKDR 1I4DD 2WICA 3KJHA 4YQFA 4GOJA 1ESMA 4TMZA 2GCPA 4WXRA 1XPUA 5DIFA 4JVMA 4KO8A 2W2XA 2GWHA 4G1UC 3M0EA 3V4FA 2WBLC 1XD2A 2O8BB 1BMFA 3EIHA 1ELOA 4LOAA 2C5LA 2AFHE 1YE8A 3K9NA 1E99A 1Q3TA 1XU4A 1J7KA 2F9LA 1P60A 4B3XA 3PUZA 4DZZA 3FKSD 4P3YA 4DEYA 2V6JA 4V0LA 4URXR 4MYCA 3QI2A 1JJ7A 2JJ1D 3IKJA 3QVVA 4H1UA 4K8OA 2P5TB 1XTIA 1ZUIA 1W2GA 4Q5IA 2GILA 4TSFD 4PTLA 2B7CA 3G5UA 2W6JA 1OH5A 1OXTA 2IHYA 3CRQA 4IEEA 2CJWB 3ONWA 4XSGA 2AKYA 4LPKA 3Q7QA 4V02A 4ZDJA 2IYXA 3Q8XB 1CBUA 4Q7KA 5CB6A 2XNDD 2FSFA 3VKWA 1E0JA 4LC1A 4RFSB 4GFDA 4A1FA 1H8HA 2JLXA 5J4VA 2HYIC 4NDZA 3HR7A 421PA 2CNWA 4RZ2A 2YWHA 4AG6A 1L4YA 1WE2A 1VCOA 4AD8A 1CP2A 4DSNA 3T61A 4Q1EA 4FW9A 4LJ6A 2VRWA 1P5ZB 2OSBA 3B6EA 3I62A 4AKEA 1E2LA 1GRNA 2BCJQ 2JJ2A 4TT3A 3PG5A 2JIZD 4Q4HA 2GDJA 4RJLA 4FMBB 4JBWA 4L4UA 3O47A 2ZJYA 3AF3A 2K5UA 3H4MA 4QJ5A 1KSFX 3BWDD 3NBZC 5CM9C 1RPZA 2OO7A 1CLUA 2P0EA 5A0FA 4CF7A 1WBDA 3ZLJA 2OESA 1J8MF 2VPPA 4JT2A 2V7QD 1NVXQ 4NL4H 2W2TA 2OBMA 3SNHA 1U98A 3KQKA 5KUTA 2GF9A 1N6LA 2FMXA 1E1RA 2O0HA 4XIGS 3I32A 3AKCA 5AR1A 4NCJA 4NKRA 3BFXA 3IQWA 4XTRA 2FG5A 4KU4A 3WMGA 4M1WA 4CVNA 2F43B 2ZSFA 4C30A 1ZM7A 1GTVA 1ETUA 1MABB 2PJZA 1HV8A 4QNMA 2HT1A 1JR3D 3ADBA 3MFYA 2XZOA 2H7VA 3BH0A 5BYKA 5LD2C 3NVAA 4QBIA 3EAQA 2WJJA 2C2HA 4ZIRB 2WMNB 2A5DA 4LRWA 1N0UA 1U8ZA 4C0HA 2XITA 3VMFA 4D80A 2WWHA 4YONB 4FCTA 2J41A 3SJBA 2JASA 2ZRIA 2YC4C 4BLRA 2BKUA 2QG6A 3LVQE 4LGMA 3WYFA 3LY5A 4C0BA 1FMJA 1ZRHA 5DI3B 4YMTA 3U7HB 1XD9A 3BGWA 4A2QA 2QU8A 2BBWA 2G88A 3NBXX 1N5LA 1DAKA 4Q03A 3C5CA 1UFQA 1VTKA 4Q4JA 3TQCA 3AUXA 1HEIA 1DVRA 1KI2A 2IX3A 4G01B 3VR1A 5JBQA 1QHGA 3R7WA 4ZKDA 4QL3A 1QHHB 1S9HA 2IW3A 4BFWA 4DLSA 3E2IA 1ZU5A 4DDWA 4BLTA 3EPLA 2J7PD 3SZRA 1EFHA 3P4YA 1RRFA 1VIAA 621PA 2DBYA 5D3QA 5DNYB 3CRRA 2VHJA 3GLIE 3MWKA 3EW9A 1YR6A 4JLBA 4EPVA 5FBLB 1E2NA 5CK4A 1UDXA 1CF4A 3CF2A 2KI5A 5FOUA 3ZYCA 1Q44A 1LY1A 3CNNA 1VHLA 3VR2A 1E79D 3DZ8A 2Q9AA 2PZEA 5JLJA 3L0SA 2IYLD 4G0NA 3P20A 4QHSA 3GEIA 1A4RA 4RD6A 3VU9A 2IS4A 2FGJA 1N5JA 1K5GA 4HLCA 3PEYA 1C1YA 4B3DA 2ORWA 1J2JA 1NVUQ 3QG1A 2OEPA 3QEOA 2DFLA 1MO3A 3TK1A 1NLZA 4B6EA 3QBVA 4JL6A 2Q6TA 2JCSA 1OHHD 3NTUA 4DEXA 4EFLA 3OZXA 4UXHA 2OILA 4F7WA 4M4SA 1CJTC 1W46A 4JKYA 1HE1C 1NBMD 4DIEA 3THYA 3OEHA 4JL8A 3PFIA 5LDDC 3R9XA 2W6ID 1QHSA 2PLRA 2GEUA 4DCUA 1ANKA 2JDID 3LW7A 2QBYB 2CE2X 4NH0A 1YHNA 3QEJA 2BHRA 1DAEA 4ZPXA 5TY0A 4EQ6B 2RGGA 3M4YA 3SQXA 2ZRMA 4M1SA 1FX0B 3CB4A 1U99A 1OFHA 1OJLA 4PZYA 4B3GA 3TRFA 4ERNA 1T4GA 1YZNA 2IYZA 4P4UA 1QVAA 1NN1A 1HUQA 3QXJA 4RZ3A 1MR3F 1JJVA 1ZBDA 2AK2A 3QE0A 5JEEA 1XWIA 5J47A 2VH5R 2LKCA 2C9YA 1KIMA 2CMKA 3SJZA 2HLDA 1R4AA 4CW7A 1DO2A 3KJGA 1XPOA 3TVTA 4NU0A 1AIPA 4MYUA 3THYB 2H57A 2QROA 4FD2A 2V9PA 1UBFA 2ZS9A 5CYOA 4LYHA 2IS6A 1SULA 4TLEA 2VP5A 2WV9A 2RGBA 2DB3A 2CHVA 1WXQA 1X8KA 3B1ZA 2F3RA 3A1UA 4LBYA 2C9OA 4L16A 3CNLA 2G3YA 2ZSBA 2VP9A 4IOMA 1Z0KA 3FKQA 1FX0A 2BV3A 2AWNA 1XEXB 1QHXA 1N6PA 1B0UA 1OW3B 1ZM9A 2ZSEA 3D8BA 2IA5A 4RZUA 1MO6A 4TMWA 4Y0AA 5DI9A 4B71A 3U7FB 1GVNB 4CEIB 2AFIE 4OJQA 3CLVA 5E7MA 2CBZA 5SZKB 2RMKA 3T1QA 4DUGD 3LO5A 4R2HA 4I1UA 5GVSA 2F1IA 2EFGA 5BWMA 3I61A 4OQMA 3K0CC 4EDHA 2ZM5A 1GZSA 2C03A 4BLPA 3GLIB 1W2HA 4US2R 1KO8A 1ZCAA 4PC1A 3FGNA 5EP3A 5JWHA 1C4OA 2Q21A 4LJYA 3X2SA 5FUVA 5TMPA 2CE7A 3LD9A 2DR3A 3U44B 1IHUA 1SXJE 4FI3C 4M53A 2OM2A 4UNPA 4UXIA 5K8UA 2HCJB 2ZUDA 1RYHA 2WWYA 4NBSA 2PMDA 1Z6TA 2DFTA 2OZEA 4MA4A 3LWNA 5DN6D 1AA9A 1NVVQ 5HCNA 4GP7A 5FL3A 1Z06A 4LPSA 3U7EB 1JR3E 5FR1A 2H92A 1OFTA 5DYIA 3DZDA 1UBEA 1Z29A 4BUJA 2J7PA 4ZDIA 4U00A 3MUFA 4HYYA 3UXMA 4I4LA 1H8EA 4TMVA 5FBWB 4CT5A 4FWIB 1DAGA 3N70A 1MOZA 4CT4B 2PCLA 1XD8A 4IVPA 1YZKA 3K53A 1RZ3A 2FDCA 2VTKA 1EFCA 1IONA 4P4SB 5CK5A 1ZD8A 1OH8A 4IVQA 1KY2A 4GP6A 1OXVA 4TQAA 5JJLA 3U4QB 1ESNA 3GLFB 4TT3D 2G83A 4NONA 4C3ZA 3AVYA 4BFTA 4Q1AA 4QNRA 5KSOA 4D4LA 5H8WA 3OFND 4LV8B 1P9NA 5FTKA 1N0VC 4FMCB 4HUQA 2B8TA 3NC0C 3R8FA 4EAQA 1YZUA 4NTZA 5FTLA 2FEOA 3CPEA 4RD4A 2J46A 4GZMA 2P6UA 2WJHA 2YOGA 2A5YB 2WTUA 2NG1A 1NSFA 1W0JA 3GJ3A 4BE7B 1ZINA 4D4KA 2W0MA 1IJEA 4W5JA 1W48A 2ATVA 5A5GA 1Z5ZA 2O8FA 3NC1C 2XTMA 3P27A 3NWJA 2ZE7A 4C4PA 2O8EB 4Q9KA 2OFXA 4JBYA 3AF1A 4ZIRA 4DDUA 3AEZA 4RD2A 4XVUA 5JFGA 4NE2A 2ZU0C 2A9KA 4OHYA 1ZUNB 2V6IA 2G9NA 4ZDKA 1QHHA 2OLJA 2ZRHA 1FUKA 1GILA 1FNNA 2D4HA 3ZZTA 2F55A 1WBBA 5KU1A 1LS1A 1YU9A 1V5WA 1Z6XA 3KB1A 5EE5B 2YINC 3VNVA 2QM8A 2QY9A 4PO9A 5G40A 4Q4JB 3WMFA 4IDPA 1L2TA 3SBEA 1E9SA 1U0JA 4II7A 4Q1DA 4BPBA 2J1LA 4DDTA 8OHMA 2WAYA 3GFPA 2XZPA 2PZGA 4UNNA 3OEHD 1KI6A 2QAGB 1P9RA 3TW8B 3CO5A 3U2QA 1R8SA 4FWTA 2VF8A 4M9SA 1ZW6A 3TNFA 1TF7A 4RD0A 4QGFA 2W83A 3KTAB 3ETLA 1UKEA 2OBLA 1YZTA 2YWFA 3VR5A 3TUIC 4AYXA 4K46A 4U5XA 4JLMA 3BBPA 2F1HA 3U3RA 4PHFA 4KSBA 3S1AA 2PL3A 5HCIA 2XOKA 4DSUA 4NCHA 2FFQA 4ZCLA 3LBIA 3PJRA 4A2PA 3J81k 1G20E 1GNRA 4BRUA 2ZETA 4B2LA 2JATA 3DMDA 3LH5A 2RGDA 1XMIA 2EFHB 4R2IA 5BN3A 4CEHB 3LA6A 2BBTA 2REBA 3LX5A 5LB4A 3RNLA 3IBGA 2QNRA 2EFCB 2YOFA 1KMHA 5CLLA 5FL7D 3GLFE 1K8RA 1U0HC 2D2EA 2Q9BA 2X19A 1U8YA 3EASA 3BAFA 1W44A 1NY5A 3X1YA 2HJVA 3FOZA 4I81A 1Q22A 2Z5FA 3I4LA 4PAMA 2ZR0A 4PHGA 5P21A 2FOLA 2FU5C 2W0SA 2GZAA 4J0QA 4XD7A 1OIXA 4M0LA 4RKFA 1HQYE 2BVNA 1BMFD 4BZPA 2C98A 3AVPA 4OK5A 2JLZA 2MSEB 1NLFA 1XXHE 4JT4A 3FB4A 5M04A 1F6BA 2ZRPA 3FYHA 2HLDD 1VDZA 1DAIA 4GNKA 3PEVA 1X6VA 2NO9A 3BD9A 4CEHA 3SHFA 4OK6A 1FW6A 3KQLA 4ABYA 3I8SA 1N6HA 4X8LA 1KKMA 1LVGA 4BASA 1IN4A 1KDTA 1ZC4A 4B47A 1QVRA 1R0YA 3PEWA 2AXPA 3I73A 5GJVC 2Z6VA 4C0LA 4LCBA 3MJRA 3DM5A 5FPYA 4EPTA 2GXAA 3IHLA 4ON9A 4HLDA 5KNBA 2FSGA 2N46A 3EG5A 2ANBA 1S2MA 2GESA 1U0LA 2ZANA 3ZQJA 4IDOA 3B2EA 1CR4A 2NO1A 3SS8A 4AK9A 4UNSA 5JI2E 3L0OA 3TSWA 1CR2A 2A5GA 1V43A 1FPMA 2XSZA 3AGQA 3K0FB 4BZQA 1F60A 3QG5A 3B7GA 1SGWA 3A37A 2GA8A 2BMEA 3U44A 1RYFA 3QKSA 3TQFA 3RSOA 4E07A 3K0AB 2QTFA 4UXJA 1CXZA 3PUWA 3DEFA 2V1XA 4ESHA 1ZIPA 2R44A 2V4ZA 3W9YA 4AWXA 5IF9A 1E9CA 4AC9A 1GITA 3U3KA 1GL6A 5FPSA 3PUVA 5GADl 1R8QA 4TQUS 1WB9A 4LDJA 1T6NA 1E9DA 2CXXA 4S2EA 3U3MA 4PAQA 5EP4A 2JLYA 1NKSA 1O87A 4D4JA 2OFWA 4RD3A 4UNRA 1Z2AA 1PLLA 2CJWA 2QM7A 2VSOA 5CM8B 3VQTA 3O8BA 3VR3A 1T3LA 3BB1A 5B2ZA 1E6CA 2CL0X 1KOFA 2HJGA 3BOSA 1OFUX 4JLDA 4BFYA 4URZR 5JMTA 2IEZA 2ZE8A 1EXMA 2C9CA 2I1QA 1H8ED 4B3BA 3UPUA 3RC3A 4EUNA 1S96A 2ECKA 1T5LA 3EARA 3IIMA 4WBSA 4HAVA 3FPAA 4TYPA 2XGJA 3Q85A 1G6HA 2KJQA 5IDVA 5AUPB 1Q12A 3ZD6A 5EUMA 3KKPA 4HAUA 4MKFA 3SYKA 1DG3A 1SKYB 2GEDA 4O2LA 4Z8XA 2OXRA 5H1YA 1KYIA 2E9SA 2ORIA 4ARZA 2J0UA 1Z22A 2IEYA 2EWVA 4NCIA 3UK6A 4DVGA 2A3RA 2IYYA 1P61B 2AL7A 2O8FB 2ZSDA 4Q1BA 3FHTA 4TTPA 3F5FA 2GVZC 3RYTC 4U02A 2EW1A 2G6BA 1M2OB 2CCJA 5FR2A 3LLUA 3ICQB 3B1XA 5HPYB 2CK3A 4BEJA 1E2FA 1M8PA 3WRXC 3ICEA 3NHAA 4O3MA 4XWOA 2FE4A 4C0SA 1MO5A 1T5IA 2IUSA 1R5NA 4DDVA 4X8HA 3EPJA 2VP6A 3RDPA 1LNZA 1TPZA 1Q0UA 1NBME 2VA8A 3QUSA 5F9HA 1AGPA 4P4TA 1R5BA 4E03A 5B64A 4KXFB 2NO7A 1NNEA 4LK2A 2DWOA 2J0SA 1M7BA 3DKVA 2WPDD 1GRRA 3A1VA 3AF2A 3KDSE 1SVIA 1G7RA 1JPJA 2MSCB 2DCUA 3AF4A 3P26A 1CIPA 4EQ6A 2PJRA 4EPWA 3A36A 3F0TA 4XD7D 1T8UA 1M6NA 4ILEA 2OXCA 4QG7A 1KSHA 4A6PA 4YXWD 1W36C 5L3SB 1JEDA 2QAGA 3EPHA 3B82A 2GJAA 1QDEA 3EZ9A 4FINA 4RVCA 4TTQA 1R6BX 2XJ9A 3DKPA 1D2MA 1GL7A 2NZ8A 2CHGA 1KO7A 2Q3MA 4LI0A 1PLJA 4OI2A 1JAIA 3K9GA 1A2KC 2ODWA 3G82C 5LD2B 3C41J 1UKVY 2B6HA 3OEED 1DOAA 4K81B 4PO8A 4IDQA 3LLMA 4HB2A 1XCPA 4C9BA 4DB2A 1OYYA 1LF0A 5KDOA 1NIJA 3P4XA 3P1JA 3NBYC 2HUPA 3KL4A 4G5GA 1VCMA 2H17A 5DSZA 4LV6A 1XMJA 3UATA 3EA0A 4NYJQ 4TLBA 2R2AA 1JXOA 2ODNA 2ZI6A 3QPWA 3NKVA 1HQCA 3GFOA 3B78A 1AK2A 3C14C 4KBFA 2NQ2C 3CBQA 3UG6A 5JS7A 2ORVA 1E0AA 2UZIR 3MAAC 5L3SA 1EFRD 2GBLC 2XB4A 4RKEA 3ZDQA 2Q3HA 5B57C 3EIQA 4RFVA 1GIAA 4FMDF 3SJAA 2GJSA 1N6KA 2R6CA 4GSYA 1COWD 3WY9A 1T0HB 2WWWA 3QXHA 4PC6A 4AI6A 4QM7A 3C15C 3E1SA 4IFBA 5D3MB 3V4RA 1U81A 1KNXA 4OI0A 2GVDC 1HURA 1ZVQA 1HY3A 4B3CA 5BW8A 5EJEA 1OKKD 4OQLA 4LZZA 2BM1A 4TL7A 4N0EA 2ODBA 3VX4A 4W5HA 3DL0A 3KKMA 1ZAKA 5KYKA 4QBFA 1CS4C 1D9ZA 2CVFA 4Q66C 4QJ3A 1IQPA 3UANA 2YKGA 1US8A 3AVXA 2QENA 3QKUA 2OCYC 3C7KA 4DSTA 4YDHB 1XFAA 2CL7X 1IN6A 3H1TA 1OV4A 4M2LA 2MSDB 2JLQA 1FL9A 3SFVA 1Z0FA 2J3EA 2YOHA 4PSAA 121PA 4HDQB 2AWOA 2OAP1 2JA1A 2G77B 2YC2C 4KCGA 3CWQA 2H1LA 3SYNA 4M22A 1UDWA 4A0HA 4QGGA 4AYTA 3EZ7A 4G3XA 3WHLA 1NL3A 1J8YF 2IXFA 1MRNA 1KTVA 1A2BA 5EE3A 2ZEJA 1DADA 3HU2A 4KSCA 1XZQA 1KHTA 2QMHA 4MKIA 5AJVB 4WZ6A 4D6PA 5EXPA 3W34A 1CR0A 2EFEB 1UJ2A 1XCMA 2XTNA 1SHZA 5CIQA 4KITB 3U3JA 2CEAA 4C0JA 1O3YA 2ZJOA 3Q72A 4GL2A 4L9SA 1W4RA 1UEJA 1AZSC 5JWOA 3Q7PA 3C4JA 5FTJA 2BEJA 2CDNA 4OI1A 5HE9A 1S4QA 2A78A 3DOEA 5KNDA 4OQNA 1XEXA 3SI7A 2F1JA 5BXQC 2FFBA 1Z0DA 3JZMA 4M1MA 4MITA 2JJ1A 1DEKA 1HT2E 1U2RA 2BJWA 2VO1A 3RS3A 4KYIB 1B23P 4JYCA 1ZD9A 2WOOA 4AKIA 1QHNA 4TN1A 2BM0A 1G21E 4OI4A 5EXXA 4PSVA 2KBFA 5JJIA 1EESA 4PO1A 2P67A 2MMGA 3KB2A 4IEIA 4LHXA 4BLQA 2NOAA 2PCJA 3WNBA 3IDQA 2GNOA 1AS2A 4Q7LA 4QBHA 2GRJA 2GXUA 2OV2A 4KV9A 4C0QC 1XEWY 5FPHA 3X1ZA 4KFRA 3WBKA 2Z43A 2ZRLA 2C04A
chains in the Genus database with same CATH superfamily
3MTBA 4F04A 2AFVA 1OLOA 1DCTA 3M6WA 1RRKA 2HCFA 3PXXA 2AFHB 3NBAA 4P32A 4UVDA 1ZNQO 1GU0A 1CS0A 3B1VA 3OE5A 1M74A 3SN6A 2PEYA 4RVFA 2VSXA 4NWIA 4RFLA 1IOZA 3LT4A 4Q93A 3TFOA 3KHKA 1STOA 2WOJA 2WQ7A 1RE1A 2JHGA 2HZBA 2ZYVX 1MFPA 2F1RA 2W58A 3M7IA 3EWAA 1O5OA 2C8LA 3OEEA 4DJFC 2HHAA 2PUTA 1ONBA 1B1AA 2HHJA 4CIWA 4EI8A 2Y1LA 1E1QA 1UJCA 4FJ0A 4BJ6A 1CULC 1E62A 4MJ7A 2EBFX 1GDDA 3WI7A 1LH0A 4Q7JB 1HFJA 2GVNA 1KO5A 1XMSA 4K28A 3DEIA 4BOYA 3NIBA 1WSBA 1TJ5A 4U3JA 1G6OA 2CFOA 2ONKA 3L4EA 4FMCF 1E3WA 1EP2B 3H2KA 2WTXA 3MSXA 1ESDA 4IQ8A 4HS4A 3RSZA 4DHEA 5ER6A 1T4MA 1JDJA 3IR6A 4QYTA 5FTWA 1WQ3A 2J0UB 1DKLA 1T3SA 3MJ4A 3VYSB 1GSIA 1WRBA 1K92A 1OLXA 1SVOA 4FDTA 4K1LA 5T5QA 1G3MA 1EUDB 1ZW1A 3UXYA 5JSZA 3KQYA 4XUDA 3QLEA 4EFNA 5KDDA 2J85A 3EHDA 5HIAA 1YCGA 2PG3A 3LNCA 1U5AA 4OP3A 5CPFA 1WBJB 4POAA 4Y0VA 4I5IA 1Q0SA 2PZAA 4HI0E 4J4BA 1IY0A 5TR9A 3P9IA 1HL3A 1N6IA 2PL5A 1NU6A 1Y6ZA 2GT1A 2LD4A 3A1SA 5DOVA 1H2WA 3TSOA 3V3TA 3VU8A 3ZGVA 1COWA 1OE0A 4M1YA 2AG5A 4F1WA 4QWMA 3DZCA 3IQDB 4BGDA 2PX8A 4U2CA 3AIOA 5D84A 2XRMA 3M9XA 1QB7A 1S2OA 3CF4G 3QYPA 3RYHA 4B3HA 2C7RA 1OZGA 1POXA 1UK8A 2BMJA 2CUTA 1GUAA 3RLFA 2I4NA 3OZWA 3AYXB 4DNXA 1K6EA 2HDHA 5H59A 1QH8B 3HPRA 4OAOA 3PTLA 2AC2A 2NU8A 1P3DA 3EZ2A 3BL8A 2Q45A 2D0PB 1Z6QA 1Q74A 2GYWA 3DUWA 4HUQB 4KPUA 1KDOA 4UFNA 1JHUA 3T4UA 4IWNA 2X14A 1E3SA 1JHDA 2EERA 1SRQA 3LKVA 1E8NA 4HQ6A 4JQSA 4WERA 4EGSA 4CQNA 4RXTA 4LJ4A 3GQBA 3SX4A 2V0CA 1W4ZA 3QVSA 3JAKA 1BO6A 1BA2A 3KXLA 3B36A 4YDRA 5FKJA 3T3EA 3GLGB 1K27A 1E79A 1T9GS 3CLSD 2D1FA 1Y63A 2VDMB 2P6MA 1PP4A 3A4LA 4RYLA 4KGZA 3EXHC 1II9A 3OHMA 1EFVB 1LDMA 2SECE 4N41A 5EKTA 3UHJA 1WZEA 5ALYA 1GL9B 2I71A 3AVQA 5C1IA 2IH2A 2AZMA 1ML3A 2CB9A 3D0KA 3IP6A 1NFQA 2Q8NA 3C16C 5AJXA 4ZOCA 3C74A 2CLSA 3QVGA 2F43A 4EHJA 4QZVA 5MFZA 5IJZA 1IBCA 1AHHA 1G63A 1KH2A 4X7PA 3T7KA 4J43A 5ALNA 5BW5A 2QVZX 3INNA 4U9HS 3S8MA 2OKGA 5AP9A 5IAEA 1DG1G 2H08A 4IHQA 3PNPA 4EI2A 2R1TA 5JQGF 1TC2A 4QHYA 1DAMA 5CRIA 4EMUA 2Z2JA 4OQQA 3PXUA 2AE1A 4RO0A 4KI0A 1XDGA 2BEVA 5EN4A 3X1WA 2P5YA 3HYNA 4UW9A 3V2IA 4Q0MA 3LXRA 4CFZA 1U2DA 3I5YA 3RD5A 2I1LA 2J31A 5DHUA 1K63A 1E3QA 3TUZC 3G1TA 5IXYA 1T13A 3KD2A 4BWYA 1XTJA 3OP4A 2XUZA 4QPPA 1YK0A 2O3SA 2RIRA 3K09A 2ZBDA 3S2FA 3ZY2A 1NLYA 4R9UC 4YJDA 2ZIXB 4LF4B 1RZRA 1BFDA 4B6SA 1PJLA 1GTMA 4CTMA 3N58A 2CNNA 1XTKA 4DV0B 1KEVA 3HTXA 4NYMR 3DSRA 4AG3A 4N54A 3NB0A 5CVTA 4QGSA 5IN5A 3LCMA 1ZGAA 3K70D 4YCAA 4OHZA 1RPJA 1YZFA 1ZP6A 1KKUA 3K70C 1ZICA 5AICA 1ECBA 1S1MA 3LWDA 5E6RA 4HRVA 2JFXA 5CHEA 1HGXA 4RF4A 2BI4A 4YI3A 5FNVA 5AHRA 4GBMA 5HF9A 2MINB 2O2IA 1EA7A 2QGFA 1PGNA 2LV8A 4KX3A 4BNLA 2DUMA 2QTVB 5JDIA 2NUPB 5C46F 2FPSA 2DY0A 4HVAA 1MOQA 2FR8A 1JR3A 1SVWA 1JPVA 3MLBA 2UYOA 4BMZA 4EPXA 4W9RA 4BX2A 5A9SA 3NGXA 2Q3LA 3C3EA 4F6CA 1C7ZA 3R2JA 4HATA 1G17A 4WOCA 2SKDA 3ISVA 3ZS8A 4BFLA 2AOVA 2RGUA 2LR0A 5K3FB 5JW6A 5EP2A 4DV2B 1Z47A 3IOEA 3A26A 2GETA 1AKYA 2HMYB 2VC2B 3EFOB 1RYMA 4C4ZA 2F9MA 3MWFA 4NC9A 3VYUB 5BOSA 4AO8A 4ZI3A 1ONSA 5DK4A 1X3SA 5E3HA 3ROKA 4HDOB 4AJIA 5IRCD 1NVAA 2XEXA 3EXFB 4O2BA 2WKQA 2WW8A 2QMEA 3ZOZA 5BSGA 4JJKA 1SVSA 4AKSA 4M76B 4X54A 5BORA 2F17A 1Y98A 4LFBB 1PJAA 2Q0QA 1SK9A 3QF4A 4N9WA 1FUEA 1FP4B 4ZOAA 2WRZA 4BB5A 1OA0A 4IDFA 4LOHA 1HFEL 1AKWA 1BHSA 2QAJA 3U80A 3WWYA 3OQPA 2QVLA 1DKPA 4DG5A 5BO5A 4DL9A 5C8DA 1RCUA 2PMKA 3VVLA 3MW8A 1R10A 3LFUA 1A71A 1ONNA 2A7QA 2J9YB 5AVQA 2IYFA 3QPVA 4WA7A 2ZB8A 2G76A 2V74B 4HX5A 5BW6B 2ZI9A 1KDRA 5GJCA 1N5KA 4W1QA 4F2GA 2R6GA 3H7AA 4RW0A 4P5EA 5A5FA 1DHRA 1JRLA 2IP2A 3T0GA 2JZOA 2W37A 4MYTA 4M36A 2O9JA 1QTQA 3HJFA 5MGBA 5EXDA 1T9KA 3L7BA 2FHSA 3ZE9A 1EG2A 1GGKA 3K9LA 4DC1A 4HBGA 1DEOA 4PHHA 4DT1A 1KMNA 1GWNA 3D59A 1CQXA 3TCKA 4TUYF 4YMWA 2NO0A 4P4SA 3I6BA 3OLVA 4NQZA 4AKGA 5BN5A 3ZV5A 3DA8A 1U8FO 2VYFA 5GPBA 3RREA 1F1JA 2O2YA 4YRAA 5D5PA 1D5CA 3BIOA 1RWKA 1UOQA 2WJIA 3AB3A 2D6FA 2H0RA 2GKSA 5L6LB 5DZSA 1ESCA 2G17A 2WVJA 1ATZA 4TXJA 4TVOA 3V8EA 1T3HA 3D3WA 2AEFA 2M6RA 3M1IA 3R75A 2Q0HA 2P11A 4DYVA 1F3OA 4HLUA 3IMGA 3M2TA 2RG1A 1D6SA 1C1DB 1QVVA 5K51A 1VMKA 3RIXA 5GZ6A 1QKIA 3DMRA 4PVCA 5TB5A 3T9BA 1H6DA 1Z16A 3ZU4A 2PM8A 1AGRA 2Z6AA 2ZVQX 1G2PA 4NJMA 1R50A 3ZCTA 1F8FA 3N8GA 1MVOA 1OWPA 2P9HA 1P2DA 3O7MA 4KJZA 4AROA 2C5HA 4C1NA 4TYWA 2PYDA 4DLLA 3KHUA 4BMSA 2HTEA 1RRPA 1GAEO 3DVAB 3F7OA 3QVJA 4TS1A 2F1KA 2ES4A 2ADMA 5FTNA 5KIAA 1PJSA 3L0PA 3LC1O 3ZLVA 3DMNA 4M7RA 2UYCA 2RJOA 3FPHA 4TMYA 4B84A 3DMFA 4ONEA 5LIPA 5DW0A 4MA5A 2VXCA 3BJIC 4BECA 3THWA 3MRSA 5CDFE 4KXNA 5JRDS 1IJBA 1RBZA 2JGDA 4QULA 2ACEA 2BFFA 3ZVNA 1SB9A 4KR3A 1GV0A 2XA1A 1IY8A 2M9MA 2YYYA 1TLFA 1KJYA 1U80A 2B8WA 2J9FA 3PHCA 1MAVA 4OHPA 3TOXA 4DYHA 2EG9A 4TXLA 3HBLA 2FWAA 4LE1A 4ROTA 3RVJA 4AJPA 4QTTB 1NW6A 1O97C 2BGWA 2ZIEA 1W34A 2V9CA 3W6UA 1IBMB 2VLIA 4OGKA 4J90A 1IJFA 2JK1A 4PAOA 3ZX5A 5HW0A 4UMEA 3RKRA 4EA7A 2D2VA 5TE9A 1J33A 4MGIR 5D87A 3QNUA 4G1VA 4X65B 4Z9BA 3VDMA 1Y7TA 3ZDAA 4EX6A 2P6RA 4MLZA 2XMDA 4R0MA 1FSGA 4MRVA 2EHJA 4V0RA 2WB4A 1JQAA 3QLVA 1BX3A 2PV7A 4G4SP 1PNVA 1UJ5A 5EMJA 5TMDA 4Z7QB 5BQFA 5AVUA 3T1YB 3RHZA 4XYMA 1DQNA 1TADA 1TO2E 3AEUA 4IGFA 1CLEA 1M2VA 4HUTA 4MRSA 1JEEA 3TRJA 2ZI4A 3WFIA 4I1SA 4S12A 4N5HX 4WZBB 1Q11A 3BXXA 1LI5A 3GAMA 3F4KA 4AF8A 2WQ6A 2IY7A 4JNKA 2IEIA 4JT9A 3AFOA 2PVCA 1TT5A 1F2TA 3C6BA 1RDFA 2F1OA 3FNHA 3KKNA 4GBED 2ETVA 5LSAA 3PQCA 3HS3A 3RF7A 2RGNA 4JA2A 4DA9A 4XEUA 2J9XB 5DHAA 1YZHA 4MV4A 3DMHA 1Z2CA 4M1KA 3SC3A 4AQDA 4F5EA 4YCSA 5IMSA 2Z1NA 2C9MA 2BM9A 4WKBA 3LDGA 2X0FA 4MYHA 3PGJA 4M9QA 4A92A 4OHWA 4TOIA 4BQEA 1JT2A 3NALA 5IVHA 1QYWA 5AI5A 2CVHA 5CFQA 1TQ2A 3INYA 1GPUA 3RS8A 4PANA 5KJEA 1RW4A 2QTHA 4RVSA 5CLFA 2H52A 4RQAA 4FLEA 3VDQA 4P98A 4Y6LA 5LP6F 1WXIA 4DCSA 4EYOA 3JVDA 1Z6YA 1LTHR 4RCYA 4K05A 4RMHA 5EKSA 4E5KA 1JALA 2PXAA 1S6YA 3GW8A 4FOPA 3TRKA 2J9FB 3C5HA 5SZHB 2IZZA 2Y2VA 4C6TB 2VEOA 5B6PA 4DRXB 1XDUA 2PBFA 4IIJF 4ENUA 1N92A 2AK3A 3OJCA 1VSQA 3PR2B 5HRUA 2C78A 4ACAA 1FRVA 2HD4A 2FB9A 1VL0A 3HDHA 3HMQA 4CDGA 3E2MA 1BN6A 4GRAA 5GM1A 3KSBC 1KO4A 3GRPA 1K66A 1FQJA 2C3MA 3KHSA 4PLGA 4QXOA 1XELA 3D7SA 3EAGA 3N0VA 3NG1A 2ZJAA 3CPJB 1OXXK 2R8RA 3HCOA 4UQOA 2J3DA 5DHRA 5DTRA 3STYA 4IV5A 1YR7A 1R8JA 1ZVJA 1ZONA 2OK8A 4P7FA 2XYQA 3I4FA 2I4IA 1QK3A 4O6VA 1H2EA 1QC5B 3EY9A 4L75A 2ZAIA 1IG0A 2WTBA 1CYEA 3WRXA 1QYIA 1MJNA 2CHUA 2RKOA 2UZ3A 1K68A 3B7WA 5K6AC 4JGGA 2LW7A 2Y92A 5CJ2A 2NMVA 3CQ9A 4KNVA 4Q9IA 1ZJYA 4KZPA 2P2NA 3ZHQA 4FT4A 3C5EA 3TBKA 1X9IA 1L5MA 1Z5WA 1FYWA 1CB0A 1JBQA 1A8HA 1MAAA 4JLNA 3GPBA 3SICE 1DDGA 1E1KA 1HLFA 5K4GA 1KQOA 4LYYA 3VBCA 1GPBA 4GPTA 1GV1A 2Q9CA 5A4FS 3UQYS 3EDYA 1OYWA 3GJTA 2DFPA 3ZHCA 4BFZA 2VRCD 4XKJA 4UEKA 3UT0A 2QX8A 2P7IA 4C14A 1VGRA 3GY0A 1RJGA 4CM8B 2B92A 4V0OA 4OSPA 2GYVA 3GGPA 1UMBB 5FEMA 4TQ9A 1WSWA 1ZISA 3CLRC 3ETHA 4HBZA 3REQB 3SOZA 4LSGA 4D9EA 4MDFA 1YT5A 1S8FA 1AN0A 4PNHA 3AFHA 3I8OA 1UWVA 2DGDA 2XSZD 3ET4A 1SBCA 3D4IA 2IT1A 1QONA 3BZWA 3FZQA 3QQPA 2CEKA 4Z0NA 5LZ4A 1SD1A 5FXMA 4CLRA 4X6YA 1MFZA 3KJIA 1I6WA 3A8TA 1EWQA 4MW1A 4B40A 3IELA 3LV8A 3BORA 1ICIA 1MB4A 4O4LF 5E7IA 3W6OA 3KVRA 2OO5C 2IH5A 1TQ4A 4C3VA 1G4UR 4P5PA 3G2IA 1NG1A 1QRAA 2FPPB 2G71A 3DVSX 3JATA 3LZDA 4ZOBA 5H80A 4ZYYA 3PLAE 2IS1A 3L77A 3Q8MA 2ASEA 3HG7A 3M34A 3MGCA 1QG0A 4YJ2F 5T41A 2XWBF 1NRJB 2JBWA 2F8MA 1SOAA 4FNMA 4OLFA 3UG7A 4S04A 1WXDA 3VZQA 1Y3HA 1DAFA 3FOAA 3G85A 3I2KA 3O8OB 4HDMB 1GKYA 2O7QA 2W2LA 2ZRKA 5DJ5A 3UJPA 2Q2QA 5HKKA 4RPLA 2PD3A 2AZ4A 1YVDA 4RC9A 1WU8A 4O4HF 4IJWA 1J0EA 4W9MC 3UAYA 2R1ZA 3ZH9B 2YDYA 2Q1SA 2GK6A 4IQ0A 4DF3A 2ZIAA 5LL6P 2C4VA 2HJSA 3KUDA 1G7SA 3R23A 1ZUHA 5CA1F 2O48X 3NEYA 1R8XA 4NI5A 1KQ3A 2P65A 5K3CA 2JEZA 3WJ1A 1UODA 1N0WA 5J2UF 1RWMA 4MIOA 1QHFA 3B6JA 4NBWA 4BAUA 4D44A 4C1BA 3OY2A 2DPYA 3MGGA 3U62A 2FF5A 5H9VA 2Z98A 4B4KA 2PWYA 2YW2A 2BFCA 2P4QA 3BE8A 3GO4A 3AM4A 1V95A 3Q11A 5FBRB 4EVQA 3ROQA 1R4ZA 3PENA 4V1CA 3H9GA 3LQ4A 5BT8A 4DFDA 4YMGA 3G2MA 3VNQA 1Y37A 1J21A 4PYOA 1ORDA 1XA4A 4HB0A 1IZYA 2VJBA 3E9RA 3VC3A 3SYLA 3WJ7A 1CY7A 1J99A 4ZVRA 3I0NA 2IHVA 2EZ4A 4ZU1X 1XDDA 5FIUA 4DCVA 1PT8A 1O6BA 2X2FA 1N1GA 1Y89A 3UMBA 3K0KA 2GPAA 3ZUPA 2TSYB 1NBMA 4KL8S 4QODA 3UAVA 1WR8A 4X1YA 3H9CA 4G4GA 4M0KA 2HK6A 3RTGA 2LPMA 1QLHA 2FN9A 2SKEA 3J80A 2PGDA 4DMLA 3GLRA 3G9TA 1Y8CA 3DJYA 1W88A 2D3WA 2W7TA 4JJZA 1O4VA 3ROFA 1O57A 1SKYE 1H94A 2YMQA 3EVNA 1TM1E 1Z17A 2J4DA 2PT9A 2AOTA 2RSLA 3B60A 3OIYA 4ZQBA 5I9LA 2PD4A 5I51A 4WEOA 5C8VA 3JY6A 1LEHA 5CDGA 1DBRA 3PUXA 2H2HA 1VHWA 2BUBA 2XCRB 3PUHA 4IHJA 3K20A 1CJSA 1T1EA 2MTBA 5F3WB 2BEWA 3AB7A 4J0IA 3ADCA 2C7OA 3FMIA 4G26A 3NCHA 3ZWWA 4ARAA 2R1UA 3EFHA 4FFOA 4HOYA 3VPSA 4C9BA 2DZDA 3CJRA 2XCIA 3C7CB 4WN9B 2IBTA 5A7GA 1JI3A 3OZTA 4K9PA 2NQTA 1P8JA 2H4WA 2RAFA 3I23A 5G53C 1P62B 3B51X 4V0MA 5IJXA 4DR2B 1W36B 4E6EA 3JD4A 3QLTA 5K8CA 2IHUA 5KOJB 4LKRA 4ZOQI 2R7LA 3GFTA 3L84A 3QUBA 3TB4A 4NYMQ 4QOSA 1R37A 2QMZA 3CPSA 5AVXA 5DV9A 4MUGA 1O54A 2EVWX 2B83A 1LFDB 4KXVA 4OOFA 3ZEAA 2VDWB 2MMCA 3CX8A 1TZCA 4Q24A 3TLKA 5A9SB 1F5NA 4M9CA 1O94A 2V7GA 3LQ1A 3WSVA 4MWOA 2ACWA 1E3LA 2HEIA 2O7VA 4YB8A 5TGDA 3RIYA 2RGAA 1Q7BA 4O4HB 4WWHA 2SHKA 5EZSA 3KYCA 1H2XA 1NSTA 4DNOA 1I4LD 1RQPA 3AI7A 5IUKC 1GL3A 3E48A 5BQOA 1Q2XA 1LQUA 3PZRA 4ZHSA 3G23A 1LVUA 1XFDA 2C92A 2ZUCA 2ZI3A 2ZITA 1XX6A 2GCIA 4KQIA 1FDSA 4MQUA 3UH0A 5ER9A 4XAQA 4WNAA 5DLPA 2D13A 2W4QA 3OM8A 4MB2A 2PX0A 2PS3A 3A6FA 3DP9A 3OLZA 5AXBA 2NPIA 4G37A 3N59A 4BO4A 1N2EA 1QFZA 4B76A 4KNYA 1V16A 5CJPA 1YDFA 4WCFB 4YRGA 3ZVKA 2NLOA 1XK6A 3QIAA 1PGOA 4FGLA 2G1AA 1XAHA 5BVHA 1Z07A 3M5PA 4PR3A 1KY3A 3M1LA 1GKIA 3O8NA 4NMWA 4PPGA 1SC3A 1SKMA 1E5LA 3MWDA 2A5JA 1H66A 1DJLA 3HA7A 4FCWA 4MPPA 1ZMRA 2QA5A 3RG2A 4AMUA 3ZK8A 2P2DA 1H5NA 3NVKI 1PK7A 4Q00A 4YJGB 1CYDA 4GYWA 4JJGA 3TLXA 3J7AC 3H1PA 3QVGB 4BRZA 3UK1A 5FD8A 1S4MA 1ACJA 5EKUA 3JWJA 2FP4A 4I46A 1I0LA 4OCZA 5EMKA 5CGQB 1CK4A 1SCIA 3KQSA 4HT3B 1RNLA 2QEQA 3S1SA 4GOXA 3EJWA 5AVJA 1H1TA 2ECPA 4YDSA 4Y18A 1E3MA 1ZFNA 4IZ6A 2C0CA 4V0NA 4D57A 4EEXA 5BWNA 1AKEA 2AUMA 3QQ5A 1KQGA 3AZQA 3O4FA 4OLJA 2J59A 4PC7A 3AYZB 5J4HA 4I1VA 5JPDA 3GIDA 1NN5A 5KU7A 4JI5B 2CWWA 1U9ZA 1ZJWA 4L8FA 3EF0A 4TT8A 2ZJ5A 1Z0JA 1JR6A 2WSIA 3AG6A 4CLDA 2RHLA 2IWHA 1FQOA 2VP2A 2NQ8A 3HNRA 1UMCB 4N6NA 4PC2A 1LLDA 3UMCA 4DQDA 1K7YA 2QAGC 1WPXA 2BELA 3AQIA 5D86A 4C7XA 1B8VA 1HO3A 5JVDB 1I2AA 1SQ0A 2ZT7A 4UEWA 5KQLA 3KV3O 1YA4A 3CPHA 1QP0A 4GC5A 2VLBA 3FUVA 4IDHA 3PYMA 4L5BA 3V4OA 4K6GA 1SEVA 4QOFA 3VNRA 1EB8A 2XDWA 1FFXB 3P19A 3COYA 4CKEA 2B78A 4Z0PA 1WDWB 2E82A 4FBLA 5B53A 3HCRA 3H11B 5CNJA 2Y8EA 2VSYA 4ZVNA 2JIDA 3S44A 3VAYA 1TLLA 4BQPA 1PEDA 3CONA 1AUQA 4D6YA 4QFCA 1AM4D 3BQMB 3ELDA 4KBYA 4UAVA 2BJHA 4A73A 4IW3B 2CDAA 2YXLA 5A5EA 1EUDA 3HLTA 3L93A 3ESXA 1CY1A 3MB8A 4IJVA 5IXSA 3KPJA 1YV9A 4DAOA 2H07A 4E5SA 4R98A 4W5QA 1Z68A 1Q21A 4FGKA 1ISMA 1LS6A 3FPKA 3W6PA 4Q3OA 2KSQA 4MUMA 4EPYA 3F3MA 3D3QA 3K1AB 1OZHA 4XJXA 1QJ4A 3MQ4A 5KYGA 3G9QA 2I1WA 2WZCA 4PFSA 3P52A 4RLFA 5C8YA 3RBVA 3CV3A 2ID4A 4IEFB 1U8UA 3VOBA 3DDOA 4Z49A 1OROA 3EXIB 3BB4A 4QWWA 1J5PA 2VK1A 2DKNA 2VK8A 4XJVA 3O91A 3NHKA 4RZSA 5E7JA 3ZXUB 5FEUA 2O5CA 3H75A 5D6OA 4RK6A 4QREA 2VSNA 1QGAA 3UJ6A 2GLTA 2FX3A 2GN2A 1U1IA 3EULA 1A9OA 2O8NA 2RBEA 1D2NA 2B35A 1CR6A 3OQHA 2PEZA 4J3NA 1A9RA 3VAAA 3AM1A 5JCZA 5JRJA 3CF4A 3RS2A 1D4ZA 2O1WA 1RRMA 3AQ4A 2HADA 4MKGA 1MJ5A 4MWBA 3LUKA 3MHPA 4UUMA 3PNSA 3UWOA 4P34A 4L7QA 4OBWA 3NHLA 3PEFA 3JPWA 4P4NA 3SIRA 1XLTC 4BO0A 1GP2A 3W3ZB 3F4BA 4LZOA 4B43A 2OT3B 2WY2D 1HX7A 1J20A 3U40A 4KMRA 3IO5A 2CXHA 2DUUA 4BFVA 1IULA 1OGYA 5IDXA 4RABA 4R5MA 2ZGVA 1V26A 2HXSA 5AHKA 1TUIA 1PZEA 3H11A 1R0LA 3PP8A 3QPUA 4M8NE 2ZB3A 2XX3A 1G8PA 1L7VC 4XM0A 4KQXA 1M6YA 4PXAA 2VPXA 4LJSA 4MR7B 4W8OA 3RUDA 3UMGA 2XCUA 1G0OA 5A3VA 5FBQB 3WAJA 3N0XA 4BP1A 4GZ5A 3PRJA 4BGVA 4FFWA 1LDBA 4MYSA 4B6QA 5LU9A 1VG9B 4DJTA 1CZOA 4ZHQA 3Q0IA 5TT0A 3VNAA 3KDAA 2QN6A 1L6IA 3DOFA 2QMYA 1GAJA 2BP7A 2G1JA 2F6RA 3H42B 3JQ7A 2P1RA 1QZTA 1M33A 2QQ0A 3NETA 4MS1B 4OAPA 2AW5A 1LRLA 4LRQA 3FGOA 2GHQA 4C3UA 2UYHA 2EP8A 2XTJA 2YXNA 2YDXA 2QTMA 1PJQA 1NQAO 2BMDA 1QYDA 3IUPA 2O23A 1BYUA 3L8HA 5COBA 2ZTLA 2FX5A 1QG4A 4GMDA 4CIDA 3MJTA 3HRKA 2HH9A 2ISQA 5IT4A 3SZUA 5E6SB 2IXEA 4GMKA 5LB2A 3JRWA 2XUPA 2D62A 4FHCA 2YYZA 4UM9D 3IVMA 4RY2A 3OPYB 1ISFA 1Z4MA 3BRWA 4PQYA 1KR5A 1CUGA 3FR7A 3PNVA 4V2IA 3FX2A 4QOHA 3FNBA 4WLEA 3SS7X 2EIHA 4OLBA 1XZPA 3ES9A 1XLUA 2L42A 4QXAA 1PFQA 3WZMA 3ZDEA 1DCFA 2D1SA 3EJ6A 1CY8A 2NZXA 5HQJA 1ITZA 2GMWA 2K6GA 3KUKA 1GA1A 2IL1A 3PCXA 4P0TA 3KAPA 5A4JA 2I03A 2OHVA 1CDEA 2ZIFA 2ZZNA 3OFJA 1VPVA 3DO5A 4NENB 3AINA 1M6EX 1X8JA 1ZIXA 2HK9A 3A9UA 2IZ5A 3DLAA 3QKRA 5CX1B 5EIOA 3SE0A 1V1MB 4FSDA 1KJ9A 1GTG1 1LPBB 1B0ZA 1EAYA 1KMMA 1OASA 1VYTA 3ZTTA 3G02A 3RUHA 1IE3A 1ODLA 5KCZA 3NOXA 3IPYA 2Q0SA 2GNPA 1GYPA 2XRYA 4C0KA 1PV2A 2V9ZA 2HT6A 2JFVA 3O6VA 1EBFA 4JEHA 3GJ4A 4I1IA 3TN7A 3KQUA 2Y1OA 3K4QA 1ZESA 2H1CA 4QYWA 4J4TA 4MULA 4WLOA 3T7EA 4DCJA 5KO2A 1DOZA 3OZEA 4EHNA 4YH1A 4KE9A 1NXSA 1U0NA 1W49A 1YR1A 4MUYA 4PHTA 4A2WA 4EHBA 3NDPA 3ITNA 5FDFA 4NLLA 5JS1A 1DG9A 2HRDA 5FI0B 4NEHB 3ENKA 2NSHA 4MR8A 3BN3A 4UCWA 1UBRS 1ZA1A 2GKOA 3O74A 4TMKA 2Q41A 3R9WA 1UXKA 1T0BA 2C4WA 2X0IA 1I30A 2FGKA 4YMSA 3DG9A 5DRYA 3ZS9A 5CYGA 1FK8A 1XE3A 2HU8A 2IV7A 3ZDCA 1UXIA 1HH4A 5FOXA 1YB1A 3FYUB 1CR1A 4IIXA 4H7DA 1TAHA 5E6SA 2QD5A 2ZG6A 2I4MA 4QU0A 3RB8A 3QKWA 4H77A 2VF7A 1VHQA 1QV7A 3LRXA 3IUBA 5JCJD 2BR5A 2ODPA 3AWIA 1VLZA 3B6IA 5IAGA 4Z3DA 1TT5B 2WYUA 4REQA 2AQIA 2A9VA 2PL1A 3ND6A 4EG5A 4DA4A 4N49A 3L7NA 1BKYA 1V1RB 2AJLI 5ICSA 2A1IA 3MWDB 4LV5B 4B2YA 2WP8J 4F3KA 2DTXA 3EGDB 3C8HA 5CFNA 2W98A 4RCZA 3ZU3A 3CZMA 1KP9A 2QRQA 3C87A 4EJMA 3ITKA 4S35A 4KO3S 1L7OA 4W6QA 1L5NA 1T5BA 3DV9A 1RPNA 2QMUA 2X7HA 4ZC1A 3LUGA 3HWX1 4TMTA 3F78A 2NUAB 3LUAA 1ESZA 2HPVA 2JIBA 3Q7IA 2CW5A 2BONA 3RSLA 1X8LA 1VE9A 2QW8A 1EK6A 1BWRA 3AH8A 4ZKEA 2ZWMA 3RF6A 4UUBA 3ZVMA 3QX8A 5ECYA 1QTNA 3WYGA 2GFHA 3H2SA 3HCBA 3P2EA 4NJEA 4GH5A 1IMOA 1PEAA 1YL6A 2VHTA 3JVIA 1ULHA 4UHDA 3ESYA 3H7IA 4P0QB 1CT9A 3H65A 4DOMA 1ORRA 5E9QA 2I0FA 3PGLA 3RKUA 4AP9A 1J8DA 1UT6A 4QJBA 4G56A 1U1CA 2A0KA 5IVPA 3ZQ6A 2CD9A 4B3TB 1TCCA 5J43A 2OVFA 3CJTA 4J1SA 5TDHA 3DVLA 3F7MA 1PVVA 1NBEA 3A6ZA 5JNWA 4O08A 3WNZA 2ZQZA 3BK1A 3LVRE 2KX7A 1TU0A 1KOJA 1SBYA 4MQBA 2O8CB 2P2LA 3EE6A 2FJUA 4TYQA 4AUEA 1YRHA 2AG8A 2PQ0A 3BWYA 3K8YA 2ZSUA 5I3CA 3JVVA 3ZIUA 1G18A 3UXHA 3FH0A 1PO7A 3SBXA 1QO9A 2AMFA 2QIOA 4NBNA 4YR7A 1I7QB 2QBYA 2HU2A 3EIEA 3JQEA 5E8RA 1QIIA 4JB3A 3TW6A 4ETWA 5FOSA 4AZVA 1PX2A 4RVGA 3ECCA 3DF9A 4ITVA 2H4HA 2PUWA 4J9VA 4RK5A 1WOYA 3VYTB 5JH7A 5D51S 2NZVG 1HZJA 2XQVA 4JENA 4UCQA 4GMXA 4XWYA 2QW1A 1ISSA 1Z6AA 3FTPA 3ZCVA 2RHJA 4WGFA 3Q12A 1G16A 1Z8DA 3AILA 1KVSA 1T5SA 2GM4A 4Y0NA 1QZ3A 1MZPA 3IBYA 4L95C 2WA2A 4A82A 2IODA 2O1XA 4CQMD 3NDJA 3OO0A 3WRYC 5EQFA 4PG5A 4IS3A 2PK3A 3LNTA 4FFRA 5FI1B 3RRMA 1G3QA 2BI7A 2E5FA 5T8KC 1HG1A 4MAAA 3RS5A 1KI7A 3HZHA 4LYFA 6ADHA 4LHVA 4DXDA 2C61A 4OA8A 3U13A 3IAEA 1QNLA 4PZLA 4C07A 5JJKA 3TFWA 2AR0A 2NXWA 2EP7A 2HDNB 3KELA 3O8OA 4HDMA 4KODA 1FXWA 4GPAA 1G55A 4KVFA 2AHOA 2D8AA 1LVHA 3HB5X 3EF3A 3L18A 5ELMA 3W2HA 3KQNA 4OK3A 4E6PA 1WMFA 3DEZA 1IY9A 3R0ZA 1PQ4A 3QMWA 2GM3A 1JHYA 2WSYB 4IRUB 2EWMA 3U9SA 1YWGO 3G9XA 1XR3A 3AV3A 4WXEA 1SXJD 2A59A 3KX2A 5DLQC 1IUKA 3OT1A 1XNGA 3GDHA 3H2JA 4QUEA 2C7VA 2QI9C 2XUHA 3AERB 3BA6A 3DM9B 3MOGA 3KYBA 4P38A 3E9CA 4RSRA 3IDSA 2COEA 4QTUB 4YRBA 2P4EA 3EA5A 1NG9A 3GA5A 2CBGA 3RFVA 4FQ7A 3VYWA 3A6KA 3ZE8A 3LYAA 3PXAA 4M38A 3ACCA 4A26A 2ZJZA 2C20A 2ORED 3GRCA 4JXJA 2JKVA 1JU4A 4H59A 2AN3A 1UBCA 2AYXA 3MA0A 3QKSB 1Z37A 1K6IA 4L27A 4P3KA 3OHSX 3T5BA 4B5LA 4CEJB 3FZGA 4A6DA 5A4KA 1Y1QA 1ZH4A 1EVYA 4RSHA 1SZCA 1HLDA 1SC9A 3MS2A 2QTGA 4B09A 1L5LA 4F4CA 3COJA 1PL8A 1HF3A 4LWZA 4DG8A 2K2WA 5A02A 5JNRA 3B13B 1M1UA 1UZMA 2H7XA 2G9VA 3K0HA 4X20A 3SSOA 3U19A 4B7UA 4JI4B 3CLUD 3H86A 5LA6A 3PR3A 2A0WA 1V2HE 3LHKA 1RWNA 4XX1A 2XCOA 1IXRC 3O3MB 3WL8A 4JKIA 4Z8YA 3COSA 4ZOLB 2G09A 4D7AA 2NO4A 3GH1A 5EZ5A 1KH1A 3OPYA 1VL1A 3RAGA 4BFUA 2ABWA 4DT1B 4B81A 1XPRA 4FLFA 3EZXA 2P90A 4KWEA 3BH6A 3SZLA 5KQSA 1FUUA 2PUVA 2XKJE 1IAQA 4HLQB 3RIEA 3B3GA 1YGYA 3M1YA 4XWGA 3L2OB 3WADA 4ZICA 3OZIA 4R8KA 1VIVA 1M8FA 4DY6A 4KBGA 2YTZA 3AF0A 3LK6A 2W2NA 4R7GA 4KB5A 3C3DA 3MAJA 1R0CA 2JC3A 3AF5A 3ESDA 3IEUA 4TXNA 3ND7A 1H42A 1YF3A 1ZNZA 1N0IA 2HEGA 2HYDA 2ZS7A 3UB2A 2RFLA 3E3AA 5CA0B 3JYOA 4JI3B 1GQ2A 1XEWX 1RAEA 1RLUA 2FUNB 1OMOA 3QMPA 1CEYA 2UZAA 3K1JA 4EZBA 2UVQA 1H2FA 3CH5A 2X3YA 4F4FA 3HDJA 3DBLB 4KGXA 3VR4D 5EIEA 5HQ3A 4QOGA 1WEHA 2YJ5A 1ZN9A 2NXEA 3D8RA 3EVGA 4PSCA 5KTPA 1YFLA 3G7UA 2LP4Y 5A9TA 5A0VA 3CZPA 1WV0A 1T6BY 2YVLA 3T95A 4DR3B 3PFHA 3D6NB 5G41A 1C8VB 4JC8A 2JI7A 4M8IA 2H1OA 5EJIA 3OG9A 5TARA 4R71A 4OHXA 4O1HA 4QQFA 1D04A 1ENYA 3AKYA 4WBXC 3AHEA 2QRMA 4YO7A 1HTTA 3QVOA 1R7RA 1VMDA 1VB5A 2GSDA 2RKWA 3W9UA 1LBHA 1M1XB 4Q6BA 2O20A 5CAEB 1KJZA 3JYQA 2Q3BA 1KYZA 1U0OC 4RS4A 5JV5A 3H99A 1JZSA 2MYUA 2YV5A 1EUYA 1AQUA 1OBCA 2OK7A 4RTQA 2E37A 1P72A 5BSVA 3UUFA 2Z83A 4LDAA 2ERCA 2O2EA 5J63A 1RRCA 1KPIA 2H48A 5HYVA 3FD8A 2WHPB 3ZZMA 5K3OA 3E4CA 1DFIA 2QORA 3PF9A 4I6JA 4NARA 4WZBE 1YI0A 1CQZA 3V1YA 4AX8A 2PT5A 3QXSA 4Q21A 4Z1MA 5L7WA 2OP1A 4HN9A 4MCAA 1QYXA 3IIKA 3N28A 3F9CA 4R5HA 1UBTS 4N12A 4EFMA 4KYVA 2HF8A 3H8SA 3L1IA 4N7BA 1TGVA 1WABA 3ZHZA 3BIFA 2X22A 4RWEA 2VUSA 1BOFA 2ZCJA 3OO1A 4X41A 2QX4A 3UHPA 4D8TA 1Q20A 4ITUA 5DWVA 1AB6A 1OFVA 2ZIXA 3K2QA 1NJSA 1ZGBA 1U3TA 1VKZA 2AMVA 4H3VA 1UBLS 3OZUA 2EKQA 3OE7A 2BGTA 1JAZA 3EQ2A 3FVTA 3O95A 1T5HX 3OFSA 1Z28A 3CLUC 3PSAA 1NX9A 2RGEA 3N7UA 3WL6A 2FUKA 3I9NA 1UXOA 3ZWQA 5HTOA 2GLXA 2CYAA 5DH9A 3G13A 1KAGA 3JQAD 1JQJC 4BCCA 1ZSVA 1OB2A 2V1UA 1OOEA 1Y7PA 1P7ZA 5D1HA 5JY1A 2I7XA 2ZRFA 3SXUA 1TVKB 3R0VA 5THKA 3GLHA 4DIBA 2BGLA 3K0SA 1I2MA 1N8TA 4L6AA 5GV7A 3ROTA 3GUUA 3OJXA 2G80A 4MDYA 4JROA 1R0WA 2ID9A 3HA3A 2IH4A 4XLTA 2FJ0A 1Y6RA 1CD