2UKDA

Ump/cmp kinase from slime mold complexed with adp, cmp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
publication title Structures of active conformations of UMP kinase from Dictyostelium discoideum suggest phosphoryl transfer is associative.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 71
structure length 191
sequence length 191
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ukdA00
5KDOA 1IN8A 4KVGA 5D3QA 4HLUC 3KQUA 1P9WA 4TYWA 4M9SA 2IHYA 4JLPA 1E2QA 1N5JA 1NBMD 2VP0A 4B2PA 4ZCMA 4US0R 1QG4A 2QN6A 4GZMA 3QKRB 4TLBA 2GBLC 3A37A 3ZDQA 5JFGA 3PUXA 3BB4A 1G7RA 1ZUIA 2FV8A 2GJKA 4YMVA 1ZJ6A 1KJZA 2QP3A 3GMTA 4TWZA 1W5SA 3LD9A 3QBTA 5KPDA 1XCPA 2N42A 3UG7A 2DWPA 2BBWA 1DVRA 4LBVA 3FKSD 4R7ZA 3A6PC 3H2YA 4ZO4A 4MUBA 3GCGA 2WVJA 1L4UA 3UKDA 3NDPA 4PO9A 1T8UA 4TL9A 4TLCA 5CJ2A 1G17A 2ONJA 3W6NA 3H4MA 2QQ0A 4DCVA 1M7GA 4LGMA 4QGGA 1L2TA 2CBZA 3DOEA 2O8BB 5AUQA 2JDIA 1NJGA 3AF3A 3LRPA 1W36B 1BMFD 1ZM3A 2RGBA 3B1VA 4HLCA 4Q1EA 3PVSA 3SHWA 1YVDA 1X1SA 2XGJA 2VBCA 1NI3A 4MDEA 2P0EA 2PEYA 1NRJB 2FOLA 3W34A 4DXAA 2PH1A 4PHHA 4EPYA 1KK0A 1E9SA 1G5RA 1AJEA 2ZRNA 3P27A 2ZYUX 1KJWA 4G5SA 1OXVA 3K0AA 5C46F 2WWIA 3NEJA 3EA5A 2H8KA 3MGCA 1UPTA 2UKDA 3MCAA 4EFNA 3GLIB 3BB1A 3B2EA 4I81A 4AKIA 2HXYA 2QBYA 1Z47A 2A5YB 2HEIA 2PLRA 2VA8A 4TLDA 2ZTSA 2RH5A 5J4HA 1ODFA 2ZRCA 4BGDA 4V0MA 2GILA 2ZI3A 3NIBA 1PUJA 5KDLA 4HZUB 2O8FA 1EFRA 2AHOA 4KFRA 1KMHB 4JKIA 3EPHA 3OZXA 3RS5A 5EP2A 5EJEA 2IS6A 2VYFA 3QXCA 4LK2A 4M8NE 1NLFA 3FMFA 4C0AC 4B32A 1MO4A 4MUAA 4TZ6A 2D62A 4FI3C 4CEHB 3U5ZB 3MAAC 1OFHA 2BCGY 4ZDIA 1P9NA 4Q1BA 3W6OA 2GAAA 3U3KA 3JVUA 2YOHA 1OW3B 3NC1C 3U61B 4GP6A 3LLUA 2AR7A 3W90A 4D4LA 2OFOA 1UFQA 1KDOA 2BBSA 4RKFA 4PFSA 3Q3JB 1FPMA 3NVAA 4I1SA 2ZVPX 3R8CA 2QI9C 1BH2A 2F6RA 5LDDC 1B23P 1N6RA 2ZU6A 4LBYA 3SR0A 5G41A 4F7WA 2OLKA 3IPYA 1W4RA 3CLVA 2RGAA 1HE1C 3TVTA 1CJKC 4ERNA 2JDID 2OXRA 1E94E 3QXXA 4ACAA 4ZDKA 1K5DA 2REBA 1JPNA 1TX4B 4Z8YA 5FBRB 4LBWA 1W7AA 3X1ZA 1IQPA 2ZSDA 2ATXA 2H7VA 4LPSA 4AYXA 1R2QA 2NTYC 2XEXA 3LNCA 3KQKA 2BCJQ 3AVWA 5FH9A 2QU8A 5JZVA 2RGCA 2MSCB 2DY1A 3RAPR 3CF2A 2GXUA 1WCV1 1E2FA 1E2KA 2YNMA 1V43A 2R6DA 4QG7A 3TJZA 3VU9A 1T9HA 5SZJA 2GTPA 1NVVQ 5DYIA 5EXSA 2WTUA 3IIMA 4B47A 2P65A 2FFHA 2OBLA 2PLFA 4HAVA 2V55B 4H1VA 4S35A 4TTRA 3BERA 3NBZC 2VHCA 1SHKA 2YWEA 5AUPB 2BMDA 3K53A 2WIAA 1XRJA 5JWOA 2AXPA 2VTKA 3QVVA 4FN5A 1EFCA 4HATA 3LLMA 1NNEA 1YZNA 3FFBA 5JRJA 1PZNA 1XCMA 2ZAOA 4M9QA 1Z06A 2CLDX 5FPHA 5FTMA 1R0ZA 1Y3AA 3RDPA 5CLLA 2BIFA 4WXRA 4BPBA 1G64A 2ASEA 3B85A 1XCGB 3GEEA 1FMLA 2VHUA 4V0KA 2IS4A 3B1XA 2P6NA 1W0KA 2J3EA 2FE4A 4AG5A 4I1OA 2ZETA 2QBYB 1K8RA 1HURA 4Q9IA 1RJ9B 2IUTA 4Z1MD 4Q9JA 1N25A 1BYIA 5JHGB 3IEUA 3IUYA 1CJMA 4NONA 1FOEB 4YONB 4PZYA 2BDTA 4QHTA 4DWJA 2BOVA 3EARA 2KI5A 1II8B 3SYKA 1SKQA 2KB0A 4MYHA 2OEPA 1RYFA 3I3SR 3HU1A 3HPRA 4X8LA 1R4AA 3RC8A 5DLQC 4DCTA 3AP3A 1HT1E 4WBSA 1EFUA 4HI0E 4M0LA 4WAUA 4DUGA 4RKEA 3X1XA 4PQYA 1S1CA 1QHHA 2D7DA 1MABB 3PITA 3NBYC 4B43A 1FFHA 2NO1A 4FIDA 1NN1A 2PX0A 421PA 4L16A 4BFZA 3CM0A 2GEVA 2DPXA 1G6OA 3PEYA 2W0SA 2F43B 2A9KA 4IOMA 1WP9A 3C41J 4GZLA 3U2QA 2FEMA 2ZS7A 3THWB 2QMOA 5HE9A 3B60A 4A0HA 1CS4C 4LHWA 2Z6VA 3VKHA 2FMXA 1VTKA 3T12A 1U99A 4BLSA 1YRAA 4Q9KA 4AI6A 1F2UB 2HXSA 2B92A 1MV5A 5BN5A 3Q5EA 1TTTA 2CLCX 1TPZA 1NLYA 1P4SA 2CCGA 2P6RA 1RE0A 1US8A 1E79D 2A2ZA 2QAJA 3PUYA 4E03A 2AFHE 5CITA 1U94A 2AK2A 1U81A 1BS1A 3CRMA 3NBXX 5IRCD 3QQ5A 4QNRA 3W5JA 4RD3A 4QRHA 1NG9A 1N0WA 2YOGA 4U00A 3RS4A 2OG2A 3K0FA 4OHXA 3GLIE 4HAZA 4HAUA 1D9ZA 3V4FA 3BJIC 1NMZA 2W00A 4TMVA 1N3BA 2WAYA 2IT1A 3KXIA 1T3HA 2V1UA 1WMSA 3ZVRA 1XXHE 2R6GA 1E9CA 1LW7A 4QBGB 4DDTA 2YWHA 5JI3E 1RRCA 1VPLA 3KKMA 1BKDR 1ANKA 1D2MA 2ZQ5A 1E98A 1E2HA 4BWYA 2C78A 2ODWA 2BJWA 4DDWA 4U7DA 3UPUA 2G83A 5EP3A 4Z51A 4LYAA 4LSGA 4JKYA 4QGHA 4JL5A 1G9XA 4FXPA 1XTQA 1WBBA 1W36C 5F98A 1HYQA 1TAGA 2IYSA 1HY3A 3L0PA 1MOZA 3U7GA 3I62A 5TV2A 4BRWA 2ZI7A 3CF6R 2ZUBA 4LBZA 1N5IA 4URYR 5JEDA 3FWYA 2C9OA 1NP6A 5DHAA 4AKHA 1CXZA 2F9LA 1IN5A 2WWHA 3EWSA 3UXMA 5A4JA 4LJAA 5B30A 4EPVA 3I5YA 1W48A 5DGXA 1Z63A 3QXJA 3GPLA 4JBXA 4LX0A 1CP2A 3G0HA 1ZM4A 2QL6A 1F2UA 2GXSA 1E2MA 4LJ7A 3FMPB 1UADA 4IXMA 2I1VB 1KO5A 1RRPA 3CR7A 4JLDA 3AVUA 4MQBA 1UDXA 3L8YA 4YQFA 3D31A 1VIAA 1LTQA 2VF8A 1Z6AA 2ZYTX 4ZIRA 1ZYUA 1E2JA 1GAJA 1QHHB 4OQXA 3SJZA 1F5NA 4R9UC 1G8PA 3OFND 2WWFA 3DM9B 5FOTA 5CDFE 4PC1A 2Q6TA 4D4KA 4XWKA 2Q3FA 3OIUA 4JL6A 3CW2A 1GG2A 2H5EA 1RC8A 1SVKA 1M6NA 4YC7A 2RMKA 1G8GA 4XVUA 4TTPA 2H57A 4UXHA 4DSNA 1R7RA 2H18A 2CK3D 3BH7A 4B44A 5C18A 3HDTA 1E2NA 3KB1A 5KYKA 3EA0A 2G1KA 1XTIA 5B2ZA 1ZD8A 1KI6A 4ASUA 3GLFE 5J4YA 5P21A 5FTJA 4TL6A 3DVLA 4Q7KA 3BRWD 5CB8A 2ZU0C 2JLUA 1Z5ZA 3TMKA 1EFHA 3EC1A 4RD0A 2H1LA 5A5GA 1TQ2A 1AS2A 4C0QC 5LD2B 1VCMA 4HAYA 1XPRA 3U7FB 1MRNA 4J0QA 3TIFA 4FCTA 4YDHB 2GEUA 4IOKA 2VP4A 4HEJA 3GQBA 3RABA 1GNPA 3TQFA 2X2EA 4IVRA 1YZLA 4EJSC 3TBKA 3ZS8A 1OV4A 3B1ZA 3TW4A 4CEIA 4F4IA 4GL2A 5FPKA 3CR8A 5CJPA 2GESA 2FPLA 5FOWA 1N6OA 3FDIA 1DAMA 1VHLA 4I4LA 4OHWA 4Q18A 3QPUA 5G40A 1LF0A 1CJTC 4MRNA 2GCPA 2QT1A 3HU2A 3BC1A 1YHNA 4CGZA 2OV2A 5CK5A 3RRNA 2VSXA 1XMSA 1S9HA 3HPQA 3WXMA 3QF7A 2GZHA 1CU1A 2NO0A 2QP9X 2RGDA 3K70C 1VG1A 4Q9HA 1RRFA 3F8TA 3IQWA 4NL4H 3K0CA 3RRMA 2J59A 4Q01A 3FMIA 1P7CA 5AWFC 3KTAB 3S1AB 1Q57A 1E1QD 4KITB 3T5GA 1I2MA 3NG1A 5C4MA 1S1MA 4KJZA 5LD2C 3CWQA 1S96A 3SFZA 3B9PA 2ZRAA 3KKOA 1G3RA 4URUR 1UDWA 5J5CA 3ZYCA 1XEXA 4C0BA 5FPSA 4FW9A 2FGKA 2WWYA 1UEJA 4P4SA 3N70A 1II0A 1C9KA 5FTKA 5JS7A 2ZJYA 4IVQA 1YZTA 4OQFA 1R0WA 4UXJA 3LAWA 1IAQA 2ZSBA 2D2EA 3LW8A 2GVDC 4Q9LA 3FYHA 3QBVA 4NPHA 3ZVMA 4N1AA 4B48A 4LUCA 1OFUX 4B35A 1G41A 1Z6YA 1JR3D 2ZSEA 1G8HA 2JAQA 1T3SA 5LB2A 4XVRA 2QMEA 3KB2A 1P9RA 2A5FA 2H92A 1N6KA 3AVPA 3VR4A 4ASUD 1N6LA 2GF9A 2GJSA 4Q19A 1XPUA 2OFWA 1AM4D 5H68A 1QZXA 4I1UA 4IEEA 1H8EA 4TYPA 5AJYA 2EYQA 3A1SA 4DSUA 4DB4A 2DFNA 1Q1EA 3PUWA 5CDFA 2WOJA 2IYXA 3F3YA 4LJ8A 1T3LA 4DEYA 2UZIR 3GLGE 3IEVA 1Q1ZA 3AVQA 1GSIA 4EAQA 4AY2A 2J0VA 2FG5A 1Q1BA 4EQ6B 1XTRA 3ZS9A 4RD1A 4HUQA 1CR4A 1P60A 2G6BA 4P33A 4DLUA 3BH0A 3BFKA 3GLHA 3ZIAA 4DKXA 5BYJA 3LXXA 2OE2A 2FSGA 2ZRJA 1OE0A 3HR8A 4DLXA 1CR2A 1E2DA 2FA9A 1M1YE 2XTMA 2NZJA 3QKUA 3C16C 2EU8A 2HF9A 4HB0A 1EWRA 3IIJA 5D3MA 4HUTA 4R2IA 3QKSA 2VPPA 2GKSA 1UKEA 4DT1B 5FI0B 2BEJA 1FL9A 3K1JA 3J81k 4W5WA 3G82C 4JSYA 3K9LA 1P62B 2IA5A 2FN4A 2HJVA 3BGWA 2DCUA 3CRVA 4LYFA 1MO5A 2CMKA 2OAQ1 2QGZA 2ZEJA 2GJ9A 3AF1A 4DCUA 2FDCA 2FGJA 4LDJA 4PSVA 3I1FA 5FL7D 2GXQA 2V6IA 4QHSA 4RD4A 5JWRA 5IT5A 2J1LA 2R9VA 2WSSA 2O0JA 4O2LA 3AKDA 1U9IC 4OHVA 1JECA 4V0OA 2WPDD 4Q00A 1G19A 2IF2A 1KI7A 2FZLA 3GJ7A 1TU4A 1CJVC 1P2SA 2BM0A 2BVNA 5AUOB 2CCKA 1KK3A 3OAAD 3DM5A 2JJ1D 3IBYA 2QROA 2GCOB 4YMWA 3SE0A 4KYIB 1JXOA 1VG8A 4MA4A 1Z0AA 1TF2A 3BFVA 4PC3A 5SZHB 3UATA 4B3CA 4UXIA 2X77A 2Q0HA 4ARZB 1OB2A 2ZRLA 2V54A 3OE7D 1M8PA 2LKDA 2HT1A 4URWR 5SZKB 3F5FA 3PEWA 3IHLA 4B2LA 4NDZA 3RS7A 3I92A 2CNWD 5GVRA 3SJAA 5E3HA 5K8TA 1Y63A 5DSZA 3SS8A 3VQTA 4TT3A 4AK9A 1XEFA 1E6CA 2YJTD 4FMDB 4QBIA 1TADA 4DUGD 5FUWA 2GBLA 4IDQA 4TQ9A 4NCIA 1UKZA 3T15A 3VX4A 2QMHA 2REOA 4LRWA 5EE1A 1CJUC 1J2JA 2CJWB 2WV9A 1QHNA 5FPTA 2WOOA 2FF7A 4DLSA 4EPRA 1FQJA 1KDTA 2CNWA 2W2TA 2ZJBA 4P3YA 2FSHA 1T4GA 2GEDA 2ZJZA 5JHHB 1OLOA 1G4AE 2BMFA 3WYAA 1GRQA 4QBFA 2NPFA 2EFHB 2J0UB 3KQHA 4G5OA 2DB3A 4PAQA 1H8ED 1Z08A 4A8JB 5F9HA 5AJXA 2X19A 4WW0A 3UANA 1A5TA 1ZD1A 2OHFA 2JJ1A 4CT5A 4B3FX 2N1BA 1NBMA 3W5IA 1Z0IA 4XVQA 2HYDA 3WP1B 1IN7A 2VHTA 2ZRBA 1LFDB 3KFVA 4UJ3A 5KPJA 2OCPA 5DN6A 3BBPA 4OK3A 4AIIA 3CUEF 4Q02A 4FWTA 2VHJA 5L3SB 1A7JA 2J41A 1YR8A 1ZAKA 1G7TA 4OJKA 4C2TA 5FUYA 1E9FA 1E99A 4JSTA 1XD9A 5HTKA 3GEIA 1RW4A 4GMDA 4KO8A 2P67A 2Q9BA 2ZSAA 1X6VA 3QXHA 4D80A 1SHZA 1G4UR 5FTLA 3TH5A 3I8SA 4BFYA 3O8BA 3GLHE 2Z5FA 4E07A 4LHZA 1DAHA 4YXWD 1D6JA 1FX0B 3SC3A 1VYTA 1UAAA 3AKYA 4LPKA 3K8YA 1F6BA 2BHRA 2GAOA 3B8HA 2BMEA 4ZCIA 2QPAA 3AVXA 4Q7JB 3PUVA 4ESVA 1G5PA 1ZNXA 3OEHD 4XWOA 4M9ZA 2PL3A 4CEJB 3AF4A 1OT3A 3UMSA 5LB4A 2CE2X 4AD8A 2FWRA 2WJIA 2XJ4A 4X8HA 5IK2A 2X1VA 2R65A 1T5LA 4JBYA 5CIWA 3C7KA 1LV7A 1RYHA 3CONA 2YINC 4M1OA 1YZQA 5E7MA 5JECA 5BW8A 1D5CA 3QI2A 1ESNA 3ZD7A 4XOIA 4LI0A 1ZUNB 4P4UA 2AWOA 1RJ9A 1KYIA 4U5XA 4W5JA 3WYGA 4LY6A 2PCJA 4LJ5A 3RWMB 2Z43A 1R5BA 2Q3MA 2VF7A 3VTKA 4TYYA 2ODEA 2E1RA 3RSLA 3CX8A 1IONA 3LBNA 4JLKA 3CZPA 3NH6A 3WRYC 5JLJA 1CBUA 1WA5A 3RVBA 3LVRE 4XTCS 4JVLA 5JI2E 2HCBA 5DI3A 2OSBA 1J8YF 4UNPA 2G3YA 3BOSA 2QTHA 4EJSA 2A30A 1KO4A 2QT0A 3GJXC 1KO7A 2MSDB 1G8YA 5GJVC 1OH6A 1W0JD 1LF5A 3B1YA 4NCJA 1KAOA 3L8ZA 2D74A 5LPNA 3CX6A 3T1OA 2O8BA 621PA 3FOZA 3OEHA 3M1IA 1AZSC 4MYUA 2VIIA 3KUDA 5EE5B 3FTQA 4B73A 2AK3A 3M6AA 1Z28A 1Z6GA 4KFUA 3AH8A 1DADA 1E9AA 2LKCA 1GL7A 1UBCA 3B6EA 1MABA 1X8KA 2G77B 3OFNA 4PAMA 4ITRC 1EG7A 2NO9A 4HLUA 3ZVLA 5KDDA 2V1XA 2C9CA 1IY0A 4BLQA 3RYTC 2HLDD 3TGPA 4G5GA 1DG1G 1IN6A 1E1RD 1TNDA 3AEZA 2V3CC 3E2IA 4CYMA 2QTVB 1E2PA 3VHLB 1PLJA 5C4GB 4EDHA 1MT0A 1AQYA 3FE2A 2ZI4A 5FL3A 3WY9A 2BBOA 5JMTA 3BS4A 3IBGA 2IYYA 2IX3A 2ZR0A 3MJHA 3X1WA 3F0TA 1KI4A 2QM7A 4V0ME 4GI7A 5EE0A 5JSZA 5L3VA 1OXSC 3LQRA 4C4PA 1E9RA 1FP6A 3U3RA 2IHBA 4HSEA 1BYUA 4QJ4A 1XF9A 2DFKB 1KO8A 3QSYA 3AF2A 2QG6A 4HAXA 4PHTA 5EZ6B 2ERXA 5KHOC 4HDCA 5JJIA 4KXFB 2C95A 2ZIAA 2XXAB 1I2DA 3QJYA 3AGQA 5K8UA 1VG0B 4D0LB 4BFTA 1I4TD 4AG6A 5K8IA 2FFBA 2OILA 1S0UA 4JL8A 4G3XA 2AN9A 2ONKA 1P61B 1Z6TA 2G0NA 2VO1A 4TN1A 2GJ8A 3TKLA 4FINA 4DLWA 1LY1A 4BLTA 2QQEA 1M74A 3MSXA 1XTSA 1MKYA 1QVAA 1CR0A 1NKSA 1VECA 5JBQA 5EQTA 1CRQA 1GKIA 3U7EB 4R71A 2D3WA 2NG1A 3ZQ6A 3K70B 2ZI9A 2EQBA 1RRGA 2GHIA 4QXAA 6Q21A 1AS3A 1QHGA 2HV8A 2XZPA 3THOA 1UEIA 2GK6A 2NO7A 3EWAA 4RZ3A 5EXXA 3ADBA 2HYIC 4Q03A 5FBQB 3W6PA 5DI3B 2YZ2A 1A82A 4BLPA 1G18A 4Q5IA 3KKQA 4OK5A 4DLTA 121PA 4CIDA 1XNJA 2V7QD 1KI2A 4B6FA 1UBEA 4Q4JB 1OKKA 2IWRA 4KFSA 4BQSA 2QE7A 1AN0A 2HUPA 4NTZA 4FWIB 1BIFA 5D3MB 1XMIA 2PT7A 4JJZA 1GRNA 1HT2E 5FPYA 4JLNA 2DWOA 1XMJA 3U60B 1W2HA 4BUJA 4A8JA 5FBVB 2IYVA 1VCIA 2ZRIA 2XTNA 4G1UC 2O8DA 4DLYA 3WMEA 4MITA 2WSMA 3ZQJA 1FMJA 4EFLA 2ORVA 4L4UA 2QE7D 4QNMA 2JLYA 1E2IA 3Q7QA 4OQMA 2ODBA 4Q21A 4Q1DA 1P3JA 1QVRA 2JLVA 3QPVA 4GOJA 1HA3A 2OM2A 4B3XA 5AUNB 1S3GA 1GITA 1HQYE 3HP1A 1DG3A 5EUQB 4ZKDA 3VNVA 2IYZA 2JASA 2XNDA 3CPHA 4MKHA 2WKQA 5EE3A 1YJ5A 3K0FB 2OFXA 4L8GA 1JBKA 4YXWA 2B7CA 3A4NA 3IQXA 3DL0A 2EYUA 2WMNB 1QF9A 3C5CA 4QM7A 1Q12A 3ND8A 1IHUA 2XAUA 4Q1FA 4TMXA 5JJLA 1HEIA 3OEED 2C5LA 4BLRA 2BC9A 3TUZC 4IFEA 2AFIE 4IHQA 5BXQC 3MD0A 1ZW6A 2PEZA 1H8HD 2PZEA 3PXGA 4K81B 1TF5A 3SYLA 2G88A 4WIAA 2ZPTX 3RRYA 2VEDA 1HE8B 1Z8FA 1OF1A 2CDNA 2IEZA 3MWLA 4DRZA 3MLEA 2EVWX 3L2OB 1KHTA 1GFIA 2W2VA 1Z22A 821PA 2WHXA 1P5ZB 4AKEA 3KJHA 4B75A 5KTYA 4RFVA 1XPOA 4JIMA 2A3RA 1MR3F 5IF9A 1ZCAA 1D8TA 5FOUA 4DDUA 2CL0X 4G5QA 2ZUCA 3PENA 4TLEA 4TZ0A 4LC1A 1YRBA 4QC2A 4C0LA 1MO3A 2W83A 3DO6A 1S8FA 4JJKA 2FSIA 3S1AA 1SVIA 1K5GA 2WWWA 3WNCA 3K70D 4PXAA 2CE7A 2ORIA 3K09A 4JLMA 1CIPA 4JLVA 1Q44A 2I1QA 1Z07A 4S2EA 4UNQA 1G20E 5AJZA 1Q0UA 2E9SA 1NVUQ 3K9NA 1ZM9A 2GRJA 2A5GA 4MGYR 1I4LD 5A0FA 1Q21A 4NYIQ 5BN3A 2ANBA 3QUSA 1US8B 4RCYA 2BMJA 4PTLA 3EIQA 2VQSA 1NJFA 1DARA 3K0EA 3NWJA 3CH5A 2C03A 4IW3B 5F3WB 3LX5A 2ANCA 3V9PA 1AGRA 4QGAA 2WMOB 4BASA 2W6JA 4B71A 5DYGA 1JJVA 1O3YA 4KHZA 2HCJB 3CNOA 3WMFA 4C0JA 1OH7A 3SQXA 2AD5A 1J90A 2ZS9A 3SBDA 4M1YA 3ZLJA 4RD2A 4NCKA 4KFTA 2PJRA 1W4CA 4PZZA 3GLFA 1XJQA 3C5HA 4B74A 3RC3A 1FP7A 4QJ3A 5IDVA 2AD1A 4EPTA 1RZ3A 2XOKD 3HU3A 1TEXA 3QG5A 3ZH9B 1HTWA 4W9MC 4C0HA 2IYLD 3WHLA 3KJGA 4UQOA 4AKGA 3AVOA 4HLDA 4C30A 3CIOA 3V00A 1PLLA 4LJ6A 4KYUA 5AJWA 1YZKA 2V9PA 3VX3A 1WQ1R 3KKPA 1E2LA 1UJ2A 5TB5A 2QAGB 2QNRA 1UBFA 3KL4A 4PHGA 2NPIA 2REXB 2NZ8A 3U3MA 4WXPA 1AGPA 5JCZA 5EP4A 1M2OB 221PA 1KSHA 2O8DB 3WMGA 2KE5A 4D82A 2ZAMA 5DIFA 4NHOA 3AP2A 3OIVA 2V4ZA 1KSJA 1ZBDA 2O8CB 3CRW1 3I72A 4IXNA 4EIWA 1PVOA 4CF7A 5J4VA 5JS8A 1KI8A 2FZ4A 2ZI6A 4P4TA 1R0YA 2IW3A 4AYTA 4FD2A 1YU9A 4BEJA 5HZHA 3ZD6A 1NVXQ 1EK0A 2QY9A 4KVAA 4XSGA 1ESMA 3DPUA 5HKKA 4M1WA 2YYZA 5ELXA 2L0XA 5TDHA 3A36A 1PLKA 2VSOA 3LFUA 1WF3A 1QDEA 4G0NA 4LYJA 1GZSA 1XBTA 3N2IA 4D6PA 4QFMA 3TK1A 1JQLB 2BEKA 1T8TA 1E1RA 1SVSA 3VMFA 3KJEA 1N6PA 1Z0DA 2QTFA 4LYHA 2EFDB 3ADCA 3U7HB 1A2KC 3PCRB 4NU0A 1W0JA 2ZYVX 1SXJD 3VR3A 2ZR7A 4D2IA 3G5UA 4LJ4A 3QNUA 4HDOB 1GDDA 1NMXA 2YOFA 3I61A 4LHXA 4G01B 4HAWA 4A6PA 2R44A 1KIMA 4PPGA 1SVLA 2J7PD 4WA7A 2JIZA 1Z3IX 4F92B 1Q20A 1ZNYA 2BV3A 2X8AA 2ZITA 5KNCA 5EZ5A 5TXGA 4M9XA 4LHVA 4M53A 4NZYA 1FTSA 1Z83A 1P75A 5FR1A 1E0AA 4ABYA 4PAOA 4JMPA 3OHMA 1ZIOA 3AUXA 1OFIA 3I73A 3QKRA 4H1UA 4KBFA 1JR3A 4PPFA 2F1JA 2J7PA 2D2FA 3CPJB 1KI3A 3SI7A 5GVSA 3QVUA 1U90A 1NSTA 4I1VA 1P6XA 4BFSA 1HV8A 1GM5A 1KI6B 1G3UA 4FMCF 5J40A 1EWQA 4A2PA 2CL6X 3W9YA 3T34A 4Q4HA 1JI0A 3R7WA 3VFDA 1KNXA 4OK6A 3NHAA 3GEHA 1GNQA 2DHRA 3LWNA 2C9YA 1IBRA 1XEWY 2CK3A 3Q7PA 4AURA 2QSZA 4NCNA 2JIZD 3O8CA 2IYQA 1ZU4A 1XEWX 3DZDA 4MGIR 3TSZA 3TUIC 4TQAA 3GJ4A 2PX3A 1HH4A 4QBHA 1DAKA 4KCGA 1NLZA 3LDAA 4GNKA 5H70A 2PZFA 5LBIA 3JVVA 4YMTA 1TQDA 2YC2C 1QHXA 3DMNA 4C0SA 2XSZD 3I32A 4QOSA 1N5KA 4B2IA 4A2WA 2ZRGA 3CNLA 2SHKA 5B64A 4L9SA 4G5RA 2MSEB 1XJCA 1L4YA 1GL6A 2Q21A 3WBJA 1K6MA 2O0HA 2RGGA 4HB4A 4XJXA 3ZGXA 1X8JA 3HJNA 1WB9A 5EP1A 1TEVA 4D81A 1E9BA 3QENA 3ZZ0A 2IS2A 4URVR 5TMPA 3AQ4A 3LBIA 1JR6A 1X86B 3T1TA 4D4JA 1F48A 1CF4A 3CF0A 1YQTA 2VP9A 4P4SB 5HKKD 3FKQA 4C0KA 3IILA 3QIAA 4Q4HB 5C2JB 1ZU5A 1FUKA 4HUQB 4JLJA 4B6EA 2ZM5A 3D3QA 3SNHA 1NSFA 2OCYC 4Q4AB 1G291 4OJQA 5UKDA 3AB3A 5B58C 3X1DA 4HYYA 3IPXA 3O47A 4A92A 4PSKA 4KU4A 1W4AA 5ANRB 2FJUA 3EIEA 4NYMQ 2NIPA 3EW9A 5FFMA 1Q22A 5IK2D 1ETUA 1FNMA 4LV6A 3CWZA 5KNDA 4GRAA 4BZQA 4DDVA 4HZUA 3VR1A 1KKLA 2O8FB 5KUTA 2IXFA 1BOFA 1XB2A 4JYCA 2I3BA 1G16A 1KMHA 2F3TA 3R20A 3L0IB 1ZM7A 1G1MA 2R6CA 4WZAE 1JJ7A 3SFVA 4L5BA 1PV4A 1CLUA 2W2XA 1W36D 3V4RA 4M4SA 4CEHA 3C4JA 3MWKA 1KNQA 4Q66C 1MH1A 1DAEA 4JBWA 3C15C 2A5DA 3DHWC 4R2HA 3GD7A 2GVZC 4M1KA 2GNOA 3X1YA 1XU4A 4A2QA 2J45A 4B3DA 4DIDA 3LA6A 4CDGA 1MO6A 2B6HA 4GP7A 1Z0FA 1T0JB 2GCOA 3GFOA 5J47A 2BBTA 1IJFA 2WIBA 4B3GA 3DMDA 3U3OA 2NGRA 4B3BA 1E79A 4FMCB 5FOSA 2J5XA 3FHCB 3OAAA 3CH4B 2O8EB 1ZCBA 3FPAA 3QKSB 2EFGA 4ILEA 3SN6A 1AA9A 4ACBA 3AV0B 4B76A 1U98A 1JAHA 8OHMA 1Z6XA 3QXSA 1NMYA 4O0MA 3TNFA 1F3OA 2ZE6A 1R5OA 1G5TA 1M34E 1LVGA 3I5XA 3B7GA 2KSQA 3MRSA 4RZUA 3O8DA 4XWAA 4V03A 2R62A 1I4DD 3BFXA 2QAGC 3ASZA 5GJBA 1S2MA 2WAXA 2C96A 3T61A 4AWXA 4JVSB 3H0KA 1XZQA 2ZANA 4MKIA 5KSPA 3KFXA 5L3QA 3U44B 3PR1A 1U8AA 1ONBA 4A1FA 1TQ4A 3PUZA 1S9DA 4NYJR 1EXMA 3A1VA 3P20A 2QORA 4OQNA 1L7VC 4Q7LA 3L0OA 3VKWA 1IY1A 2R6FA 4HDQB 3ND9A 4PPNA 4C7OA 4I99A 2G9NA 4BFWA 3SYNA 1UF9A 2PMKA 1DE0A 5HPYB 2BKEA 2YHSA 3ZZUA 3D8BA 5L3RA 4BFUA 2G0TA 3CO5A 3RNLA 4EPWA 3L0SA 2CCJA 3KQNA 2HLDA 1FW6A 4N3NA 1IJEA 2HF8A 5C1BA 1N6NA 1U9IA 3FMOB 4LC0A 4MRVA 4TL8A 4RD6A 3HWSA 3BK7A 2VH5R 1VCOA 2DYKA 3K9GA 3SJBA 4JT2A 4LHYA 2NO6A 2QRNA 5HE8A 1OYWA 2HDNB 1UM8A 2WJYA 2WM9B 2IEYA 1JR3E 1R5NA 4RZ2A 1DEKA 5HCNA 4BRUA 3U3JA 3LY5A 5CLQA 2IXGA 2DFTA 1CULC 1G3MA 3OF5A 2CHGA 2O0KA 4XD7D 1E69A 2Q9CA 2ZVQX 4D0GA 1HUQA 3MWJA 2LWIA 1TF7A 2CL7X 1OKKD 1FX0A 2QPOA 4UNSA 1NIJA 4C3ZA 3AGPA 4Y0AA 2GJAA 4UJ5A 4FMDF 3A4MA 1TU3A 1VKJA 1GVNB 2GK7A 1KTVA 2JA1A 3SOPA 3SJCA 1YZGA 1W44A 4OHYA 1P73A 1C4OA 4QL3A 5G3YA 1XTJA 4Q47A 1L8QA 4CEJA 2NMVA 1E2GA 2QZ4A 1J8MF 1OH5A 2ZJOA 1XXHA 2IS1A 2FEOA 3P1JA 3K9HA 2DFLA 4RCZA 2QSYA 5G3ZA 1JNYA 2PMDA 3W8NA 5DNYB 4OL0A 2TMKA 1OB5A 2OBMA 4F4JA 1VIYA 4XIGS 3THYA 2JCSA 1GKYA 1R10A 4NYIR 1FZQA 1P72A 1JPJA 2JJ8A 1KI1A 4JLAA 2O8EA 4MDFA 1Q1QA 3EPLA 3SHFA 4WOPA 1GWNA 3N2EA 3PFIA 4JS0A 3PEUA 3K09C 2GETA 3REFA 3L43A 2OAP1 1XDBA 2B8TA 4D25A 1XFAA 3EIHA 2JGNA 1E4YA 3KX2A 4BECA 1E2EA 3DZ8A 3PQCA 2XJ9A 3QG1A 1ZINA 5GADl 1QG2A 2WZQA 3CZQA 2J9RA 1KK1A 4NYJQ 1NY5A 2IXEA 4Q48A 4M1TA 4IKEA 4W7SA 3T1QA 5B57C 1UKVY 3BB3A 2GZAA 3LBHA 1DELA 2E87A 1YKSA 2BJVA 2JLWA 1RIFA 3KXLA 3ICQB 4EPXA 1G6HA 2VHQA 5JEEA 2AWNA 2J0SA 5KSZA 5GJCA 5JCPA 4WZBE 4XH9B 2IC5A 1Z2CA 4P32A 3P4YA 2QENA 3OIWA 3LH5A 1KSGA 2ZI5A 4YMSA 2VL7A 3P32A 5F2EA 4ZKEA 5KSOA 2O52A 1E96A 4ZPXA 4Q4LA 2ZROA 2ZJ2A 4OHZA 4EQ6A 1GNRA 4MKFA 5H1YA 1CR1A 4DZZA 2W6IA 1JEEA 4FCWA 5DN6D 4Q4AA 1B0UA 1DAGA 2FFQA 1BO6A 1NL3A 2IF0A 3A4LA 4R98A 1SXJC 1Z29A 3GFPA 1P2TA 2JJ2A 3SU8A 2IUUA 3THYB 3EZ6A 2NQ2C 2UZ3A 1ZC4A 3UWOA 1W46A 4K46A 2CVFA 4C9BA 3PV0A 1W4BA 2XXAA 2FX3A 4DLZA 1N6HA 1WRBA 1XX6A 3TSOA 1LNZA 1FQKA 1ZP6A 1N2CE 3B9QA 1GRRA 4F91B 5HR5A 2VLIA 4IOLA 4BLOA 4V02A 3SZRA 2ZS8A 4Z8XA 3T5DA 1COWA 1NVWQ 2RHMA 3QEJA 1QRAA 2ZE8A 4NCHA 3T1VA 1OXXK 5HZKA 1COWD 2XITA 1W0KD 1Z0KA 1U8YA 1U0HC 1IXSB 5FI1B 3VU9B 2ZUDA 4L9WA 1W2GA 1NF3A 3DEFA 4JYBA 5CYPA 3TR0A 4TL7A 1J70A 3I8XA 2WKRA 1SGWA 3D7MA 3GLGA 4KV9A 2ZXUA 3R9WA 4DEXA 4F4CA 4LZZA 3PG5A 4DCNA 1Z0JA 2QPTA 2ECKA 1G7SA 3DKVA 2IBMA 2XB4A 3KZ1E 2F7SA 1Q3HA 3UIEA 5BWMA 3UMRA 1KDRA 3WBKA 1A1VA 4BE7B 4QGFA 5E95A 3GJ8A 5FUVA 4Q7MB 1QHIA 2Q9AA 3DDCA 3EPJA 1VYUA 3TAHA 3WNBA 4E22A 1T91A 2MMCA 5K8LA 4OYHA 5JSZB 2WJJA 3IKJA 2EFEB 5GJWC 1DOAA 2WPDA 1VHTA 1GL9B 2CHVA 4K8OA 1N0VC 1SVMA 1GIAA 2GWHA 2B8WA 4PZLA 3EX7C 3U6KA 3LW7A 4TMZA 2RHDA 1OIWA 2XNSA 4ARZA 4KODA 2XZOA 1NY6A 1H8HA 4PPQA 4JT4A 3IDQA 2AXNA 2IL1A 1XZPA 2ZJ8A 1KGDA 4UNRA 4HZIA 5FOVA 4IDOA 4JLBA 4EKDA 3U4QB 4DC9A 3Q72A 5FBLB 2F55A 3HYTA 4GFDA 1YR6A 1TL7C 3KKNA 2F1HA 3AKEA 4A8JC 1U0JA 1BMFA 1TQ6A 4KLNA 3B82A 1OHHA 3GLGB 2RGXA 4RVCA 1JB1A 3UK6A 3FB4A 1O87A 3X2SA 2FNAA 4QM6A 1XD2B 5L3SA 4II7A 5CB6A 2D06A 3NXSA 2EWVA 2PZGA 1NN5A 2IYRA 3WRXC 3PEVA 2OO7A 1IOZA 2GA8A 2ZJ5A 1YR7A 3DOFA 3KTAA 1IXZA 3CKLA 1CEEA 3R9IA 4MGKR 5AK0A 1M7HA 5KO2A 2D4HA 1SQ5A 4IOJA 4EJSB 1OIVA 2OBNA 1A4RA 4GOXA 4ZV4A 3ONWA 2GF0A 3BE4A 2IK8A 3EC2A 2ZRPA 2JATA 1YZUA 5FOXA 3A1TA 4AYWA 5J4LA 5KSYA 5H8WA 1X3SA 3T06B 3A1WA 2VP6A 5FUXA 1RVDA 3EZFA 4GDFA 1OXUA 4NMMA 3QPWA 4PO8A 4PHFA 2FFAA 2RB4A 1TUEA 2XZLA 1D2NA 1II9A 1IXRC 3TUJC 1SVWA 1XXHB 2A5JA 4ZDJA 2ZE5A 4C2UA 4X8OA 2CHQA 3UMFA 1R8SA 3U4QA 4DCSA 3FGNA 2RAPA 1EESA 1SZPA 3GLFB 2N46A 3U6BA 1F60A 2OCBA 2F3RA 3KJIA 4GT1A 4DLVA 2W6JD 2RGEA 5EXPA 3KQLA 4KBGA 3MUFA 4GPTA 4RSGA 3PIRA 1OXTA 2QGNA 4W5HA 3K0SA 2YWFA 2QUZA 3B5JA 3C14C 2F1IA 1AK2A 4OI0A 2OESA 4TT3D 1DAFA 2P5TB 3UG6A 1QBKC 4A6XA 2ZSFA 2DR3A 1KZ7B 3SQWA 4PANA 3L82B 4ZCLA 1W1WA 4IJMA 4TMWA 1FNNA 4NE2A 4ZI3A 3EZ2A 3SDZA 3TAUA 5FTNA 2HJGA 3THXA 1XP8A 3ADKA 4PC6A 2DBYA 1AKEA 4DIEA 3GJ6A 5FL7A 2ZRHA 4Y0VA 4LOAA 4X8MA 4N0DA 3IHWA 521PA 1JALA 1NN3A 3ETLA 3H86A 2B21A 2FSFA 3LVQE 3NC0C 1ZM2A 2JJ2D 5BN4A 3AVVA 3A58B 3GJ0A 1DBSA 3WP0A 3EG5A 4A82A 4O3MA 5CK4A 1ZIPA 3CNNA 1AQUA 1J99A 1PUIA 4FMBB 4DT1A 3C8UA 4V0NA 1N0UA 2F43A 4NBSA 2EFCB 721PA 3Q5DA 2R6AA 2XX3A 4JLOA 4MKGA 1DTSA 4URZR 2GXAA 4TMKA 4OI1A 1D9XA 4LCBA 1NN0A 2CVHA 3LV8A 4BEBA 1RPZA 1OSNA 2H16A 1DO2A 1CTQA 3TW8B 4WVFA 2O8CA 1HQCA 5CM9C 4DSTA 3TE6A 1XD2A 1R0XA 4QHYA 1S3SA 2V7QA 2J87A 3M4YA 4TMTA 2C2HA 1VG9B 4GSYA 2XTZA 4YMUA 2QAGA 1YR9A 4GMXA 2Q3HA 3HYRA 1ZMXA 1F2TA 1GKUB 2LCFA 5G53C 2WJHA 4OQLA 4B33A 1G3IA 2BWJA 4E09A 4B34A 1Z2AA 5EE9A 3QF4A 1EFTA 1XJ0A 2KWIA 2X2FA 3KDSE 2RGNA 3B1WA 2ZRDA 2ZJAA 3BIFA 4DSOA 1II8A 2KJQA 3NHBA 4ON9A 3I4LA 3NDBB 1OFTA 1U8ZA 3RLFA 3RWOA 2XSZA 4POAA 2JLZA 1SKYE 4CEIB 4KI0A 2WBLC 4LWZA 4MRRA 2P5SA 2AKYA 5HCIA 4O25A 3RS0A 3GJ5A 4XTRA 1XMVA 1M7BA 1C1YA 3MJRA 5DHFA 2JLXA 1AKYA 1P2UA 1VCNA 2IYWA 2FH5B 4LJ9A 2Z83A 1OH8A 3RHFA 4YDSA 1DPFA 2PJZA 4LV5B 3RS3A 1GILA 5JJKA 2YKGA 5IHPA 4KLZA 1SKYB 2Z0MA 4MYCA 3R7WB 3FHTA 4OKSA 3LQQA 4NYMR 4WZ6A 1E3MA 5TVKA 3NEYA 3IO3A 1LS1A 4U02A 2IYTA 1P2VA 2QEQA 4DBLC 4A15A 4OI2A 1ZC3A 3OIYA 1V5WA 1E1QA 3MWYW 2QM8A 5DO9A 1KK2A 4MGZR 3EASA 4US1R 3ASYA 4Q1CA 4GOKA 5KU1A 3W8RA 4O2RA 4TYNA 2ZR9A 1ZNZA 3RS2A 1EX6A 5CM8B 1OHHD 2H17A 2C98A 1QHSA 4CRWB 1KKMA 1JEDA 2XOKA 4MRPA 3THWA 2ZRMA 3WYFA 3R8FA 3ADDA 1R8QA 3E5HA 3AVYA 2ODNA 4KSBA 3EZ9A 3Q85A 4NP6A 3REGA 1OPXA 1ZNWA 4UNNA 4NKRA 3GJ3A 3QOFA 4MH0R 1IN4A 1RKBA 2QMUA 1KO1A 1XTKA 3WHKA 4GBMA 2J46A 1KZGB 2UVQA 2AX4A 3ECCA 4TTQA 3VR2A 4HB3A 4CZ2A 3CB4A 2A78A 4YLGA 3H1TA 2W6ID 3RRZA 1JXMA 2D7CA 5DH9A 5TY0A 3THXB 5BQ5A 4LV8B 2W0MA 1PJRA 3FVQA 3PJRA 5AR1A 3CX7A 2B7BA 1Q3TA 2EW1A 5FR2A 4US2R 1CRPA 3ICEA 2VP5A 3E70C 4P31A 1W47A 4V0LA 4E5UA 4M1MA 3FHOA 4KAXA 1NIPA 1UBGA 1OJLA 3MFYA 2ZRFA 2ATVA 3TLXA 2OLJA 1GUAA 2CEAA 3IGFA 3UWKA 4IDNA 2IYUA 4TQUS 5EXTA 5BYKA 4L15A 3NTUA 1ELOA 1KAGA 4QJ5A 3W3ZB 5DISB 1U2RA 2EWWA 4HB2A 4F38A 1KY3A 3CRRA 4P0TA 1ZUHA 4ZDWA 2J0UA 1G8FA 1DS6A 3AM1A 4KSCA 3P4XA 3MMPA 3AVTA 4ZI2A 3FFAA 5M04A 2VRWA 1E9EA 1SXJA 2ERYA 2V8OA 4XD7A 2BKUA 1H65A 3EPKA 1WBDA 1RFLA 2CXXA 2WICA 1WXQA 2WWGA 4RJLA 3B78A 1N6IA 4A9AA 1X8LA 2KBEA 1JAIA 1KY2A 2GCNA 4F93B 2OT3B 1F2TB 3K0AB 4EFMA 3N5CA 3QKTA 1T0HB 1UKYA 4IFBA 2JEOA 4JVMA 4D4MA 3BD9A 4JZKA 3VKGA 3GLIA 4RFSB 3R9XA 2HT6A 4MRSA 1WDTA 2OZEA 3TR5A 1IM2A 1OYYA 3TVDA 3VAAA 1E0KA 2FPMA 3CRQA 4PR0A 1NBME 1GTVA 2PBRA 3JZMA 1EGAA 4TSFA 1XD8A 2W58A 3OE7A 1KMQA 4XSHA 4IDHA 2CLSA 1E32A 4PC7A 4ZIRB 1E4VA 2BM1A 4Z1MA 4UKDA 1SXJE 4QKQA 3B13B 3IO5A 4BFXA 3KUCA 1VMAA 2F9MA 2PCLA 4CW7A 2OXCA 2ZRKA 1LB1B 4IRUB 2MMGA 1XWIA 2WJGA 1FTNA 1KJYA 2RCNA 5KOYA 2P3SA 5TARA 5AJVB 3ZVNA 1TMKA 3FKSA 4OBEA 4IVPA 3AP1A 1GOTA 3K0CC 4PO1A 2R8RA 3AUYA 5E4FA 5SZIA 2IWHA 1ZRHA 2YVUA 4A0GA 2GZDA 5FBWB 4BZPA 4CT4B 3W3AA 4M2LA 4ESHA 5JRZA 1JQJC 1U0LA 2VP2A 3DKPA 1GP2A 4PC2A 1NVVR 2F1RA 1NKTA 3ZZTA 4IDPA 3EXAA 1SXJB 1NG1A 3QY0A 1KI9A 2QA5A 2JLQA 3OESA 3M0EA 2WJVA 2ZYWX 4FCVA 2A7QA 5E7IA 4DJTA 1X1RA 2JLRA 5CYOA 2RKOA 1G3QA 2QRZA 3VR6A 4A36A 3BWDD 2DWQA 1FUUA 3A8TA 1WE2A 3VR5A 2ZE7A 2C77A 1E9DA 1E0SA 1QHYA 2J7KA 3NBFA 4NH0A 2AKAB 4PQFA 5CIQA 4PSAA 3CBQA 2OCAA 2J0QA 5F9FA 3GFTA 3IIKA 3LXRA 3ZIAD 2CJWA 4DVGA 3SBEA 2OUKA 3RANA 3NH9A 3VHXA 4IEIA 4DHEA 3OEEA 1S4QA 3BAFA 4Q1AA 2XB2A 3TSWA 3EAQA 3LX8A 1D2EA 4A4DA 4BZXA 1KDPA 2P6UA 1T6NA 1VDZA 1R6BX 4M1SA 2FU5C 1SULA 1VYVA 3H84A 2PT5A 2G1JA 4M22A 5EUMA 4C7OB 2XNDD 3QF4B 2I4IA 4AC9A 2ZREA 2NOAA 1ZD9A 1DO0A 1XEXB 3BORA 3KXKA 2C04A 2RGNC 1AZTA 1ZVQA 3VNUA 2WWXA 3Q8XB 4Q4JA 1OIXA 4DLRA 4HLQB 3TRFA 2JLSA 2GDJA 2ORWA 1W49A 4TYQA 2YWGA 3LO5A 1DAIA 4A0FA 4D0NA 1E0JA 1EX7A 3A1UA 3MG9A 2YV5A 3CPEA 3ZJYA 4LJYA 2AL7A 4BFVA 1AIPA 4M21A 2P2LA 1SVOA 2WSSD 4TSFD 5DI9A 4TLAA 2Z4RA 1G7CA 2KBFA 3BH6A 1N5LA 1KSFX 1W5TA 2Y8EA 3Q9LA 3D6TB 3RSOA 5L3QB 3GP8A 3U44A 1EFRD 3AF0A 1YE8A 3AKCA 1AS0A 4URXR 1MRSA 3WNDA 2IUSA 3EZ7A 3P26A 4RFSA 4PX9A 4DB2A 4CVNA 2YC4C 3E1SA 3QEOA 4H9GA 1A2BA 1IY2A 4MYTA 2VSFA 5J4KA 3JZAA 4N0EA 5JWHA 4A0RA 2C99A 2K5UA 3QE0A 2R2AA 5DE3A 2FPKA 1G21E 5L8VA 2O5VA 5KNBA 2C8VA 2Z4SA 5E7JA 4RZXA 4Z54A 3BXZA 1TUIA 1KOFA 4D26A 3GLHB 4PQRA 3NKVA 3SEAA 4OI4A 2QP4A 4JVNA 1CKEA 4EUNA 3O8RA 3T35A 1T5IA 2WKPA 3HR7A 4RY2A 2V6JA 1LS6A 1J7KA 3TQCA
chains in the Genus database with same CATH superfamily
4CKBB 2PIAA 5F1PA 4KVGA 5BV8A 3AHGA 2BSXA 4HLUC 1KFCB 1NI4B 2IHYA 4XYEA 1RJFA 1E2QA 1NBAA 4GXNA 4A0SA 3AOEA 4ZCMA 5ED0A 1A8IA 2QN6A 3SYMA 4GZMA 3QKRB 3QVSA 5BT9A 4ZEVA 2JHPA 4FNOA 2FRDC 4ZO7A 3BB4A 1G7RA 3GUHA 1K2WA 2FV8A 4GXRA 2GJKA 5C31A 3ZGNA 3L93A 4YMVA 3HK2A 4TWZA 2GK4A 1MX9A 4QSMA 3M4JA 5HUJA 4LF6B 2XYGA 3LD9A 1Q15A 5KPDA 3EVZA 3UG7A 3ABSB 5DP2A 1G21A 4NJMA 5F76A 1KSGA 4JQZA 4BP3A 1J07A 4QZVA 4MUBA 3EFBA 2WVJA 3FSJX 1E8DA 3R0JA 1R6UA 1H0SA 4TLCA 3RUCA 2VCHA 4N8DA 1G17A 3VOAA 1J09A 4MQLA 3ZWAA 2VG8A 3O73A 5EHNA 4MEBA 1M7GA 2O9JA 2V4MA 3RBAA 4F6LA 5AUQA 5FUWA 2JDIA 1NJGA 4ZMBA 3HBNA 2VWQA 1BMFD 1ZM3A 3B1VA 4HLCA 1I4OA 4Q1EA 3IMFA 3SHWA 3TX6A 4A26A 1E9VA 1X1SA 3WB0A 4YLYA 2VBCA 2V7GA 5IYZF 4U63A 3Q40A 4E13A 2P0EA 3SJ7A 2J9FA 3KWMA 3IULA 3NT4A 1PFQA 1Y5IA 2HPAA 1RKUA 2R1TB 4JEHA 3TZQA 4DXAA 1KK0A 1UBUS 2WKSA 2ZUTA 3HEBA 1W93A 2MOKA 2QHXA 4B80A 3M7IA 4B3IA 1WEKA 3G2MA 4K5QA 1HTBA 4W8GA 2Q7XA 2UKDA 1ML3A 3MCAA 1REQA 1PL0A 2PX8A 3UOGA 1IBSA 3I5AA 2W4QA 2PLRA 2YJ5A 3CUUA 4PSDA 4TLDA 4IXDA 2RH5A 4H7KA 1ODFA 4OMCA 4OIFA 4C21A 3KP1A 4R31A 2IEDA 4F0JA 4BGDA 2ZPAA 4M0UA 3HM9A 4X6UA 4PG4A 5KDLA 4WUTA 1EFRA 1K7SN 1QGUB 2PGAA 3K5WA 1CFJA 1CNMA 1SOVA 2C7BA 3HJHA 4ZWNA 4TKMA 1AUQA 2OUIA 3IUQA 3T3DA 1TZ2A 4EMUA 1BNCA 1I1QB 1JVBA 2PX2A 5EP2A 2D5CA 4ZZ1A 2IS6A 1NLFA 2N47A 4F3TA 1G9TA 1SEVA 4MAMA 4TZ6A 2FETA 3Q8LA 1G59A 5EQJB 2DJ5A 4UHEA 2BCGY 4NFYA 4OGFA 1EZ1A 2EGUA 5L3ZA 1H1TA 5BPHA 1BGVA 4C0WA 4GHWA 1QDUA 3JVUA 5MDHA 4YPOA 5IEJA 1J7JA 3B51X 3W9BA 4MVJF 4WN3A 3TE7A 3NPAA 1OROA 4GP6A 3KR0A 5K20A 4YCCA 3W90A 4H35A 3BMQA 4D4LA 1H4QA 3FA2A 4HDKA 2BBSA 3R5KA 4L0MA 5J1SB 4MKXA 4PFSA 4PEVA 3Q3JB 3IFSA 4W63A 5B3JA 3WHPA 2X5XA 2W2OA 2QD3A 4M38A 2F6RA 3V6MA 3LPDA 1L1QA 4EGSA 4FCCA 2JEZA 2RHWA 1AQLA 3HJAA 5FNVA 4LCEA 5ECYA 1KGSA 1UPUA 4ECAA 3QXXA 4ERNA 1E94E 5HX7A 1K5DA 1OOEA 2OK8A 2PM8A 3D81A 2R0QC 1QMGA 5A7HA 4YGYA 3K8ZA 1H2EA 3FOWA 4L27A 4M49A 3NEPX 1DQZA 1L7BA 1VIMA 1RXVA 2E4VA 2V7UA 3E48A 4LPSA 4UAJA 5EMJA 4BBAA 4LF9B 3Q7RA 1R2QA 2GI4A 2H1SA 3DNFA 1Y3FE 1LBSA 3AVWA 3UCEA 1BS2A 1EVYA 2QU8A 2FLVA 4YIKA 2RGCA 1OXKB 4RTJA 2H5LA 1UMBB 2H1WA 3RAPR 3QFFA 2XT9A 2GXUA 3WGOA 5LQAA 1NV9A 1W581 3HYCA 3D59A 3VPDA 1X1AA 1T9HA 2GTPA 1UBOS 2I6TA 1AD2A 1NVVQ 2F3UA 3QFHA 2FZEA 1J2TA 1IHYA 1T5DX 3WMWA 4AUMA 1U5CA 2ZFUA 1QP7A 1WABA 4ME6A 2OBLA 2PLFA 2OC4A 3BT7A 4IXTA 3AEQA 2V55B 3ST7A 3IBTA 1JWAB 1P19A 1DSSG 3MERA 4BX0A 3BERA 3NBZC 3QE4A 2X23A 4TUYF 3Q3IA 4NMHA 2BMDA 5AUPB 1L7DA 5DIZA 1D6MA 2GBPA 3AHJA 5FPPA 3H9GA 5JAOA 2H11A 4EK9A 3LTNC 4HATA 3NM5A 4QU0A 3N6XA 3CEHA 1GQSA 1XCMA 2PD6A 3BHJA 2CLDX 5FPHA 5FTMA 5BSFA 1AKQA 3RDPA 3H6GA 2TSYB 5CLLA 3ROPA 4WXRA 4AJ9A 1CYDA 2V0NA 1G64A 1XCBA 2E55A 2ASEA 3TZBA 3A06A 2GWRA 1DV1A 5ALGA 4O2AB 2DQ4A 2QTWB 4JNCA 1MJFA 2EX4A 2W6MA 4Q9AA 4G8BA 3STWA 2J4DA 2MHCA 4V0KA 4S1NA 4X1OA 2QTGA 4X6XA 2P6NA 1YL7A 3HJTA 2IS4A 1JFSA 5E9WA 5AVUA 3IKVA 1SKUA 4I1OA 2ZETA 1SD5A 3ECSA 5EZYF 4EATA 1RJ9B 3NYIA 1YOVA 1U0GA 4Z1MD 3TD2A 3C48A 5K2MA 3EMVA 3IUYA 2QN9A 4NONA 4KOEC 1E1NA 5F7JA 5FD8A 2QZ9A 4QHTA 4QPZA 2ICAA 3OQ1A 2BOVA 5T8KC 3ZW7A 2AFIB 1OJ7A 4IIEA 2KB0A 2PRKA 2IZ0A 3T3EA 3OPVA 3LPMA 3CEAA 5F12A 3A27A 3D7KA 4S1OA 3NHLA 2VDWB 3I52A 4M0LA 1YR1A 5KNLA 2WHRA 1R8JA 3H11B 3X1XA 1S1CA 1ZOLA 4JBGA 3V1YA 1N2JA 4FVTA 3ONVA 2Y0DA 2XMPA 3CT6A 2O7RA 4FIDA 3HCDA 1NPYA 2YVKA 1ACLA 1J00A 1JWBB 3KOXA 3MS2A 3CM0A 4L16A 2GEVA 4BFZA 5I7SA 5LR6A 3UK1A 4X6YA 3IAM1 2H48A 4MVCA 2ZT6A 4GWGA 4ARSA 1WP9A 4GZLA 3QV1A 2Q4RA 2AOVA 4TPKA 3U2QA 1C9EA 4OFWA 4YRBA 2PGIA 3THWB 2QMOA 3G0BA 4EABA 5B36A 3IUMA 2LD4A 3CW8X 1UDRA 4QA9A 3AM5A 2GR9A 2P9GA 1VTKA 4RVUA 1RHJA 3GP3A 2Z2YA 1JILA 1H1LA 1HRDA 1C7EA 1JH8A 4O4HF 4AI6A 1DX9A 4MYRA 4JLSA 4DXDA 1F2UB 2H4ZA 2H9IA 2HXSA 2O7QA 2RAVA 4P35A 3ROEA 1BOOA 2EKQA 2H9YA 4BMZA 1P4SA 4P4GA 2P6RA 1RE0A 2A2ZA 4UM5A 3PUYA 3W79A 3KOOA 2QX4A 2OHHA 3WMXA 4H15A 2BHLA 3GOQA 4HADA 2HF2A 2CB9A 3BMNB 3F6CA 3K9BA 1IEWA 3QZUA 3F7TA 3FI0A 4YAOA 4J1TC 1B41A 3O95A 2B0CA 3RV3A 2YOGA 4U00A 2OG2A 2UDPA 2HJ9A 3LYHA 1V3TA 2D13A 3HA5A 2YMQA 3V8EA 4LZJA 3EGIA 1JQ3A 3DYBA 2PKCA 3NT2A 4P6VF 3MJFA 5JYCA 1A9QA 2C7QA 4TXNA 2WAYA 4R1SA 1OX4B 3KXIA 4ZJZA 1T3HA 2QRVA 2EV9A 3H5LA 3ZVRA 1XZBA 2AG8A 1E9CA 3VU0A 1LW7A 1HLFA 2YWHA 1MDFA 4C6HA 1U9ZA 4BMOB 3WNQA 4ENQA 1NVEA 4R2JA 2WD7B 4G67A 1BKDR 4BYMA 2QLNA 4GOND 3ZDFA 1E98A 3LBYA 2ODWA 4B8WA 5DX0A 4F21A 1XZMA 2EEPA 3ENKA 2X0FA 4U7DA 4RXMA 2F1OA 1C0EA 1L1FA 4Z51A 2G1AA 2YX1A 3A05A 3LLCA 3OIFA 2ZZKA 4LYAA 3W9SA 1H6AA 5ALXA 1WBBA 5F98A 1VMEA 2H4WA 4WECA 3MRTA 2J85A 3HKEB 3I45A 1BCSA 1CP3A 1HY3A 3L0PA 4LTDA 4R9RA 1MOZA 4ZREA 4HVLA 3FFTA 1U9CA 3CNQS 4BRWA 1XVVA 3GCWA 1ZK2A 3C7CB 3P94A 3CLRD 3W3AH 4URYR 3HWRA 4EY5A 4COKA 2VRBA 1H1DA 5DPMA 6AT1A 1DT5A 3T5TA 5C34B 4MIOA 1PDVA 5CG1A 2F9LA 2WIFA 4AKHA 4LJAA 4Y3UA 4KO2S 4IDCA 4TTSA 1Z63A 4WINA 2X8BA 4HQFA 4Z4IA 5LXTB 2G8NA 3OQ6A 4LX0A 1F2UA 1VIDA 2Q41A 2X76A 5JADA 5JC8A 2WD8A 3C3WA 1FPQA 1OBHA 1XQVA 4NWIA 3OFSA 4ZMRA 1WD5A 4GKKB 1QDLB 1VJ1A 2GPJA 4MV3A 3F1LA 3FPSA 4F86A 1AA6A 1ZWKA 4HBZA 3FI9A 2FUG6 2I1VB 3DTVD 3NAZA 4KKVA 3RD5A 1HK7A 4XM1A 3IVAA 4BTEA 3AVUA 4MQBA 1JIXA 3PUJA 5CXUA 1VIAA 3TQOA 4F04A 3CH7A 3O4GA 1FLAA 4MK4A 3EVNA 1LTQA 1EYZA 3FUWA 4LOLA 1U9YA 2XHEA 4ENTA 5HJ7A 4JH0A 1Z6AA 4ZIRA 3DMTA 4EO4A 2O4UX 4OX9B 3VU8A 5JSHA 2NVUB 1KQGA 1E3EA 1GXSB 1M1NB 5KCZA 2CXOA 1JXAA 4OQXA 3SJZA 1H9BA 1U2ZA 3DUFA 4R2LA 4XLLA 4Q05A 4KNYA 1G8PA 3EGOA 4CN8A 3HN2A 4GYJA 4IIHA 2NXWA 2VK8A 3NIWA 2X0EA 3SJUA 3I76A 1W6RA 2Q3FA 1Y7IA 2X0JA 3OIUA 3CW2A 4JL6A 5AM1A 4GKBA 3F2VA 4D56A 4BTVA 3A31A 1IK4A 1LPPA 4ZU1X 1WVGA 1G8GA 3L5KA 4XVUA 5CFZA 1QOPB 2H57A 4I4TA 3VH1A 4DSNA 1MA0A 3DV9A 1QIHA 1BC5A 1YK0A 2RJNA 3CUWA 2CK3D 1JQBA 1SXGA 3S40A 4DM3A 1FQWA 1E2NA 2JAHA 5JCXA 3QE3A 3PU6A 5L9AA 3QXGA 4PONA 1M2GA 4FUQA 1XTIA 4D96A 2DM6A 1HLDA 2C2ZA 2OCGA 4IHJF 4YJ3A 5J4YA 2P4UA 1VMIA 3W2TA 1Q6YA 3OG9A 1QV6A 3BRWD 5F73A 3BDIA 2A0KA 5CCBA 3EZGA 2A1IA 1IZ0A 1RPAA 2ZU0C 3FDFA 4QYTA 4YRPA 2JLUA 4F9GA 5ERYA 2QNIA 3HO6A 5FCDA 5DKFA 1PZMA 1JU4A 2VRCD 2C83A 1C1XA 1L6IA 1U7PA 4XARA 2VAPA 1R6AA 2HBQA 5DYWA 5C7OO 1XPRA 3OZGA 1MRNA 4J0QA 5F5XA 3TIFA 3DLPX 2GEUA 4IOKA 2WLTA 2GK3A 4YDHB 4C7KA 5CLJA 2QLTA 4P7JA 4P3XA 5SICE 4BBPA 3TQFA 1JG4A 4GLLA 5LYJF 1VKZA 1EFLA 1ZW1A 1OV4A 4OQDA 4CIBA 3B1ZA 4ZAZA 1JT9A 1AMUA 3CR8A 1ULAA 1O94D 2B82A 2NU8B 2FPLA 5ALIA 5FOWA 1N6OA 1IY8A 1DAMA 4I4LA 1GUZA 3HSSA 2WT8A 3VXKA 2Z1NA 4A7PA 3QPUA 1LQ2A 4BP1A 3KK0A 2IV2X 3AEUB 4KQIA 3IT2A 5H82A 2EL9A 2GCPA 2O3JA 1SWWA 3HU2A 2QN1A 4CGZA 3HBLA 4YQEA 4L95C 3OTIA 4F2GA 3N2NA 1IIRA 5IVHA 5CD1A 2GZHA 2RGDA 3VPFA 1XTPA 1M9NA 1PW7A 3FIUA 3K70C 5HXAA 3CJQA 3F71A 3O03A 1N4AA 1UKAA 2ZPUA 3PC8C 3M9LA 3OUZA 1NVGA 1TUBA 3PJGA 3RRMA 2J59A 1XVUA 1I33A 1NULA 2ZATA 3RUFA 5BR4A 2Z5GA 3OBBA 5G0SA 3B3QA 1MOQA 1V0JA 2EHDA 3KVYA 1Q57A 3PE3A 4UUQA 3T5GA 1FRFS 1G2PA 1FXWF 1Y1KE 2BE7A 2OC9A 1FFSA 2ADFA 3NG1A 1SUPA 1F06A 2QZZA 3OJFA 1ZDMA 4F1KA 3F4BA 1BU8A 1G3RA 4PIMA 2G28A 4NC9A 3ZYCA 4MX8A 4C0BA 4D3ZA 3OY2A 1ONNA 4P4SA 1P7PA 2R25B 1Z8HA 4UVDA 3OQHA 1N5RA 1C9KA 2CDCA 4QPNA 5FTKA 4JN6B 4R1MA 2JFWA 1E1CB 4RQBA 5DHQA 5JS7A 4LS3A 1YZTA 1N2IA 3O9VA 5KWVA 2YFKA 1R0WA 3UWSA 2ZUUA 1KDZA 4UXJA 3FUUA 1TZBA 3LAWA 5H9WA 2ZSBA 2X0RA 2YTZA 2D2EA 5G1OA 3LW8A 2GD6A 3DL4A 2AR9A 4QGBA 4HGRA 1U7UA 3QBVA 4QOFA 3ZVMA 2W2LA 4LUCA 4B48A 5JNSA 2H0AA 4I55B 2JAQA 3LZ6A 4MV8A 3COWA 5LB2A 2ERCA 3UENA 1JFTA 1P9RA 1WZIA 4UAVA 3AVPA 3VR4A 2OV1A 2XRFA 1DLJA 4UPDA 4NG5A 5JAQA 1VPWA 1XPUA 3QFCA 3IQEA 1Z4KA 2WTXA 2Y68A 1DFHA 5H68A 1WQ4A 1GARA 3DE5X 4Z2YA 4HGYA 2DT8A 1V5EA 4RKYA 9ABPA 3OA2A 5BV2P 1CNEA 3HCFA 4N01A 3ZVKA 3TSYA 1U3TA 4W1QA 1Q0TA 3V7YA 3SICE 4V39A 3NW9A 1ZJYA 4ZOLF 4DB4A 1R50A 2XBUA 1Q1EA 1CY8A 2SCUB 3PUWA 3K5IA 4V38A 2WOJA 4DEYA 2OP0A 4BNTA 1Q1ZA 1C50A 3HUEA 1GSIA 3PLNA 3U80A 4AY2A 2FG5A 4RF2A 4EQ6B 1F0NA 3URKA 5LBTA 1VGRA 3H0CA 4RD1A 2OZPA 2YYSA 1KA9H 5IAKA 1CR4A 4HWKA 4WXHA 3EDYA 1ES9A 3H4TA 4O2AA 3U40A 1QE3A 4IGAA 4RCVA 5F21A 3VV2A 3BH0A 4W1PA 2D5BA 2QKYA 3PC3A 4DKXA 1M6WA 5BYJA 4E2YA 5J2TB 2E2WA 1RYDA 2OV3A 4FOTA 4L8WB 3Q6NA 1H05A 5EMKA 1N5OX 3I9V1 4DLXA 5JALA 3W7VA 3WQBA 1E3LA 2NZJA 3DBLB 4PRYA 3JWJA 4MLDA 2EU8A 4ZC8A 4HUTA 5IP5A 4JQYA 4R2IA 5JQGF 1QVVA 4DT1B 4WOKA 4MW9A 5FI0B 4NIMA 1NBOA 2BEJA 3KZNA 4DR6B 1F2DA 2YY6A 1FL9A 1WQ3A 1YRLA 2AC4A 3ZJ4A 4W5WA 5EHXA 3G82C 5JXWA 3J81k 3K9LA 2I66A 3ML1A 2C3YA 3OX3A 2BFDA 1IG0A 1P62B 2W22A 2YV1A 4Y2UA 1AN9A 1KMMA 3N8KA 3PYXA 4EZEA 1JB9A 1MO5A 2HRDA 2Y0BA 2ZEJA 4GZ6A 3DDWA 3SY8A 1UBHS 4RTPA 2GXQA 2V6IA 4CM4B 4RD4A 1SZCA 2R9VA 2GCGA 1E5TA 1NZFA 1SU8A 1Z0UA 3DG9A 4NCXA 4WI1A 3RARA 4OHVA 1JECA 1T5SA 2GN4A 3GYBA 1G19A 3IP1A 2FZLA 3IJPA 3KS9A 1SCBA 5AKZA 3IP6A 5HIMA 1B6SA 1P2SA 2BM0A 2ID4A 4I9FA 4FYPA 1BW9B 1K27A 3BL6A 1ZCZA 3OAAD 3PGVA 4CT0A 3CNHA 3GVCA 4F1JA 3AEUA 3GNQA 4JOSA 3SFTA 3T0FA 5K0FA 2GCOB 5HFNA 4FKBA 4F4DA 2QTRA 4Z9YA 2PUCA 1KERA 3SE0A 1FLNA 4KYIB 4HBGA 2D2XA 3IOYA 5SZHB 1TF2A 4FFRA 4PC3A 3UATA 3FNFA 4X1YB 2H5JA 4OB7A 4D45A 1GV1A 4DYDA 2RBGA 2QRQA 3BGSA 1RJGA 2ZRLA 3E27A 1M8PA 2G7MC 3PNKA 5IAEA 4URWR 1RBZA 3ELBA 3F5FA 1R5JA 1WY5A 3CTMA 1T15A 3GZJA 4L78A 5CCEA 5JH7A 5JPIA 5E3HA 3VMMA 5DSZA 3DXYA 1H2RS 1TKCA 2GD0A 4TT3A 3OP1A 4WBNB 4D57A 1QMPA 4QBIA 1TADA 4J0FA 1LXCA 3CLRC 3OCWA 2GBLA 4D41A 5IZCC 2Q5CA 2OHOA 4LISA 2XQGA 1EVJA 3WA6A 2REOA 5EE1A 4BMVA 2XGOA 4X3CA 1GGHA 5LL6P 1IB6A 5D01A 1D2RA 4XGKA 1N7IA 2FF7A 3PFWO 4GKAA 4DLSA 5MGBA 1EM6A 1QM5A 1FQJA 4X1IA 3QUBA 2VPYA 4JB2A 4ER7A 4FUTA 1P2FA 1PUXA 2ZJBA 1PD0A 4M37A 2AUTA 2FSHA 3PJFA 4P3YA 3F8SA 4IUYA 5JR3A 2KQUA 2BFBB 1UPAA 4Q4DA 4FONA 2BMFA 4EAAA 4MARA 2NPFA 2FUNB 3PHBE 2J0UB 5DBHX 4C87A 4UFOA 3RBZA 3LWBA 5JVDB 1Z2DA 4IR7A 3G9TA 4ZVLA 1ND5A 3FSGD 1IPFA 4KDCA 2ZIVB 4WW0A 3UANA 2OHFA 4RUKA 3PGXA 3I34X 4CT5A 2N1BA 3RHZA 4I9UA 4KDFA 4P81A 2HYDA 5JTUA 4Y2XA 3OWOA 4UREA 2OCPA 1CNFA 5DN6A 5EIFA 4R1QA 3PQFA 5NLLA 4LFCB 3VDMA 3ZI4A 4AIIA 3ZHSA 4FWTA 2ZBDA 1Y3CE 3DDUA 5L3SB 5DWDA 3HS3A 5DM2A 1YJAA 4DLLA 3B9RA 2B1JA 3GHHA 1GTG1 1ZAKA 1G7TA 1SM4A 2A33A 1CDZA 1Z5NA 1OILA 4PSUA 3FF1A 3VJMA 4YMHA 2YWDA 5KOJB 3MF4A 3VTAA 4JJIA 4JSTA 5KJ6A 3FCCA 5AKXA 3TECE 3Q8KA 3VPXA 4KO8A 2Q9BA 2ZSAA 4Q39A 4GD3Q 1XQ9A 3EGXB 2OZLB 4GC5A 1RQ2A 2YIVX 1G4UR 3UHAA 8AT1A 1ZI6A 1XWFA 5I7WA 2D1FA 3GG9A 4JP5A 2I4MA 4E07A 4OP1A 1J5XA 4XSVA 4RL6A 1YK1A 3SC3A 1DIBA 1JLLB 1EJ2A 1EBBA 2C7PA 5I9LA 4JB8A 5EJ4A 1HE4A 3B8HA 3GRYA 2BMEA 3LMKA 1D1TA 1LA2A 3LS2A 2I03A 1O94C 4YO8A 1YT5A 1YBAA 5DX1A 4ALMA 3AVXA 1M66A 3IVRA 4ND4A 4ESVA 3PUVA 2O19A 2DRIA 3OEHD 4XWOA 4BMXA 1EVKA 3QLUC 2I6XA 3H5RA 2ATEA 1RM0A 3K72B 1GNLA 1MDBA 1B1CA 2ZAIA 2CE2X 3KYCB 5KWSA 1IATA 3HBJA 4O4LA 2VDQB 3HWWA 1GZUA 1U65A 1UINA 4EGCB 4HO1X 4YROA 4J07A 1A9ZA 3ETEA 2YINC 4E94A 1PJZA 4JDUA 1YZQA 1FFXB 1GZHB 4M1OA 3CEPB 5E7MA 5AM4A 4F2DA 2XH8A 2UVDA 1VHJA 4PIVA 3EH1A 1ESNA 4L0CA 4HWOA 4P82A 3HHPA 2RGYA 4S1PA 4XOIA 3ZD7A 3ICOA 5EZYB 2AWOA 4BKUA 1T2FA 1RJ9A 2UUAB 1N2ZA 1XNGA 2WE8A 2LW7A 1GDTA 5KOIA 1STOA 1PJTA 1BEUB 4MAFA 5H3HA 4CQNA 3K6KA 3C3AA 4CM7A 2YHIA 3AT1A 5J1TB 3KSDO 1Y1SA 5BNFA 5DT9A 5E0KB 2VF7A 2R751 4TYYA 4EG7A 4BL5A 3CX8A 4U7JA 4X1KB 4L76A 4DNXA 4YRIA 1V8FA 3CGGA 5F4ZA 2PRZA 4HYEA 1BVHA 4LVOA 5F1OA 4H4CA 3SHVA 2HCBA 5IEBA 1D0IA 1NUHA 2Y2VA 3PTZA 4WD3A 4X6LA 1NUUA 4WGGA 3X2EA 2BUBA 2QTHA 2ZTUA 4N39A 4OQPA 5AH0A 3KSZO 4U7GA 4EJSA 3ELUA 1OH6A 1W0JD 1XAHA 4LZAA 4KQFA 5AVOA 3PPXA 1G8KA 1DQYA 4HWTA 2FSSA 4Q37A 4PXSA 5DCUA 5FWDA 5LPNA 4TUYA 2O8BA 3FUXA 1T8PA 3D43A 4P93A 3ENQA 1IXKA 3C5VA 4RHUA 2ECFA 2X1MA 1U4OA 2AK3A 1AO0A 1LWOA 2J3MA 2GEBA 2VYNA 2X9QA 3ZG6A 2PS9A 3BJRA 3P9PA 3R76A 4KYTA 1TCCA 3B6EA 1JL3A 1MABA 1YBFA 5BUZA 2ZXEA 4ITRC 4ZGWA 5K99A 2I34A 3QM1A 3CCCA 1SKBA 3ZVLA 3I53A 4RIGA 3F6RA 1NAHA 4YRLA 2AJBA 3GRUA 3LE8A 1EXNA 4I4IA 1L4LA 4G5GA 4D8XA 4O1IA 2BF4A 3A26A 1E1RD 3SZ3A 3AEZA 4HSGA 3R6GA 2JLBA 3UWMA 4CYMA 2HU8A 5IT4A 5BURA 1JTFA 1VKOA 4YAKA 3WB2A 4BNWA 1NUSA 4XQGA 2QWXA 5FNVB 2NX2A 1IN1A 5C4GB 4UUBA 2GN0A 1SB9A 4BC1A 4EB8A 1RLUA 1NXOA 3EQ7A 3PDIB 5IX8A 4V0ME 1KI4A 2QM7A 4IILA 4KRYA 3UTCA 5LVAA 4RF4A 1Z4IA 3REQA 4B2YA 4HSEA 1DJPA 2OV6A 1E1YA 5EIXA 4MR8A 3KJQA 2QM3A 3ZE8A 3QSYA 5DM0A 4R41A 3BMXA 3ZI0A 5KHOC 4HDCA 2CN1A 3IBFA 5JJIA 2HA5A 1BE8A 3M6IA 4IF4A 4LDQA 1Q77A 3BJEA 4JR0A 1GU7A 4TTJA 2Q46A 3TZEA 1I2DA 9MHTA 5B4VA 1C3XA 1VG0B 4IDDA 3V4SA 4DMUB 1VPVA 5LLDA 3Q7IA 3S8YA 3L7BA 5K8IA 4KXXA 3SD7A 4AXXA 3PNBA 1AB5A 1YB4A 1RPTA 2JBAA 2DGDA 3T7SA 1UOEA 2AN9A 2RSLA 1DQSA 1Z6TA 2UYYA 4TS3A 2G0NA 4G9EA 3C3KA 4X45A 2R7MA 5SY6A 4BJ3A 3IIIA 4MPRA 3TKLA 4E5SA 5IARA 3VISA 1XELA 4BLTA 1X38A 3L4BC 4CDNA 3KNZA 1CS0A 3G2IA 1XTSA 4FILA 1A2QA 1CR0A 1X77A 2H1FA 3PD1A 2E37A 2J09A 2R7NA 5JBQA 4RABA 3TEFA 2W70A 1BMDA 2X1HA 4TV9A 1GPMA 3TTVA 1MHTA 1Z12A 1ZXBA 5ECDA 4CODB 1IHDA 3KSRA 4QQKA 1RRGA 2GDZA 3CPSA 4QXAA 1JXQA 3NASA 4UM7A 1I0IA 3DDSA 2I71A 2HV8A 2TRSB 1N7GA 5EXXA 1W88B 2NO7A 2XDQB 4EY6A 2A1UB 4YAIA 4NOJA 3R40A 4Q03A 3W6PA 1CUJA 1H2ZA 3CZMA 1GCAA 1IHXA 4CIDA 5IC5A 5DXAA 1E5XA 1XNJA 1VIVA 1KI2A 1T2EA 4K3VA 3PGJA 3H42B 2IWRA 3MJCA 5JDIC 2QE7A 3E7FA 1FRQA 4FWIB 1DBPA 4JJZA 3RT7A 2EFYA 1IJKA 2YUIA 3LWDA 1V3UA 1NU8A 1KJNA 5AXCA 5IJAA 4CMIA 4MB6A 1NM5C 5GZ3A 4C5CA 2ES4A 3ZCSA 2JZOA 4FC7A 2DWUA 4WK0B 3RYHB 1XDZA 4JB3A 1XN1A 3RYIB 3HXMA 1C7IA 3MNFA 2FMUA 2IYVA 1NVKA 2RHHA 4FYMA 1W52X 4G1UC 3AW8A 2O8DA 1P0MA 3FGZA 2FPSA 1NA5A 4MITA 5KJCA 1FMJA 3GDHA 1Z5UA 3DB2A 2R7LA 3OOEA 2ORVA 5E3JA 2QE7D 1XQWA 2H59A 4DQXA 4CLEA 2JLVA 1PGJA 1JG6A 1WHTA 2FN8A 3PPIA 1P4GA 2NTJA 1ZJWA 3QPVA 1TVKA 4GOJA 5AUNB 3DP7A 1ENZA 4R01A 1HQYE 4GAEA 3B9BA 2BFOA 3RFCA 5LZ8A 4M7OA 3RRJA 1DIAA 2VYCA 4YHHB 3AKZA 1GCUA 4K2HA 2IYZA 2AH5A 3WLFA 2XNDA 2NLOA 4HG2A 4R0MA 1J33A 1JDNA 1HZZC 1NW4A 2IUEA 4F06A 2TS1A 5I7AA 5YASA 3IEXA 4L8GA 3NTQA 5KTMA 3EG9B 5B7GA 4XVCA 2FE1A 3A4NA 5I8ZA 2OYCA 3OM0A 3DL0A 1M2HA 3MBOA 1U2GC 3ND8A 4UBMA 3UUWA 4PN7A 2XAUA 4EG4A 5I7HA 1WUIS 2PSFA 1KYZA 3OEED 4KAJA 5JATA 3TUZC 1USGA 1P80A 3GJYA 1KYXA 3IP5A 4IHQA 2YJ4A 5AOVA 1U4SA 3LHFA 3NEAA 3SPXA 3LC0A 1H8HD 2PZEA 4FEGA 4JELA 1TF5A 2CXRA 5CPFA 1NNI1 4WIAA 1E7RA 3H04A 2X6TA 4C4OA 2CDNA 2IEZA 4DRZA 1O57A 3VPHA 2HA4A 1W87A 4DY6A 5FB3A 1FSSA 3O31A 1T6XA 3H2SA 3WKBA 821PA 4PIPA 4I2NA 3GW8A 3M3PA 4HTAA 3Q2IA 2A3RA 4Q3NA 4QUHA 5IF9A 1D8TA 4N6GA 4DDUA 4BYGA 3PENA 2PUFA 2C1ZA 2WTAA 1MO3A 3F3SA 3FG9A 3DNMA 3BXXA 4TVOA 1FYWA 3WYEA 1FIUA 1SVIA 1P8JA 2JB9A 3IVXA 3WNCA 3JASB 4HMQA 2CE7A 2J9FB 5HGJA 5A6SA 2ZKIA 3RJZA 4S2EA 1Z07A 3ESAA 5K01A 1QGZA 3AHHA 1GAWA 4HAOA 2E9SA 1NVUQ 3HCEA 3QPDA 3I2GA 5ALYA 2Y76A 1Q92A 1I4LD 2V0GA 2A0WA 3K9CA 3MMSA 5E6UB 3C87A 2Q50A 1US8B 4LW8A 2ISSD 4KVZA 3RIMA 2W6PA 1O97D 2VQSA 3UQYS 4GKJB 1NJFA 1DARA 4EY7A 4OHOA 3JAKA 1GCOA 1N92A 3IELA 3W8DA 3Q98A 2IIQA 5FBKA 2BCEA 4JC5A 4KIGA 1M6EX 4UE2A 5DNWA 3CLTD 4BASA 1F4LA 1Z2PX 4N5MA 2J8ZA 4GZ5A 4I55F 3M6FA 4KHZA 3SQXA 1RAHA 2HCJB 3DE2X 3EA4A 4J16C 2CLEB 1UXGA 2AD5A 3ZLUA 1J90A 3K05A 4HV4A 3TDMA 5ALKA 4G36A 5JASA 3ZLJA 2PSSA 1DHRA 1V1RA 2CLFB 5T41A 4CV2A 1W4CA 4X61A 3KTFA 5BRAA 5ICCA 4TKUB 2G1UA 2VUSA 1BVRA 1I0ZA 2QW8A 3I09A 3ITNA 3NWOA 5IDVA 5K0NA 4DPMA 3PR2B 1JU3A 1RZ3A 1TM3E 1VJDA 1T36A 1KFKB 2IX9A 4X94A 3EHDA 5ER9A 3HB1A 3L7JA 5J9FA 4DHWA 4LYGA 3JQGA 1G0OA 3IOMA 4W9MC 4C0HA 3WHLA 2XIJA 1MOPA 1O96B 3AONB 4OQZA 2E21A 1PLLA 3R3SA 4LJ6A 3NXKA 3UC9A 3WLHA 4GE3A 5IFKA 1JDPA 4NLLA 3KKPA 4Y1RA 1WY7A 3RTEA 1E2LA 4H7IA 2P5UA 1VL0A 1VMKA 3BCHA 3R7BA 4D98A 3ABOB 4E2WA 2A6PA 3GYGA 2IE8A 4D92A 3CG0A 2O1WA 3H8WA 4I4TB 2AZXA 1E1DA 2E4UA 4P92A 4UU0A 1A76A 4FSHA 5C80A 3K71B 2KE5A 4H18A 3E61A 3AP2A 4BB5A 1XDSA 1KSJA 2JKYA 4A1OA 2O8CB 5HM8A 5C8YA 1K97A 1JSXA 3BSFA 3FNGA 4CF7A 1GZVA 4KXMA 3GGCA 4P4TA 3URMA 2GNPA 2Z08A 1ZOOA 3E9QA 2B20A 3TOCA 1NVXQ 5JQGB 1EK0A 2QY9A 4XSGA 5A7FA 1I10A 4Z0PA 4BFCA 4N5NA 3DOUA 1P4JA 2G80A 3CE9A 3PQDA 4Q3CA 1F4PA 3IR7A 2YYZA 5ELXA 5TDHA 1PLKA 3ABRB 3AESA 2PZBA 3GR6A 3PUKA 1D0VA 2O2DA 1JA1A 3KKZA 3PC7A 4HH1A 4D02A 3A9CA 3EZNA 4LHEA 4NS1A 2C4NA 3AWDA 3W8FA 3DB1A 2PHZA 2VJQA 2X40A 3N2IA 3MFQA 4ZANA 3HRIA 3GRFA 5K8JB 3VMFA 1FUEA 1F0KA 3DO8A 2COEA 1L7PA 2RIPA 2VZ9A 3U7HB 1A2KC 2VJDA 4EFKA 1W0JA 2ZYVX 3DVSX 2OWDA 5EPOA 3ZLTA 3G5UA 1UBSB 2UYHA 5AFSA 1YJCA 4HDOB 1GDDA 1QKJA 2R97A 3WXBA 1I7SB 4ZO9A 2PLWA 4ENPA 4W9NA 5DW3A 4BNXA 2DSTA 3V5NA 4Z2AA 4Z53A 2R44A 5AQ1A 4J7CA 3B70A 1MH9A 1BWPA 3L8EA 3WNVA 1YB1A 1NT4A 1ZNYA 2X8AA 4UBJA 5KNCA 1NMQA 5C52B 1VSTA 4I8DA 3D0RA 4K8RB 4DM7A 2PUDA 1RC0A 3ZW8A 1FTSA 4HFNA 1QFJA 1FDRA 5HIIA 4IDAA 4PAOA 1K98A 3OHMA 3UJDA 2QVZX 4N3CA 1JX6A 4GKVA 3UXEA 1ZIOA 4QUJA 5JZSA 2YUTA 1NW5A 3MMNA 5A05A 1C14A 4EYGA 1TFRA 1S2IA 3LXMA 4A5SA 4HLNA 4RIHA 4RYDA 2AZDA 2D2FA 1ZI8A 3GDGA 5DSXA 5ESWA 5GVSA 5HUQA 3AB8A 4EVSA 1T2DA 5HJ5A 2R8OA 3ISTA 4CKYA 4NJOA 2XWBF 4IJWA 2AI3A 1HV8A 5IG2A 3W2IA 4UBNA 1UEXC 5HA5A 4WUVA 4AJ1A 3W9YA 4OK6A 1BZYA 3GEHA 2YQ5A 5TQ0B 3S2EA 2DHRA 3LWNA 1E77A 3EOBI 2WU1A 1TGYA 3DMHA 3OX1A 4BY9E 1NPDA 4JFAA 3Q7PA 1N8SA 5B3AA 3QH4A 3O8CA 5ETJA 4OHMA 3FCOA 3AEKA 1ID1A 3B1FA 4HVTA 4MGIR 1Y6FA 3P2KA 4E1BA 2R2GA 1OD6A 2PX3A 2JZCA 2EW8A 4KCGA 2P5YA 4Q3EA 3ILVA 3PJEA 1WUJS 2PZFA 4CIXA 1L5ZA 4RDIA 1ZXLA 4KPUB 3K15A 3VDNB 1OBFO 1BX1A 3BXPA 3GGOA 3R9WA 3I32A 4FT4A 1FFAA 2POCA 4R84A 3SKYA 4XB2A 3HVUA 2SHKA 4QDZA 1W76A 4L9SA 3NIGB 3AY6A 3JR3A 3ZGXA 2RGGA 4XJXA 1JSCA 2R6HA 4LDNA 3BPSA 3G17A 4XZ3A 2O20A 1E9BA 3IHTA 3KXDA 3ORHA 4C88A 4GUAA 4D81A 4Z6KA 1Z2OX 2IPNA 2IS2A 1PYOA 3LBIA 1NYQA 1A8QA 1JHAA 1ZNQO 1X86B 1DJLA 1RWMA 4FNMA 4I9NA 4PR3A 4D4JA 3WA7A 1CS0B 1QF6A 2VP9A 5ITWA 4C0KA 1A8PA 2RHTA 3IILA 1W2WB 1L5HB 3ABIA 5C2JB 1WCIB 4UOEA 3HCAA 1TFUA 1FUKA 4HUQB 3B6ZA 3LT1A 2PGLA 4RJ2A 5JFOA 1O95A 2ZM5A 3D3QA 1BQEA 1NSFA 5ITVA 2OGUA 4OLHA 4E3WA 3JZDA 4OJQA 3T7DA 1FFYA 5TPWB 1JDUA 4G26A 3PIIA