The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
31
|
sequence length |
139
|
structure length |
139
|
Chain Sequence |
MVWTPVNNKMFETFSYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESAIRFGSVSCLYYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGFLVQRPKTARDFQPANKRSV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Oxidoreductase
|
molecule keywords |
RIBULOSE BISPHOSPHATE CARBOXYLASE LARGE CHAIN
|
publication title |
Structural Analysis of Altered Large-Subunit Loop-6-Carboxy-Terminus Interactions that Influence Catalytic Efficiency and Co2 O2 Specificity of Ribulose-1,5-Bisphosphate Carboxylase Oxygenase
pubmed doi rcsb |
source organism |
Chlamydomonas reinhardtii
|
total genus |
31
|
structure length |
139
|
sequence length |
139
|
chains with identical sequence |
J, K, L, M, N, O, P
|
ec nomenclature |
ec
4.1.1.39: Ribulose-bisphosphate carboxylase. |
pdb deposition date | 2007-07-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
I | PF00101 | RuBisCO_small | Ribulose bisphosphate carboxylase, small chain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase | Ribulose bisphosphate carboxylase, small subunit |
#chains in the Genus database with same CATH superfamily 1RXO C; 2V6A I; 1SVD M; 1EJ7 S; 4HHH S; 3RUB S; 3ZXW B; 1AA1 C; 1RBO C; 1WDD S; 4F0H B; 1BWV S; 1RLD S; 4F0M B; 8RUC I; 1UZH C; 1UPP I; 1UPM C; 1RCX C; 1AUS S; 1RCO C; 1IWA B; 3AXM S; 1UW9 C; 1RBL I; 4RUB S; 2V63 I; 2VDI I; 2YBV B; 1RSC I; 4MKV S; 2V69 I; 2V68 I; 4F0K B; 1UZD C; 1GK8 I; 2V67 I; 1BXN I; 1IR1 S; 2VDH I; 1IR2 1; 1RLC S; 3AXK S; 1UWA C; #chains in the Genus database with same CATH topology 1RXO C; 2V6A I; 2HW8 A; 1SVD M; 1EJ7 S; 4HHH S; 3RUB S; 3ZQJ A; 1CJS A; 3ZXW B; 1AA1 C; 5DM6 0; 3UMY A; 1RBO C; 1U63 A; 3QOY A; 4QGB A; 1WDD S; 4F0H B; 4DFC B; 1ZHO A; 1BWV S; 3U4M A; 1RLD S; 2DFX I; 4F0M B; 8RUC I; 1MZP A; 1UZH C; 1UPP I; 1UPM C; 3U56 A; 1RCX C; 3FPN A; 1AUS S; 1RCO C; 1IWA B; 3AXM S; 1UW9 C; 1RBL I; 4RUB S; 2V63 I; 1I2A A; 2VDI I; 2YBV B; 1RSC I; 4MKV S; 1DWU A; 4F9T A; 2V69 I; 4REO A; 2V68 I; 4F0K B; 3TG8 A; 4QVI A; 1UZD C; 1GK8 I; 4QG3 A; 2V67 I; 1BXN I; 1IR1 S; 2FHZ A; 2VDH I; 1IR2 1; 1RLC S; 3AXK S; 4LQ4 A; 1UWA C; 5DM7 0; 1AD2 A; #chains in the Genus database with same CATH homology 1RXO C; 2V6A I; 1SVD M; 1EJ7 S; 4HHH S; 3RUB S; 3ZXW B; 1AA1 C; 1RBO C; 1WDD S; 4F0H B; 1BWV S; 1RLD S; 4F0M B; 8RUC I; 1UZH C; 1UPP I; 1UPM C; 1RCX C; 1AUS S; 1RCO C; 1IWA B; 3AXM S; 1UW9 C; 1RBL I; 4RUB S; 2V63 I; 2VDI I; 2YBV B; 1RSC I; 4MKV S; 2V69 I; 2V68 I; 4F0K B; 1UZD C; 1GK8 I; 2V67 I; 1BXN I; 1IR1 S; 2VDH I; 1IR2 1; 1RLC S; 3AXK S; 1UWA C;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...