2VHWA

Crystal structure of holo l-alanine dehydrogenase from mycobacterium tuberculosis in the open and closed conformation
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
371
structure length
371
Chain Sequence
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALANINE DEHYDROGENASE
publication title Three-Dimensional Structures of Apo- and Holo-L-Alanine Dehydrogenase from Mycobacterium Tuberculosis Reveal Conformational Changes Upon Coenzyme Binding.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 126
structure length 371
sequence length 371
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.4.1.1: Alanine dehydrogenase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain
A PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhwA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vhwA02
3K5PA 3PQDA 5TJ9A 1KC3A 2JAPA 4L4RA 1BXKA 3GT0A 4GSLA 3KM0A 3F1LA 3QY9A 4WASA 3WTBA 1HWYA 3RFVA 3LU1A 4XYGA 4DIOA 3MJVA 1QYWA 3BTVA 1C14A 3OBBA 1DHRA 1I36A 2O3UA 3BMQA 1LSSA 3KVOA 3NDJA 4J0FA 2QRLA 5DN9A 1EE9A 3PVZA 4RQUA 5IZCA 1WZEA 3QA9A 4B7UA 4PG4A 4C4OA 2J5QA 4TRJA 5TJHA 3KTDA 4K1LA 3CSDA 3ZH2A 1BXZA 1M6HA 1ISGA 3LK7A 1VJ0A 3OIFA 4WNCA 2IXBA 1K89A 1NBOA 2HMWA 1DIRA 3OHSX 1RPNA 3ZNOA 4KTTE 5COAA 3ROPA 4BIIA 5JS6A 3JD0A 4YJDA 1OC4A 1BMDA 2OOSA 3GVIA 2G82A 1VL0A 2DBQA 4NH4A 3I1JA 1YOVA 4BKUA 1J49A 3G49A 2AEMA 1NQOA 3BMOB 3F5SA 3NX4A 5GZ3A 3CEAA 2ZCVA 4OSPA 1QYXA 1Y9EA 1M2WA 1YJQA 2WYWA 1Z74A 3GVCA 1DRWA 3DOCA 1GU7A 2D3TA 3GHHA 2EGGA 3OFSA 2BFPA 4MVJI 4FFNA 1C0PA 4O6VA 5BSEA 4OM8A 3CH6A 4RPHA 2HDHA 5B37A 1ADBA 1GUYA 4YJHA 4BB6A 4OOFA 4YVFA 4UUPA 4DPKA 1HZJA 3DEYX 1YBVA 3RWBA 4RVFA 5IXYA 3U09A 1D3AA 3O4RA 2DTDA 3DMTA 3G3EA 2Q1TA 2WJPA 3HB4X 2GPTA 2PA3A 4J1SA 2Y0CA 1O89A 3Q9NA 1CERA 2HRBA 2VQ3A 4J2HA 1BDMA 4Q3NA 5THQA 1PZHA 1PIWA 1EVZA 2VWHA 3GDFA 1ISIA 1GY8A 4OJNA 2VZ9A 4TRMA 3WR5A 4XA8A 2B36A 3U4CA 2WEKA 4GPD1 2IRWA 1I01A 1R12A 4WOKA 3DOOA 3RC7A 3U5TA 1ZK2A 4Y8VA 4JNKA 3E82A 4UVIA 1LLUA 3MEQA 1DO8A 3CXRA 5B4TA 2IE0A 5G4KA 2Q1WA 2GERA 1XHLA 3AFNA 4RF3A 4B7CA 4DA9A 4XIJA 4N18A 1LTHR 2HJSA 4BS9A 3E18A 1EK6A 1HT0A 5KIAA 1E6WA 2I99A 3HHPA 4QX6A 2OXIA 2PNFA 4IQGA 2YFQA 2AEFA 4IJUA 4LSMA 2JL1A 1T1SA 4XWYA 4JBGA 4OHUA 3B70A 4DQXA 4IQ0A 3GDGA 4DMLA 1ZMTA 2NACA 3SLKA 5HS4A 2RH8A 1BDBA 1P0FA 2NUAA 4IDBA 4RZIA 3LLVA 2NU8A 4Z6KA 4RF5A 5GZ1A 3NAQA 1VM6A 1LSJA 2P5UA 3PFWO 4J0EA 3H9GA 4LN1A 3DONA 3D4PA 4PIVA 1ZMOA 3GNTA 3NT5A 2OP0A 4JIGA 4MIEA 5I7SA 4D3DA 4I8XA 1GQ2A 4WLVA 2Q4BA 5DT9A 4J1NA 3ZHYA 1CIVA 4JROA 1XKQA 5CDSA 1I24A 4BNGA 5G4KB 4Z3DA 1OBFO 1I3MA 3K92A 1ML3A 1LSUA 3V1UA 3PRJA 1MC4A 3QE3A 4HY3A 2DKNA 1K6JA 4MVJP 3GVPA 2CUKA 4IDDA 1WP4A 2B83A 1PU2A 3GAZA 4WNIA 1MFZA 1W0CA 2FSVA 5IZ4A 3DZJA 4MIYA 1K6IA 3L4BA 3AUSA 3L4BC 3LLSA 4IDFA 2V7PA 3FNGA 4D3SA 3OMLA 4PG8A 3UVEA 3U4IA 2I67A 4UEKA 2PGLA 1VL6A 1V3TA 5DP2A 4YJGA 1F8GA 5TS3A 2A4KA 1MUUA 3WIEA 4YCAA 2W2LD 2O2YA 1N7HA 4QO8A 2AXQA 1DRVA 1Z7BA 2NVUA 2ZB7A 3JQAA 5U4QA 3C7AA 2OUIA 3MCVA 5B4VA 4PLYA 1HE4A 3AK4A 4E2YA 2SCUA 5KJ6A 1Z45A 1P31A 4HBGA 1HDCA 3DZKA 3PIIA 1PJCA 1F8FA 3QVSA 1XDWA 4L4SA 3DR3A 1G6KA 1HE5A 4RPLA 2X0IA 4CODB 5KJEA 2VTEA 2YHUA 3GDOA 2C7VA 2QHXA 4XR4A 3DL2A 2PH5A 1HE3A 4A27A 1K0UA 2O48X 3B6ZA 3OIGA 5KWEA 4YT2A 1LRLA 1ZK4A 4N7RA 3E6AA 4OYRA 1PR3A 2HKIA 2Y66A 1HYGA 1R6DA 4GLOA 1GD1O 3H65A 3LC7O 3EUWA 2W90A 2PTGA 4R1NA 3OM9A 3O03A 2RBEA 4BGEA 3JYPA 4W6ZA 1YRLA 2WE7A 5LC1A 1H6CA 1V3VA 2GASA 1YL5A 3WQQA 3LF1A 4CM9A 2PZLA 1KVUA 4CQLA 3GZ4A 1EBFA 4XGKA 1LNQA 1DXYA 1ZUD1 1KEWA 3BHMA 1H94A 4WLNA 2Q4EA 5TIIA 5MDHA 2G0TA 1PZEA 2JFFA 4DC0A 3CIFA 1M67A 3EAGA 1KVTA 2NWQA 5DULA 3BMNB 1M76A 2RHRA 2C07A 3VTFA 2NQTA 2E48A 4ZD6A 4NHEA 3D5TA 1DOHA 1M6WA 3PEFA 1ZCJA 3N7UA 4JBIA 1CJCA 1NX6A 1WMBA 1BWSA 5TNXA 2J3IA 1UAYA 1GZ3A 1IZ9A 3P5SA 4KWHA 4MDHA 4IDCA 4PVCA 4J9VA 2YV2A 4U8GA 4Z0PA 4AJLA 4CUZA 2NVWA 4Y98A 1AN9A 3RKUA 3L9XA 4BQRA 5JY6A 2YW9A 3RBZA 1BSVA 1VLLA 2YV1A 3HFGA 1E92A 3MZ0A 4YYZA 1K3TA 3KYBA 3ORFA 1C0IA 5I8ZA 5ITWA 5A9SB 4RVUA 4GWKA 4RJTA 5L53A 3EK2A 3JQ6A 1U5AA 1YDEA 3H3FA 2I6TA 4XJTA 1YXMA 2BI8A 3LDHA 2X5KO 3E1KA 4LCJA 1BXGB 4A7PA 1E3WA 1JW9B 3RSHA 4WOJA 4ZA2A 5HTOA 4R4JA 1U8XX 5H81A 5JPIA 1YB1A 1ENYA 3TQHA 3W4KA 4PLGA 4NJOA 5KJ1A 4FB5A 4H15A 1PJ4A 4KTVE 1B3BA 2EP7A 1XYGA 2GZ2A 4CM9D 3AWDA 3FPCA 1H9BA 4IDEA 2X5JO 1T26A 2FMUA 5F21A 2O2SA 1O8CA 4HADA 5I7EA 5KJFA 3W4IA 3C1OA 5EN4A 4NZ9A 1Y5RA 4I08A 2IXAA 2VHZA 2D2IA 3O26A 4MKZA 2WDZA 3CE6A 4W4TA 4FOSA 3EVTA 3HFSA 1A7KA 1V8BA 1YBMA 4GVLA 5C37A 5DBFA 3C7DB 2Y1OA 3IJRA 1KEPA 3F5QA 3K8ZA 5A5EA 4ZICA 1RM3A 1PZGA 2R00A 4YAGA 1R4NB 3HDQA 1VI2A 4YB8A 2PZJA 1R4MA 3H2SA 1VKNA 3JYOA 2YZ7A 4OO3A 3ZWOA 1UXGA 3CKYA 2XXJA 1LSOA 3DOJA 5IG2A 2UUOA 2P4HX 3UAGA 1U8FO 2X9GA 1B3RA 1EE2A 2GN4A 3RVDA 2GDZA 4BHTA 4QECA 3MJCA 8LDHA 5IZCC 1EQ2A 4B4OA 3IL2A 5TGDA 3LT2A 2DFDA 3Q6IA 4QT0A 4TKLA 4D46A 5C3MA 4DQUA 1PTJA 1LRJA 4TVBA 2TMDA 3HB5X 1DHTA 3BIOA 4CLOB 3V2HA 3HSKA 1NPYA 4DUPA 1ULSA 3ZV3A 5TT1A 1ULUA 4FOOA 1Y8RB 2E49A 1YQXA 4PRLA 4R9SA 3VZSA 4AJJA 2R2GA 4LVUA 4S1VA 4R69A 5FFFA 2NU7A 4YJFB 1NR1A 4INAA 4HKTA 3RAJA 5B12A 3KEOA 5G0VA 3R1IA 4XJSA 1T2FA 3UXYA 2WD8A 3SJUA 1GDHA 1TA4A 3MWDB 3KLPX 3GPIA 4Y9DA 5JBIA 1FDTA 2BGMA 1SMKA 2WM3A 2OO5A 4HNGA 4YT5A 4A03A 3ZHXA 1LBEA 1NNUA 1E7YA 4R1UA 4CLRB 4FC6A 4GMGA 3P19A 1DFIA 3WX0A 4AJKA 3EZLA 4ONEA 1Y6JA 1R0SA 1MV8A 4WECA 4NQZA 1FDWA 1T2EA 3ZWCA 3WDSA 5KCZA 1AE1A 5EERA 2B37A 3WNVA 4D7AA 2NM0A 3L6OO 1UDAA 4RPGA 5A05A 2O3JA 3D7LA 3KO8A 3NGLA 1I2CA 4N5NA 4HV4A 4II2A 3K2BA 4URFA 4ALIA 1YQDA 3IIEA 2P2SA 1O0SA 1R66A 4RDHA 4PG5A 2CY0A 3H8VA 1E7MA 3R3JA 2AA3A 1ISJA 1DIGA 3SBOA 4OKNA 2Y0EA 3PYMA 4ZVVA 4U0JA 1E6UA 1XSEA 2C59A 1Y81A 3ETGA 2H63A 3AUTA 2WMDA 5BR7A 2CDBA 3SLGA 4OXKA 4B3JA 3I5MA 3RBXA 3NDRA 2DQ4A 1E1NA 4L0QA 4BQPA 1QKIA 2VWQA 1DC6A 2P9GA 3L0DA 2VHWA 5DOVA 3VVCA 2BLLA 3WYBA 2YDXA 3WLEA 4WEQA 4LVCA 2UDPA 3JQ9A 3BXXA 1U4OA 4NBRA 2OORA 4GVXA 3CZMA 5I8WA 3GAFA 3IS3A 4KUEA 4RF4A 3PJFA 3GRKA 3OA2A 3NEPX 2DC1A 3ZNNA 4FFPA 4W7IA 1ENPA 2QQ5A 2O3QA 3DFZA 4B3IA 1IYZA 1PQWA 2AG5A 4R9RA 3PGXA 5T64A 2GO1A 1LQUA 3ADOA 4MPDA 4YAIA 4B4UA 2VWPA 4IZHA 3OEWA 2UUPA 4P4NA 1QXSA 3WFJA 5AQ1A 2PKQO 4CQMA 5DBGA 1PJQA 5COBA 4QFDA 2PR2A 4HFMA 3WGZA 2EWMA 4R5MA 1NP3A 3MJTA 4IXTA 4IMPA 4YTEA 1K6XA 2P9CA 4ALNA 2VUSA 4PZDA 4WE3A 3SJ7A 4DTIA 4YRAA 4PZCA 2D1YA 3PZRA 1XQ1A 4JP3A 1UXHA 2VRCD 1DBVO 4EDFA 2Z1NA 3WTCA 3HADA 4TSKA 1D4FA 1DC3A 4Q3CA 1MB4A 4B8WA 3ZWYA 4GX5A 3UH1A 1YS4A 2JFGA 3WSWA 2AQ8A 1IZ0A 1OMOA 3H2ZA 4NU5A 5EQDA 4J1TA 4M89A 4NIMA 5CG1A 4AJEA 4U0KA 5LDHA 4JJGA 1QRRA 2I3GA 1PZFA 1YJ8A 5A9TA 2X58A 3M2TA 1NAIA 4MVJH 5ENDA 5F1PA 2HMSA 4E12A 4FCCA 3N74A 2QYSA 3S2GA 1ZK0A 3AY6A 3GG2A 2PZMA 2AHRA 4RF2A 4AJIA 3B1KA 3ENKA 4R5HA 2XXBA 1GFSA 3ONFA 4A10A 4QUKA 1ZK3A 2CFCA 4EBFA 1QG6A 1EVJA 3BHIA 2CF5A 3GK3A 3ZN2A 3WGGA 4CQMB 4J16A 3FR7A 1B14A 1UZLA 2FY8A 4E32A 2GCGA 5DZSA 3NT4A 2JAHA 2CVQA 3GLQA 3RUHA 3I9NA 3C3XA 3I9JA 5C7LO 4ZQEA 4K28A 4YR9A 1LI4A 1UJMA 1HLPA 3W4JA 3WJ7A 3G1UA 3L6EA 1YE3A 3JD1A 4TRRA 4YJFA 1YL7A 3FN4A 1YKFA 2GSDA 3KEQA 4ND3A 1Y8QA 1GYQA 3DBHA 5AXBA 5MGBA 2RCYA 1ZSNA 4AG3A 3E5RA 1RM4A 5JAZA 4ZQBA 2JFHA 3JQCA 3FNHA 5DCWA 1SOWA 4PLCA 4WLOA 1WWKA 4DYDA 1OC2A 4I9NA 3KLMX 4ROSA 4JGBA 2WD7A 4WCFA 5DOZA 4KWIA 1PJTA 1NFFA 3DBVO 3F47A 4E5PA 1VC2A 3GVXA 3OJOA 5LDGA 3MWEB 1B0AA 4XQEA 2O23A 4ZQFA 3RUCA 1VL8A 4FQ8A 1KBZA 1WDLA 1HDXA 2D5CA 3PYXA 3OSUA 5CDGA 5JDCA 1ZEJA 4YA6A 4U6SA 4ZJUA 4BOYA 4AJNA 3QVTA 2RH4A 2EGHA 4E33A 1OFGA 5JLAA 3QVOA 5HRUA 1MA0A 2V6GA 3QIVA 1YQGA 1EDZA 1ONOA 4J43A 3PLNA 4MP6A 5CDYA 3RUAA 4ZN6A 1CRWG 3QWAA 2FZWA 1C1DA 3UHAA 3HZZA 3JSAA 3JV7A 4E5YA 2DM6A 3QLJA 1PGPA 4ALMA 3JCZA 1M66A 2IEDA 4RVHA 1T4DA 5C7OO 2C2YA 2CF6A 1CQJA 4FGSA 4HP8A 4BO8A 1DAOA 3PDUA 1U7TA 1MC5A 2Y68A 4BGIA 4EGFA 1KETA 3JYLA 1VRWA 3AOEA 3GGOA 3ZZNA 3VPXA 4R16A 4DLAA 2DU8A 3EC7A 4YXFA 3INRA 4ZHSA 2FN7A 1MLDA 3BMCA 2I65A 2Z5LA 1WXDA 4YAJA 1TT5A 4J91A 1FMCA 4W99A 4B3HA 3QP9A 5ILOA 3PLRA 5FYDA 5JFOA 4OMUA 4BL5A 3NT2A 3EHEA 3PHHA 5IN4A 4ZU3A 4CL3A 4DPLA 2H5LA 4NDNE 2X0RA 4A0SA 4EEZA 1WZIA 4EI2A 1FF9A 3JQ8A 4NPCA 1QYCA 2QX7A 2EHDA 4J2OA 1PL7A 3D3EA 2VYNA 3M1AA 1X13A 2DBZA 3H5NA 5HWSA 3F4LA 3VKVA 4W9NC 3ZWMA 1R0LA 1MXFA 1TB4A 4KQWA 4TZTA 4UEOA 2O4CA 4PLPA 1JKIA 5JNLA 4LSWA 5IDYA 1LDYA 1HLDA 4E2XA 3DBHB 3A1NA 1P1KA 4HUJA 4E13A 4L76A 1A4UA 3Q2KA 1XCBA 4J4HA 2B4RO 4EZBA 4IDGA 1IB6A 1Z75A 3FBTA 4KP7A 3H3JA 1HDRA 2J3KA 1IHXA 2FOIA 2X6TA 3PFFA 1IE3A 3W8FA 2VUUA 4CQMD 1E1MA 2ET6A 2OMEA 3DDNA 3INTA 5A1TA 1ARZA 2FRDA 1WNTA 3QV1A 2P68A 5JMPA 3KBOA 5F5LA 1HDOA 1WDKA 4XD2A 4BMNA 1I33A 1XG5A 2BFAA 3GFBA 3ZCXA 1NWCA 3SC4A 2CVOA 1N1EA 3AI1A 1XELA 3WB9A 2XF8A 4DRYA 4OL9A 4XDZA 2WWRA 1ZK1A 3KOUA 1A27A 2HUNA 1PJSA 2X8LA 1QP8A 1LDMA 4LMPA 4PLVA 5ES3A 3KYDA 4J3FA 5J23A 2AE1A 2FPGA 3KYCB 3Q1LA 1P9LA 2X22A 4BNIA 5EIOA 2F00A 4MINA 5B1YA 2IEBA 2WTBA 2V6BA 3STHA 3IOYA 2DVMA 5FEUA 2X9NA 1JWAB 4LW8A 5IAAA 1SOVA 3BAZA 1E3IA 4FJ2A 1G0NA 1PJ3A 1PS0A 3F1KA 9LDBA 3RD5A 5DDIP 2YFHA 3LVFO 2AQHA 2DTEA 5TRTA 1LX6A 4H3VA 1JKFA 3H9UA 4BNVA 2B4TO 4CM8B 2GZ3A 2EF1A 1P74A 1X7HA 4J9UE 4DC1A 3WMXA 3JQGA 3ZV5A 3FHLA 4BNMA 2WYVA 1GYRA 4DPMA 3B1FA 1ONPA 1C0KA 3T4EA 3GG9A 4E6PA 2FSSA 1DDOA 3TL3A 3DHEA 1DJQA 1EVYA 5A9SA 2AQKA 2DAPA 1V0JA 3C24A 1ZFNA 2ZYGA 2GUGA 4NFHA 3JQAB 4UVGA 4EUHA 1HZZA 3QVXA 1A72A 1UR5A 5FI3A 1LRKA 3BYZA 4CMJA 1UXIA 3TFQA 4I5FA 5A5FA 1X7DA 5JCJD 1C1DB 3GHYA 5BNFA 4RCVA 3ASVA 1QYVA 1E3LA 3LC1O 1TI7A 2Q1SA 1Y5MA 2EKLA 4B4WA 1P1HA 5JAMA 4FS3A 3QQPA 3A06A 5CEJA 4MIOA 4YAEA 2QYTA 4KUHA 1L7DA 1P1RA 4IDAA 3PHJA 5CG2A 2VYND 3ZU3A 1U2GA 4U7WA 3U3XA 2NNLD 4AFNA 3C7CB 4R68A 3K31A 3DTTA 4G81A 1PJBA 3OF2A 3TSCA 1Y8RA 2ZCUA 1RYEA 2E82A 4IXWA 4B4VA 3JD4A 3TPCA 1EEHA 4IIVA 4TWRA 1KY4A 4XRGA 4PLZA 1HXHA 1ZSYA 3EY4A 4YWJA 1N9GB 4IS3A 1SZJG 4B8ZA 4PN3A 1NQ5A 3OEYA 4CJXA 3JQ8B 3WGIA 2O50A 1H0KA 4KMSA 1W6UA 3H5RA 4WUVA 5AXCA 5A02A 1HYHA 2OFPA 1JU9A 2HJRA 4ND2A 1UZNA 4NBUA 5DCYA 6LDHA 2PY6A 1NQAO 1P1IA 1PQPA 2JCVA 2ZQYA 1QR6A 4R1TA 1HDYA 3W6ZA 4R01A 4BO5A 2IODA 3IKVA 4FGWA 4RDIA 4J7CA 1T24A 4JJIA 1XGKA 1QMGA 3WQSB 5L40A 1KVSA 2PKRA 1XU9A 2GRAA 4IIUA 4BVAA 2PK3A 1EQUA 2X9VA 3DTYA 4D45A 3ETDA 4XYMA 1DLIA 5L95A 4BNJA 3K6JA 2C5EA 1R4NA 2JJYA 3FR8A 3RROA 3S2EA 1N5DA 3IKTA 3E48A 1ISHA 4DGSA 3JYNA 4K6FA 4A73A 2O3SA 4GX2A 2PLAA 3V2UA 1OOEA 2C20A 4RPJA 3I6QA 4MP8A 4R3WA 4RZHA 4Y67A 3ZGYA 2VNAA 4W82A 1JDJA 2EERA 4K6CA 4O59O 3C8MA 1DIBA 1NYTA 4E5NA 1HEUA 3ZWWA 3GZNA 1VE9A 2O3TA 3ZWAA 3ULKA 4W7HA 1A9YA 1I3KA 1H6DA 1O9BA 3FSRA 2Z1MA 4OKIA 4XYEA 5HA5A 3WLFA 1YONA 1NPTO 4FJ0A 1ZKMA 2Y99A 2JCXA 2J3JA 4LK3A 1P33A 5H82A 3AUAA 2IZ1A 5EQFA 1O95A 3IDSA 3PK0A 4HNHA 4ALJA 1O5IA 4CUKA 1J6UA 4AJHA 4DIFA 2Q2QA 1DB3A 4N5LA 3RUDA 3D4OA 3RJ5A 1DFHA 4IY1A 5L51A 3GGPA 3BTUA 1HRDA 1WPQA 5JCXA 2ZJ0A 1JWBB 3EVNA 4NK4A 5JYDA 1MXHA 1AHIA 3OQ6A 2V65A 2NTJA 2BFMA 3EDMA 2BELA 4I5DA 3PI7A 4FFRA 2GN8A 1BW9B 1JA9A 5HS6A 1C3VA 1X15A 2HO5A 2H6EA 2FR0A 3H9QA 4I9HA 1PGOA 3RBVA 4BO9A 3Q2IA 3D3WA 1U7HA 4HFNA 4L4XA 3AU9A 4IQ8A 3HDJA 4KZPA 5IN5A 5ER9A 1U3UA 2POQX 3NUGA 1RM0A 2B4QA 3DAPA 1Q7BA 3ZWVA 2HAEA 3KB6A 4D41A 4EW6A 1GPDG 1TEHA 2Q1UA 5K9ZA 3AM5A 1LC3A 1LDEA 5EJ2A 4UREA 1PL8A 2YV3A 4CQLB 2IDZA 2HLPA 1N7GA 4BMSA 4UAGA 1B16A 4EITA 3ITKA 5BSFA 2BI7A 2JKVA 2X7HA 3JTMA 2X5OA 3WIDA 3PYLA 3HWRA 1UXJA 4WLFA 3TFOA 2GGSA 2PFGA 2Y0DA 3GY0A 3ABIA 1JLLA 2A9FA 2C0CA 2VOJA 2O4UX 3AM4A 4IPTA 2UV8A 1W8DA 4BUCA 3Q9UA 4D3FA 4MKXA 5AYVA 2A92A 1B2LA 1LQTA 1ZH8A 4GI2A 2Y1GA 2Y1FA 2ZK7A 2PGDA 1NPDA 1Q0LA 1TVEA 1NHWA 3D3WB 5IJZA 4BGUA 2Q2WA 4UVHA 3TZHA 3DO5A 1PS8A 1PX0A 3GUYA 3JYQA 3OJEA 1KS9A 3AUUA 3GEDA 2RAFA 2O7SA 1YVEI 3H4VA 5JO0A 4Z0HO 3R3SA 4BKRA 1T1RA 1KOLA 4DLBA 1Q0QA 1E0DA 4R54A 4NU6A 4EJMA 4FDAA 3FCOA 2PGJA 4U5QA 4O63O 2FR8A 4CLRA 3B20A 5K6AA 4UUMA 2HK7A 3VZPA 1UP6A 2CNBA 2OZPA 4XX0A 1D7OA 4D0SA 1QYDA 1VSUA 3FBGA 2GF2A 5IXSA 1XA0A 4MVJA 3VHRA 2G17A 3O8QA 4Z9XA 3Q11A 2H1SA 4FC7A 1CF2O 3CUKA 2CDAA 3PHLA 4XQGA 1SEVA 2WYUA 3DQPA 5AXAA 3F9IA 3F6YA 3RC2A 3DZIA 2UVDA 4M1QA 1MG0A 3V1TC 4K26A 3VTZA 4GGOA 4GAEA 3BTOA 2QIOA 2NV6A 3NJ8A 3OJ0A 1YOVB 2EEZA 4J7XA 3GRPA 1ORRA 2QZZA 4R51A 4WPGA 1YDWA 2ILTA 1E3JA 1R0KA 4GH5A 4P4GA 2WSBA 3SEFA 3UCEA 4DVJA 4GKVA 4TKMA 3K9QO 3IUPA 5CFZA 1Y7TA 3F46A 2A35A 4PZEA 2B35A 4LMRA 4CLOA 1P77A 4Q3DA 3WSVA 1SO8A 4PG7A 3FWZA 4TQGA 5JMWA 4RVSA 2HMUA 1T2CA 3DZGA 1MFPA 1QORA 1GL3A 4CMEA 4MVJG 3RC9A 4BO6A 2CSUA 2QRJA 5JO9A 1J4AA 1YWGO 3LZ6A 2HK9A 4XYBA 1GZ4A 2V6MA 1E1KA 2QG4A 3ANNA 4MVJD 3AOGA 2OBYA 4UUNA 5TQVA 1B26A 4BO4A 5BSHA 5KVCA 1HF3A 5CHEA 1D1TA 4XR9A 3FTPA 4DREA 2IZ0A 1IOLA 2VHYA 2ZB8A 4BO3A 5ICSA 4Q9NA 4QQRA 4CMGA 2E4AA 4G5HA 3GH3A 4M55A 5CDTA 3Q0EA 1YO6A 2YJZA 1ISFA 1BW9A 1DPGA 3ETEA 4MVJM 4B7XA 4R41A 1AXEA 3DHNA 3ICPA 3IAHA 1I8TA 1D1SA 4IJVA 5CDUA 5HBRA 4HXYA 5JC8A 1UP4A 4TZKA 3GEMA 3OP4A 4I1IA 4WGGA 4B79A 1H6BA 1KYQA 2IYOA 3WJAA 3OQ1A 4J90A 3DBRB 3DBLA 5G0SA 3DZHA 1R15A 2EW2A 3E9MA 1KVRA 2VYVD 3VPGA 5T8KC 1GUFA 5G2OA 1BRMA 4TROA 3L07A 2FPIA 3JQ7B 4BNWA 4IJKA 3CZRA 5TF4A 2NVUB 1TLTA 5AVOA 8ADHA 4BNXA 3QWBA 3PTZA 2G5CA 3FF4A 4NFSA 4YBZA 2GR9A 3G0OA 1GTMA 1MX3A 3TN7A 1X0VA 1R37A 1U1IA 1IL0A 1IPFA 2AEJA 1FJHA 2JHGA 3DBLB 4GGPA 4OXNA 2BGLA 4Q3BA 3RFXA 5TLSA 4HFJA 3ANMA 1XR3A 2VRCA 3DMYA 2BGKA 1CQIA 1K2WA 3HDHA 3G79A 3I83A 3L4SO 3V5NA 1T2DA 4EUEA 4CR6A 2Q3EA 4YACA 4YJHB 1SBYA 2DT5A 3D5QA 2YY7A 4Y6SA 2ZIZA 1DRUA 4ZRMA 3GNQA 1NR7A 1BG6A 4WJZA 1A9ZA 4UVDA 4XKJA 3HJAA 3GMSA 1R16A 5EL0A 4Y6RA 1P44A 1ZSVA 3DHYA 1U4SA 4OGWA 3ZHZA 4JQCA 3I3OA 1U3WA 4OQZA 2O7QA 5FI5A 3LT4A 5FF9A 4PLWA 4RVGA 1A7AA 2D5AA 1YL6A 1WVGA 4OIMA 2OHXA 2C82A 2IYPA 3RUIA 1AUPA 1X7GA 2LDBA 3HN2A 5KKAA 2JD0A 1Q2XA 3DC2A 3IC5A 4YRDA 2C5AA 2RHCA 4NFYA 4A2CA 3JQDA 3IMFA 4CM3A 1YGYA 2A94A 4NNJA 1R4MB 4A26A 4AJ2A 3VH1A 3GF4A 3S8MA 2Q49A 1KEVA 1B7GO 4CMBA 3E8XA 5GZ6A 3PQEA 3RKRA 4AL4A 4PRKA 3ZWPA 4MOWA 4KQXA 4M49A 3K96A 1NAHA 1NASA 3KXDA 3PJDA 4O0LA 3UF0A 4CV0A 2EJWA 3D4NA 5JC1A 1VJ1A 4LRSB 4E3ZA 3EW7A 4YPOA 1EFLA 4H16A 1XQ6A 1ZNQO 3VH2A 3O38A 4Z0TA 4JK3A 2BKAA 2ZQZA 4E0BA 3U9LA 2FWMX 1KC1A 1GPJA 3BA1A 3PIDA 4FD3A 2VN8A 5JDCC 3C85A 3QWFA 1LDNA 1CYDA 3CINA 3P7MA 1DEHA 1X1EA 4YQYA 4FBGA 4YDRA 3RFTA 4CV1A 2EXXA 2UYYA 4NBTA 3L77A 3WS7A 2DUUA 2XOXA 4FN4A 1ZIDA 4MKRA 2XPCA 3RI3A 4C7KA 5L7TA 3CMCO 1NTOA 2EG9A 1OZAA 3O8QB 4O5OA 3TL2A 1EMDA 1WAMA 3OETA 4Q3EA 1F06A 1GYPA 3X2EA 4BO7A 3VH4A 2W8ZA 1OI7A 1UDBA 2VTDA 4BNUA 4EUFA 1HYEA 2B0JA 3H9JA 3TNLA 3MOIA 5IDXA 3DWFA 3UUWA 1GR0A 1DSSG 4RQTA 4DBVO 4DMMA 3ZU5A 1PGJA 2NTNA 2ZYDA 4XCVA 4LGVA 3FI9A 2LDXA 5GMOA 9LDTA 2VZ0A 5K6AC 2E6UX 2DBVO 1ID1A 3UGKA 1H2BA 1DIAA 3NKLA 4RGBA 1U5CA 4RL6A 3CTMA 4L75A 5THKA 5C7IO 4PG6A 2UAGA 4RLSA 5IF3A 3VVBA 4XGIA 4GWGA 4AJOA 3KSZO 1QV6A 1RJWA 5EESA 5JYEA 4NBVA 2NU9A 3A14A 3GZNB 2BD0A 2D4AA 3H6KA 2OP1A 3DBRA 3NTOA 4CLXA 3QW2A 4XB2A 3WGQA 1GEGA 1KIFA 2I3AA 3PP8A 3TWOA 1Q0HA 5L3ZA 2HQ1A 3U4HA 2QZ9A 1GADO 1HTBA 1M75A 5KVVA 1I30A 1UUFA 4TVOA 4P8RA 4ALLA 5JY1A 1ADCA 4GX0A 4OXYA 2J5RA 3RUFA 2PD6A 2QRKA 1ONNA 4MO2A 1E7WA 3KETA 1GZ6A 2GD1O 5T57A 1C1XB 4WLUA 4RORA 4E21A 3BMQB 3G17A 5T5QA 5L4NA 1VJTA 3TF5A 3ADPA 3WWYA 1W73A 4F46A 1GUZA 3R0IA 2YDYA 4PVDA 4CMIA 4ZGWA 4NG5A 4DBZA 4Q3AA 5CEEA 1LLCA 1I2ZA 4IINA 3OQBA 3GEGA 4XRRA 3ZWXA 1SAYA 1E3SA 1BGVA 1MP0A 2ZTLA 4E4YA 2W2LA 2B5WA 4F45A 5HM8A 1WMAA 5L9AA 3P2YA 4GL4A 4KUGA 2FR1A 1V6AA 3F3SA 3Q3CA 3VAZA 3PZBA 3MJSA 2YYYA 1A4IA 2JD1A 1U28A 4FSHA 1UAGA 4L73A 2GN9A 3ZDFA 1L7EA 4EJ6A 5A9RA 4IM7A 3VZRA 4JXKA 2Q45A 1KERA 2C29D 5GY7A 4AJ4A 5EMHA 4DL9A 1XLTA 3F4BA 1Y1PA 1SC6A 2B5VA 2Z95A 5KTKA 1E5LA 3V1YA 1WDMA 3WGTA 2G1UA 2JD2A 3JD2A 4E5KA 4NJMA 3ZW8A 2GZ1A 5JAIA 3MJ4A 4XQCA 4XYLA 4WCFC 3ZU4A 4OAQA 3WGHA 3U4DA 4GQAA 4IGEA 4CM6A 2C7GA 3VPSA 3D1LA 1Y9AA 3E03A 3JQFC 2V6FA 3PJEA 4GBJA 3X2FA 4OOEA 2FZEA 3GPDG 3JQ7A 4XZ3A 2YHIB 1ZVMA 1K5HA 1DC5A 3L6DA 1U2DA 1LC0A 1ZO8A 1JN0A 5KNLA 3TRIA 4BO2A 4YQZA 3FPLA 4WCDA 3I9MA 1DC4A 1JVSA 3DMTC 3GFGA 3JQGB 5G4LA 1ZJYA 3QVWA 2HU2A 4E30A 1A5ZA 3AW9A 1LLQA 2BH9A 2Q2VA 3PHIA 1I3NA 4KDEA 1ADFA 1YB4A 3DZFA 1X14A 1N8KA 2GN6A 3FNEA 3FD8A 1EVIA 1FDSA 2G76A 3DB2A 3TZQA 2DPHA 2ZJ1A 5CPBA 2YQ5A 3HE3A 3LC2O 4LRTB 3GR6A 1EBUA 2J6IA 3ZHBA 4XDYA 2D8AA 3MTGA 3JQ9C 4G2NA 3VPFA 4EYEA 1FDUA 4AJ1A 5BNIA 2EIHA 4BKQA 3KYCA 2B69A 1Z82A 1GQYA 1YB5A 2Y1DA 2Y93A 2Y05A 2ZTMA 4WCFB 4YRBA 2RIRA 4TMFA 2DBRA 1LJ8A 1SEPA 2ZB3A 5G0UA 1XEAA 5L4SA 2YQ4A 3PWSA 5KVQA 3CPSA 3INGA 4LCEA 1KY5A 4H7PA 4J4TA 1EDOA 3IP1A 4WLEA 2AG8A 1U3TA 3ZWBA 3CMMA 3LSYA 2CDCA 3EZYA 4PLHA 2X0JA 1JKJA 1CETA 4BNKA 3LYLA 4FFOA 1CWUA 1NHGA 4JBHA 3TDKA 3UFXA 4FIZA 2I9PA 4F6LA 4Q39A 3AM3A 5JCJA 2C2XA 4ND4A 3U49A 1X1TA 1E3EA 2P5YA 3E9QA 3EGOA 3ROQA 3UCXA 1PSDA 5A3JA 1GEEA 4ITUA 2X86A 4J7UA 5BNTA 3EYWA 3W8DA 4CLDA 4M8SA 1PJ2A 4CMKA 2DPGA 1PGNA 5AXDA 1L1FA 5KJCA 4BO0A 3W8EA 1RM5A 3IQDB 4L9RA 4CL8A 4OQYA 5I9NA 7MDHA 4CMEC 1XIVA 3COSA 4Z9YA 3I9LA 1P1JA 3NTRA 1Q1NA 2NTVA 2OBNA 3KV3O 4YT4A 2OL4A 3S2FA 1S6YA 5I9LA 1NVGA 4XIYA 3SXPA 4CM4A 4PLTA 3S2IA 3ZI0A 4L8VA 2J5KA 5K0ZA 4QSMA 1EUDA 1G0OA 3BMOA 4XQ9A 4CM4B 5BT9A 4UUOA 3V2GA 2HRZA 3GA0A 3ANLA 2W2KB 4P4LA 4CM5A 1KVQA 3ZU2A 4E31A 4E2ZA 5A04A 1SNYA 3I9KA 2NADA 4GX1A 1JTVA 1VSVA 3QWHA 1GQQA 2VWGA 1E77A 5ILGA 1U9JA 2ZKLA 1DLJA 3ZV4A 3H7AA 1KEUA 4HFRA 1H93A 5DF1A 1IULA 2IZZA 3KHUA 4OH1A 4ID9A 5IDQA 3BMCB 1SB8A 2PZKA 2PKQP 3GNSA 4I5EA 2FPPA 4QFCA 4QO7A 4BNHA 4D44A 4BMVA 1WLYA 2ZATA 3PPIA 3IP3A 2P4QA 1LLDA 2VCYA 3I4CA 3K30A 7ADHA 2FHSA 2C54A 5A06A 2YHIA 2DUWA 3FTNA 3KYDB 4R1SA 1CEQA 1PL6A 2NSDA 4BKPA 1HETA 5AOVA 3S1LA 5ITVA 3ASUA 4PGFA 3RASA 1I3LA 3PHGA 3ONDA 2EKQA 3UN1A 1EUZA 3C1TA 3SC6A 4II3A 2ZB4A 5ER6A 3MOGA 1PS9A 4QEDA 1PGQA 4NR0A 3VDQA 1O6ZA 1VPDA 3T7EA 3AJRA 1E7RA 1B15A 3T7CA 3VKUA 3OJLA 2HMTA 2F1KA 1JAYA 3ROKA 5L4LA 3BHJA 3M6IA 4ZQHA 1UP7A 3VC7A 1IY8A 2EV9A 2VUTA 4NBWA 2BF7A 3AI3A 4M87A 1Y8QB 1C0LA 2CVZA 1SPXA 3E5MA 2GNAA 3WYCA 1HDGO 4D42A 2O3RA 4BV8A 4F3YA 4S3MA 4ALKA 2X23A 4NK5A 3WGOA 4ILKA 2BFOA 4K9DA 3GOHA 1F12A 1G1AA 1J5PA 1NQTA 2EW8A 3DFUA 1GV1A 4GKBA 5CEFA 3M1LA 5CAEA 1HSZA 3JQEA 3PWKA 4DIBA 1EFKA 1UDCA 1HDZA 4R3NA 1UH5A 1SCUA 3NYWA 3SX2A 3TZ6A 5EPOA 4X54A 4CM7A 5BQFA 2HSDA 4ND1A 5JE8A 4CMAA 4Z9FA 1GV0A 3FRJA 1LXCA 2R6JA 4KOAA 4IUYA 2J3HA 3HN7A 3WMWA 2GLXA 1RWBA 4WEOA 2AMFA 2VZ8A 1Z73A 3WBFA 3ON5A 3UICA 2VT3A 1JQBA 1IPEA 4PFJA 5A03A 3HG7A 3LT1A 4BV9A 4XB1A 1PR9A 1I2BA 2JCYA 2D59A 4NI5A 3PGJA 4RV9A 4BNNA 1QV7A 5I7VA 1P1FA 3RU7A 3LT0A 3AU8A 1OAAA 3I4FA 3LF2A 2I5PO 3JQAD 2PD3A 5B4UA 3DXFA 3DZBA 3T4XA 3WICA 1QLHA 3ZNPA 3GUCA 3UCFA 4IJWA 3B1JA 4RO0A 1BHSA 5TX7A 1V9LA 3NV9A 3PWZA 2BRUA 1PWXA 3ITDA 4IS2A 3VH3A 1N9GA 3UKOA 1BXGA 1EUCA 4YAKA 4FJ1A 4JP2A 4MJLA 1IHYA 1NXQA 1PQUA 2VT2A 2BMAA 3A28A 2PH3A 3WFIA 5KKCA 1F14A 1T25A 2VYVA 3H5AA 4ZQGA 1N92A 1ENZA 1ZXBA 3P2OA 5COQA 3PDJA 1FDVA 2Y1EA 3M2PA 5L7YA 3I23A 4J1QA 4FR5A 4M54A 5C5IA 1P45A 3L9WA 1P3DA 4O1MA 2VRBA 4JX8A 4OSOA 3U62A 1T4BA 4N54A 5IFLA 3TJRA 2FP4A 3GN1A 4P22A 4BO1A 3W1VA 1YH3A 3KUXA 3U0BA 1ZXLA 3ZNQA 6ADHA 4GMFA 4C7JA 1I10A 1TXGA 3KSUA 3NJ4A 2CMDA 4IZIA 5DBIA 3OICA 1ISMA 2NVBA 3A4VA 1B8UA 1ZW1A 4DYVA 1MG5A 1O94A 2HMVA 1AHHA 2HCTA 3RCBA 3AY3A 4BKOA 4QXMA 1H5QA 4JCOA 4Z3KA 1DIHA 3KRTA 3QSGA 2D0IA 3JQBC 3RU9A 3JQBA 1I0ZA 4CMHA 2NU6A 3BZUA 3HDYA 4I9UA 2CD9A 1HE2A 5TSDA 4BB5A 3WWZA 2VNSA 4LISA 1BVRA 2AQIA 4UVEA 5U9CA 5LCXA 5FWNA 4RVDA 1DFGA 1ADGA 1XU7A 2Y67A 3K2EA 4GLLA 4HWKA 5DCUA 3MJEA 4E5MA 4QTZA 2E37A 3O9ZA 1UXKA 4CM8A 1I5RA 4AJPA 3ZWNA 4UULA 3K73O 5H83A 5KOIA 2VOEA 3QJ5A 4BNTA 3TZCA 1N2SA 2XAAA 5I9MA 1H2HA 4CV2A 5U1PA 3NRCA 4CV3A 2J8ZA 3OA0A 1SB9A 4UEJA 1GCOA 2P9EA 4NMHA 4KDFA 4N5MA 3ZV6A 2I66A 3G1TA 2EJVA 5EINA 4U6QA 1LDBA 1E7SA 1HKUA 2AW5A 4IGFA 5G0WA 3E9NA 3ICCA 1V35A 3FWNA 1ZBQA 1NM5A 4J49A 3RC1A 4HX5A 5L7WA 1PWZA 2P91A 2PD4A 2Y1CA 4CPDA 5ENVA 3QHAA 3ENNA 3RIHA 5L45A 4CLEA 4DXHA 4I5GA 5CP8A 5F1KA 1F0YA 3SVTA 1AXGA 1DJNA 1H9AA 1S7CA 3HNPA 4G65A 3PJGA 3WBBA 3S55A 5ICMA 3ONEA 3HUDA 4XGNA 4YT8A 3C1AA 3WQRA 3GN2A 3D64A 4CLHA 1NVMB 4CR8A 5DP1A 3ZW9A 4PCVA 4IBOA 1ZEMA 1HL3A 1W4ZA 1LU9A 2ZYAA 4FW8A 1QLJA 1J0XO 2NQ8A 3NGXA 5F1OA 1A71A 3OH8A 3WGYA 1F17A 2BHLA 1YBAA 2EP5A 2Q99A 3AFMA 3QWIA 3TOZA 4EJ0A 5IDWA 4FFMA 1B8PA 3AOEC 5A4DA 3V8BA 4AICA 2ZTVA 5JDIC 4XEHA 3OIDA 5JDIA 1PJLA 1T2AA 3GGGA 5ADHA 1CDOA 4BNZA 5G0TA 3VZQA 4BNFA 4D0RA 4DWVA 3WYEA 4CMCA 3KSDO 3I6IA 3I52A 1VKOA 2PV7A 1WW8A 3QRWA 1V3UA 3FNFA 1XWFA 3W6UA 5T8KA 2H9IA 3UOGA 1DAPA 2EKPA 2YUTA 5T67A 3VPHA 2I76A 3GC6A 3WXBA 1C1XA 5KVSA 1AGNA 3KZVA 2W98A 5JW6A 1I32A 4WK6A 1Q7GA 4J6FA 1LUAA 1N1GA 4BGVA 4IMRA 4AVYA 3GQVA 3WOHA 3JQFA 4RPKA 4ZRNA 5TT0A 4CUJA 3ST7A 4ESOA 5BSGA 5JSFA 1MGOA 2GYYA 3RQSA 5DNAA 4D79A 5JXWA 1TT5B 1EK5A 1UZMA 2CZCA 3DAGA 3MTJA 2Q46A 3WNQA 1NVTA 4D43A 1Z6ZA 4J4BA 1NFQA 2X0NA 5TC4A 5CPFA 4FPXA 3GMDA 5F5NA 3RJ9A 3TOXA 3PXXA 1BTOA 1RKXA 1X0XA 2R00C 1E6EA 1PEDA 1TT7A 1QSGA 4JN6B 1U3VA 3IUSA 1EZ4A 3HQ4O 4BNLA 4CR7A 2WE8A 1ZZEA 4E2WA 4MP3A 5F3RA 4GSKA 3NTQA 4RLHA 1IUKA 1ENOA 2X1HA 4L74A 1BVUA 3AY7A 3OJFA 4YJGB 3BTSA 2W2KA 4MVJE 2ZTUA 4Y6PA 3RUEA 2AE2A 1JAXA 4YEDA 2NLOA 3A9WA 3AI2A 4ND5A 1H6AA 1Q7CA 1FK8A 4CM1A 1JVBA 3I9OA 1E1LA 3TZKA 5I7FA 1E3WB 4W9NA 2DTXA 3VDRA 4MVJF 2DFVA 2X4GA 3EMKA 3OECA 4M86A 4FFLA 2HK8A 1NFRA 1HSOA 3R6DA 5A3VA 4JLWA 4EEXA 1LDGA 3VOSA 2OGUA 4JJFA 4TRNA 2PWZA 1FXSA 3GVHA 2Q50A 1E7QA 1P0CA 3ROMA 4NJMB 2QW8A 1GCUA 1RYDA 5JAQA 3WG9A 3UW3A 1Z7EA 3D0OA 4DLLA 2WD7B 1NWHA 4P38A 1B8VA 1GAEO 3N58A 3JD3A 3DAFA 2VHVA 1LA2A 2VHXA 4DQVA 1E5QA 2JHFA 3NDIA 5T6BA 3PQFA 4A5OA 4WKGA 4CMIB 2TMGA 2DLDA 3LQFA 1ZJZA 3IJPA 4F6CA 3H9EO 1D8AA 1LEHA 4BNYA 4PLFA 2W4QA 3BMNA
chains in the Genus database with same CATH superfamily
3PQDA 3UO8B 5DTMA 5TJ9A 2JAPA 1BXKA 1X7WB 1ZGZA 3NH6A 3P27A 1OLSB 1PW7A 4GSLA 1LK7A 5YASA 3LFHA 2CGEA 2HSGA 3EOZA 1QYRA 4GXQA 5FLYA 3RFVA 4A92A 3PL1A 4FE7A 5JXJA 1IUOA 3BTVA 1H3EA 2FAXA 4RM3A 3RG2A 5E6SB 3OBBA 4V3CA 2O3UA 3NDJA 5E4FA 4OH7A 4RQUA 3PVZA 4DIDA 4CEIB 4C4OA 2Y1KA 1V26A 5JH7F 1P17A 4EG4A 1HNWB 2J5QA 3OWOA 5CA1B 1KZHA 3KTDA 1SA0B 3TR6A 4Q6WA 3QTLA 1CJUC 2Q5JA 3PC3A 1SJ9A 3OIFA 3HCRA 2FOXA 2IXBA 3I6BA 2VA9A 1DG9A 1DIRA 2A3RA 3G7NA 5KTOA 2XDWA 2ZRKA 1AHPA 1CS4C 1T15A 3TKAA 4ZZ3A 3Q87B 3GXBA 4FYVA 3ETLA 4DDKA 4MPPA 3USCS 2BDEA 2OOSA 1Y37A 3I0ZA 4EHKA 1GP2A 4Y9TA 3I1JA 1UFOA 2AXNA 3D8NA 3FPAA 4BXOA 2XUOA 3HC7A 4KLRA 3G8CA 3LI2A 4B3DA 3KAQA 4HNTA 2I9KA 3BK1A 4MLPA 2BKVA 3SG0A 1G60A 1Y9EA 1DEAA 2NV2B 5H70A 1IXYA 3P8ZA 4PAQA 4II7A 4ANFA 3UK2A 2NO1A 3IUBA 5CTJA 1Z83A 4G41A 2BFPA 3ISJA 2P30A 3ESZA 3KKPA 5DN6A 4AULA 5H8WA 1UK9A 4OHZA 5B55A 3EGIA 1VP9A 3VYTB 1C0PA 1VE1A 2BSAA 3LGAA 3GJ6A 3KZCA 4IRMA 2Q3CA 1P81A 4YECA 2HDHA 1BGXT 2AJCA 4H7FA 2KW5A 2O2ZA 3NWEA 4KX5A 4MS4B 3TIGA 2OFFA 3A32A 4IHAA 2BE7A 2QTBA 4RVFA 1XTQA 3G3EA 3DMTA 2VDLB 2Q1TA 2CUTA 1TMOA 2WJPA 1JR3D 4O4HA 3AR3A 2GPTA 4UBLA 4P93A 1DKUA 1DX6A 4J1SA 3W2EA 4J2HA 1KFEB 3TW8A 1CERA 4XM2A 2VQ3A 1LS1A 1BDMA 4Q3NA 4US2R 4E3WA 3VKGA 2QB5A 4FNGA 1PZHA 1PIWA 1T4GA 1EVZA 3TGLA 2ZIXB 1ISIA 1NDHA 5KJ6A 1L8AA 1GY8A 1P0IA 4FU0A 2VZ9A 3MLAA 1RYNA 1IQUA 2GUWA 3QI2A 1EFPA 2ZPTX 1QH0A 4L08A 5ALDA 4IEIA 3CX8A 3ILXA 4XA8A 2B36A 3FPSA 1JHVA 4PFSA 5A3QA 2WEKA 3P9PA 2IRWA 1R12A 1NUQA 1VHLA 1RXYA 2XQJA 3MD0A 4FI3C 4FHEA 2ENWA 1UMCB 4IDOA 3IP7A 4QBKA 3NOXA 4G24A 3O4FA 2EQBA 4G9BA 4OJKA 3U5TA 1IN8A 5MN5A 2PT7A 1QHHB 1Z4PX 4BFZA 3EZNA 5IP5A 1TQHA 1U2SA 5EJ4A 3CXRA 3VQTA 3AEKB 2D13A 4BMCA 3ZDCA 4P7GA 4OHPA 4Y6QA 2HV9A 3X1KA 4KMMA 3ZPXA 1SCBA 4BS9A 4LHVA 3RABA 1E6WA 3BOSA 3HHPA 4N0DA 4U2BA 3GZTB 3DEJA 1MU0A 5EFZA 1MQ9A 2PNFA 2YFQA 3TSZA 4AN1A 5FH9A 5F3WB 4YV0A 3IUNA 3B70A 1Z3CA 1UZUA 1MABA 3U7JA 1KI6A 2WHPA 5KOJA 1NXVA 3GDGA 3LUAA 2NACA 2IPMA 2CT8A 1JFVA 4PXSA 1RLIA 1BDBA 1J0CA 1FTGA 2W58A 2WV9A 3ORHA 4ZAWA 4ZCSA 2NU8A 4Z6KA 1IIRA 4ZXPA 5T4HA 1GPMA 1VM6A 1AKMA 3IBFA 3LX8A 3ZY4A 3PFWO 4KIGA 1T1EA 4W5JA 2MCFA 4PZ9A 3D4PA 1ZMOA 2WHQA 3EH2A 3NEYA 4JIGA 5DNEA 3SNKA 4JQYA 3FLBA 3DLIA 4I8XA 1UJCA 1T9BA 5J5VA 1XQXA 2Q4BA 3B5IA 4J1NA 5DT9A 3OZGA 1CIVA 1E3MA 2NU8B 4MIKA 2HPHA 4TUYA 4Y9RA 5LZ8A 4YV1A 4DCGA 5G4KB 4Z3DA 2WHPB 4B8YA 1FSGA 1XZKA 3EIOA 1XQYA 4RA6A 3MRVA 2O57A 2WHEA 4HAWA 4ZC8A 3FFXA 5IK2D 3O4VA 1L7OA 3G8DA 3QF4B 5KTRA 2ZG6A 4QU9A 1TUEA 1QK3A 2C98A 4EFKA 1OH7A 4MQEB 4IDDA 4KPFC 4AUKA 1GGMA 2QYOA 1D2EA 2BM9A 3QUTA 5IZ4A 4BPBA 3CZAA 5EZ6B 4MIYA 3BXZA 3CRMA 3FMPB 1KI3A 1WZNA 5SY6A 5F2NA 5CIQA 4EY6A 1RQLA 3FNGA 1DINA 4IDFA 3TL6A 5HPYB 1CYEA 3OMLA 4PG8A 4ZARA 4BQNA 5DMXA 1N3BA 3UVEA 5BW4A 1KXZA 3NHMA 3P9YA 4P7KA 1VL6A 1V3TA 3TDMA 4EQ6A 5BY2A 1W59A 2W2OA 5FWXA 2FW6A 4YJGA 3WIVA 4RCZA 4NX2A 1KYZA 4MRAA 1GT6A 5JAHA 1JZSA 5SZHB 1FB5A 2VPTA 1RKVA 1XNQB 2AXQA 5DTQA 2PX5A 2ZDGA 2ZB7A 2YIJA 3CLSD 3AF3A 3JQAA 3Q8XB 4MR7A 2VTVA 4LHZA 5KYNA 1C8BA 1MN6A 1Z0ZA 2UUBB 4YI5A 3LQ4A 2QBYA 5B4VA 2ZYUX 1HE4A 3NOQA 3BIXA 3DC7A 1XWIA 1QHNA 1PJRA 1BX0A 1MPTA 2SCUA 3PR1A 1Z45A 4JEMA 5E8RA 3A9CA 1Q92A 3ESXA 3N6XA 4UTOA 3ZJ4A 2FETA 3PIIA 2AZXA 2GRJA 4KE7A 1F8FA 1TCAA 1XDWA 4OGFA 3MN1A 3ZNOA 3D6FA 2NYAA 4V0OA 4X64B 3AVVA 4KITB 4EGCB 2O0JA 3GDOA 3NHJA 4X1IB 1HFWA 4NU8X 5GONF 2OSVA 1BX3A 1K0UA 1EB8A 1JDZA 3L7YA 1SCAA 4Z4IA 5JJLA 4GUAA 3IJEB 1J8DA 1P29A 4YT2A 1ZK4A 2W6CX 3LYUA 4UXHA 2HT1A 1PR3A 2IYNA 2OYSA 4ARZB 2Y66A 1HYGA 1JPVA 1R6DA 3PUIA 4QD3A 5K6TA 3SE0A 3PUHA 4H7KA 4RACA 5DHTA 4ETNA 4MVJM 1YULA 1GG2A 3UA3A 4EJSC 3U17A 3ZIDA 2DH6A 3VR6H 3OM9A 3VV3A 3VR5H 1Q3KA 3ZKWB 3CLRC 3D3QA 1D5WA 3B5JA 3JYPA 4W6ZA 1YRLA 4ZO8A 1XHEA 3SKVA 2CXHA 1JEQA 3GCDA 5DE3A 2D2FA 4CQLA 2YYZA 5EYPB 1N5LA 3M6UA 1ZUHA 3FZGA 3P9KA 4MUXA 1DXYA 1XA4A 2IYUA 1CRPA 1E6CA 2JS7A 1QUEA 3IQEA 2Q4EA 5HJEA 4IO0A 3PNSA 4BC1A 2WM2A 5JEEA 4XEUA 3I61A 3SQWA 1M67A 5C5DA 4WXMA 1M76A 3FUWA 1CJTC 1PE0A 2RHRA 1C2TA 4WQMA 2C07A 1Y5LA 2NQTA 3O7WA 5C32A 2XH8A 3L92A 4TV8F 1DOHA 4YDQA 1MB2A 1R3DA 5LQCA 1ZCJA 4U3JB 5EMLA 3N7UA 1E4VA 2PMDA 4HQNA 1RT9A 1U94A 4RFSB 5IEJA 3BH0A 3IT2A 1BWSA 5TNXA 2J3IA 4ITRC 1YHZA 1DOZA 4NZPA 4RKYA 1ZI6A 4D57A 3C5HA 1IZ9A 3P5SA 3BVPA 4KWHA 1P61B 4MDHA 4MRVA 3FPEA 4RCYA 4PVCA 3DLHA 2YV2A 4DZRA 3N5KA 4EFMA 3PGMA 1JG4A 1LBIA 3L9XA 4CF7A 5EZSA 4B82A 3KJZA 4BQRA 1L7NA 3A1EA 3LCMA 4R1OA 1JR2A 2G83A 4FYJA 4L28A 1Y89A 4Q82A 3KYBA 1C0IA 5I8ZA 1Q83A 3C8HA 3KUKA 4EHFA 1LPMA 1EIZA 3CEMA 4HGQA 5DHSA 4F11A 4YFVA 1KYYA 3WAKA 5HKBA 4NABA 4RXUA 3WK9A 1YDEA 4XSGA 1AO3A 4UC0A 2I6TA 3VM6A 2Z3WA 1T0PA 4NV3A 3R7BA 2OSBA 3AVPA 4NFLA 1KPIA 1II9A 4CN8A 1J0BA 4QNMA 1OYWA 3AHCA 3GP8A 4WOJA 1JKMA 3KOOA 3D6JA 3RRXA 4KR0A 3TQOA 4Z4GA 1O3YA 1NV9A 1MOPA 1UL1X 3SDBA 4ZDIA 1YB1A 2Q1YA 3W4KA 1H8HA 4GLBA 4KTVE 4U3JA 5DYTA 3D1VA 2QJFA 4ZTUB 5C1IA 3AWDA 1P2TA 3HNOA 3FPCA 1H9BA 4MAFA 4MSUA 3ICOA 4JB3A 4TYYA 3TTVA 1CT9A 4HEA1 2O2SA 4EWLA 5EGNA 5MFZA 3SR0A 1NXSA 2JGFA 2GB4A 1X8JA 2IY7A 4LZNA 2F3SA 5JXHA 1G41A 1Z9BA 1IRIA 4ZJZA 5AW4A 1SXQA 4G4JA 2XDYA 4B9EA 4QUDA 1V1MB 2A9KA 3HFSA 2O7RA 4H4CA 1ZD5A 1KAEA 1KI8A 1YBMA 3T5PA 1MAWA 1NY5A 3T5GA 5BV0A 2HF8A 4MJXA 2J3EA 2WSLA 3SHQA 3IJRA 5LYJB 4L16A 4Z1MA 1WPGA 2HA0A 3EEIA 5JH7A 1B74A 4HDRA 5A5EA 5IT5A 4TQUS 3Q8LA 4ZICA 2P75A 2WUFA 3UMSA 1SXJA 3QX8A 1VPTA 1BMFD 3SDZA 1QQ5A 1ZNYA 4YAGA 1R4NB 4NE2A 5EIBC 1PEAA 3CLHA 5K20A 3OTIA 2PZJA 3FMVA 4R7GA 3IV7A 3WGMA 2G7MC 4H08A 5GJBA 2F9LA 3JYOA 2YZ7A 5KSPA 3ZWOA 4HN9A 2NW6A 3QJGA 3CKYA 1LSOA 1A69A 2VNHA 2XUKA 1SQGA 3NBXX 4QUHA 2UUOA 3OOWA 2IS2A 3N53A 1U8FO 1B3RA 5EJ8A 4N5IX 1WUTA 4WN9A 5TVKA 1C2YA 2MSKA 2QVGA 3RVDA 4B1FA 1TA9A 2GDZA 1P72A 3MJCA 4MQFA 8LDHA 2I8AA 3FTCA 2X15A 2IQ5A 4D4MA 3S68A 2QRNA 3FETA 1JBEA 4J07A 4B4OA 1N6LA 1OX6A 4IYRA 5TGDA 3V7YA 3LT2A 4TKLA 1CCWA 4B4DA 3FNQA 3PNKA 2IX3A 4KLCA 3LWDA 1PTJA 3HDTA 4BMZA 1ZGCA 1H1LA 2C57A 5I9IA 3G13A 5IF9A 5I7OA 4JUIA 3D8TA 4CLOB 3LC0A 1EDBA 4LV5B 1W0KA 1EVLA 2DH5A 3DO6A 3HSKA 1MT0A 4XE5A 1PI3A 4ZKEA 3C3BA 5I45A 1DWUA 4N1AA 1ULSA 3ZV3A 3BJMA 5TT1A 5J3JA 2JB9A 3DEIA 5EHQA 4UTXA 3I6ZA 3UK1A 4HDMB 3BJEA 4PRLA 3U0VA 3Q88A 4E22A 4R9SA 4D99A 2ZAOA 3OIUA 2X6RA 2R2GA 4LVUA 1E2EA 2A5JA 5DWDA 5FFFA 5KNCH 2DLNA 3H1PA 3FPFA 3UBTA 3PVCA 3UAOA 4YJFB 1Z7WA 4E94A 4Z4QA 5KNDH 5IAOA 1WU7A 2VK8A 3Q7SA 1FUIA 3OLZA 4TUYF 1WBDA 3UG6A 4ND7A 3OZVA 2YFYA 3RHZA 1U2RA 3T52A 1SWVA 2P62A 3R1IA 4XJSA 3LH5A 4BX3A 2ZJOA 1T2FA 1U31A 4IIFA 1F6DA 2WWFA 1GDHA 3LS2A 3MWDB 3IQXA 3N9IA 2PR7A 4MV1A 3OZ7A 3TR5A 4IH4A 3DE1X 1TZMA 4TKVA 3MWJA 2WQZA 1P39A 4GHWA 5K4AA 4YRQA 4PQGA 5LQSA 4WZAB 3TOSA 5JANA 2C96A 4ZODA 3BT7A 2FYTA 4A03A 3ZHXA 1LBEA 4DG8A 4BZZA 2BMDA 2XRFA 2XDQA 2QE6A 2HFJA 3P19A 1G2OA 1AKEA 5CVJA 3U80A 3HCPA 4XASA 1J7JA 1U2EA 2PHZA 2AOXA 3DYIA 1DT5A 5HUJA 1XZAA 4JJ8A 4LX0A 5ANRB 4PAOA 3RRJA 3WIBA 3WDSA 4D7AA 5AUNB 1XEXA 3L6OO 5A05A 3ZVMA 1A8SA 1I4WA 1UPTA 1KYWA 3H2YA 1E2UA 3VDMA 3EVGA 4URFA 4L57A 3A6DA 2P2SA 3EGXA 5AKJA 4PG5A 5EI5A 5H1YA 3M6LA 3F6SA 1E7MA 2BEVB 3R3JA 4M1ZA 1BIFA 1DIGA 3VJKA 3SBOA 2Z58A 2J7PA 1PG2A 1E2PA 2SICE 4H4EA 2G1KA 1BWQA 3M0EA 3PQ4A 5K1ZA 3P9RA 4EG1A 1XSEA 3F3MA 3TAXA 4DQDA 4F5WA 4FYXA 1WF3A 2QQGA 3PA6A 2CDBA 1TUGA 2W8BA 2O0HA 1W5EA 4OXKA 4JOQA 3I5MA 5CVDA 4RS3A 1G8MA 5BV8A 2WU3A 4L0QA 5DYWA 2D1FA 3D54D 3E15A 3OPNA 1UBCA 1Z5WA 3ACDA 1QKIA 5H02A 4ZVTA 2P9GA 3L0DA 3MJRA 1L5SA 3C8UA 1NVVR 4Q1AA 3SGLA 3RIMA 3PD1A 3PWTA 4FHDA 4WEQA 5D7NA 4W1QA 3BXXA 2JJ2D 2OORA 1GG9A 1UEXC 3DCYA 1QX3A 4EB3A 1Q0TA 1H4SA 3VO2A 5I51A 4KUEA 1A76A 2RAPA 1SR8A 5FOSA 3HKEA 4GDFA 4U2DA 3OA2A 4RE6A 4QPCA 1YZLA 3NEPX 4FQ7A 2OWDA 1ESMA 3WRYA 3ZNNA 4D5GA 1AMOA 1KDPA 1MDBA 1GNVA 2IUEA 1KSGA 3OZDA 4ZEWA 1O0BA 2O3QA 2XA2A 3DFZA 4JI6B 2RMKA 1D0IA 2P4EA 2QMEA 1E3DA 4HWGA 4OBWA 2FSHA 5IAKA 3KBBA 1G3QA 1AQYA 4QDZA 4BLQA 4C07A 5AUQA 5ITZA 3ADOA 1QBGA 3WLIA 3DEKA 5E7JA 4BX8A 2GA8A 1O95C 4F2GA 3UB4A 5FNVF 1XL0A 1A5SB 1CC1S 1EFRD 2UUPA 3I28A 1ZXXA 2PKQO 3KDAA 3S40A 2XNDA 4E7PA 2PBFA 5COBA 4QFDA 2ZSUA 1NP3A 1ATZA 2OD9A 1F8YA 3MJTA 3IB6A 4IXTA 4YAFA 3K70D 4G0VA 4L3OA 4L4ZA 4RXTA 4WE3A 4DTIA 3KR9A 4MLDA 4PZCA 4YRAA 5JNVA 1AGPA 4WFQA 3WGJA 1N36B 2VRCD 4KYVA 1NRJB 1XWWA 3FB1A 4MPTA 1Z5OA 3DLPX 3C3WA 1D4FA 4TSKA 3TTXA 1DC3A 1C3EA 3E0QA 4GX5A 1JBQA 4IH1A 2GD6A 2JFGA 3EXEA 2GCPA 1OMOA 4KCGA 3ZVRA 2CKDA 3UQZA 3KPWA 2QX8A 2GYVA 5BWBA 2HF7A 2GK6A 2E18A 1R8SA 4GS5A 3THOA 2CL5A 4EI7A 5T6MA 2BKUA 3QEOA 4Y7DA 2F7SA 5CG1A 1Y42X 3UWPA 2X77A 5ELMA 1MNAA 1QIHA 5K0TA 2B4KA 4N5DA 1HDEA 1FNNA 1W4LA 3OZCA 2OK8A 2X58A 5FKJA 4N65A 4I4LA 1NVFA 3FYTA 1SGWA 2FUNB 3TNYA 5ENDA 4KR9A 3EA5A 3UG7A 4E12A 2BPOA 4ARCA 2AUTA 1T6BY 2QYSA 1ZK0A 3S2GA 3RHTA 4IUBS 1QTRA 3QKIA 2AHRA 4L4YA 4RF2A 5BSTA 2DQKA 2K87A 2IZ7A 3ONFA 4YIHA 3O6VA 5FUWA 1YQEA 4O2AA 2AKAB 1NW3A 4XPIB 1V95A 1V37A 3W5UA 3BHIA 2QDKA 3JWIA 3SIWA 4KWCA 4CQMB 4OMCA 2OR3A 1B14A 4RXMA 4EX7A 1UZLA 2HRDA 4BJ6A 4MW7A 1U8EA 4YJ3B 4PZLA 1JDBB 2JAHA 3LRXA 3SYKA 2BTQA 3RUHA 3WIOA 4QEKA 4PIPA 2UXDB 2FXIA 3I9JA 3BSWA 3ILVA 3RK1A 4N0MA 3ZC3A 1U5BB 2J30A 2YWDA 1HLPA 4O02B 5B58T 3W4JA 3IDZA 4HI0E 3T3PB 2IIPA 1F6BA 1GLVA 1U9IA 1SUDA 3G1UA 3JD1A 2X1MA 4IVRA 3DHWC 4OY3A 3T15A 4J2TA 1YL7A 3FN4A 3M5CA 4YJFA 1YKFA 3L7OA 1N34B 1TTQB 2P0AA 4L8GA 2PKXA 2QN3A 2OCDA 4A36A 3VYVA 1GYQA 2MYUA 5CM2Z 5MGBA 2B9EA 2QTWB 2RCYA 1ZSNA 5J47A 3QQ5A 3W5JA 5JAZA 4ZQBA 2JFHA 3B52X 2QQEA 3JQCA 5TMBA 3FNHA 2ZBGA 3IP9A 4PLCA 3I1FA 4I9NA 4KAJA 1XU4A 2XMPA 1VQ1A 1MQSA 2I8LA 2VH1A 2XB8A 2VBFA 3MWEA 4NQRA 5EE9A 4JVMA 5AHWA 3ZS9A 4KWIA 1PJTA 1Q2UA 4NYJR 2V8BA 3SU8A 4N82A 4AECA 2DPXA 2LIVA 4QUJA 2NT3A 3ORYA 3KHSA 4Z1OA 5B6PA 3GVXA 4ZAGA 1FFWA 1HFJA 2XWJI 3MWEB 1B0AA 2BFCB 3VYUB 2F1HA 1ZVJA 5D87A 4KR6A 1XNGA 4FXPA 4TYQA 1WDLA 5F2OA 1SCJA 2E1RA 4YMGA 1S5PA 3OSUA 2B98A 1BDIA 3EXHB 5E0KB 4ZJUA 4URWR 4AJNA 3LQYA 4MRMA 3U4QB 4E33A 2CHFA 1U7UA 1F1BA 3UJ9A 3R9XA 2HIHA 2ZWVA 3QIVA 5CH8A 4DTCA 3D6HA 3VNVA 3PLNA 2C88A 2N75A 3L18A 1TF5A 4RPIA 3RUAA 1CQWA 1JXAA 4P5EA 3A2LA 1CRWG 3CLUC 3VKFA 3TD9A 3HZZA 2CHQA 5C81A 1F0NA 1XTSA 1XOIA 4E5YA 4DSTA 3JCZA 1T4DA 5F98A 4LNHA 1CQJA 3NC0C 3K2IA 5TPZA 3PDUA 8ABPA 2FKNA 2EATA 2IP2A 2Y68A 1N6OA 4BGIA 1T36B 2AI1A 3UJ8A 3UT0A 1FYVA 4TTTS 1S2NA 2DU8A 2JHCA 4C3OB 2LTAA 1L5YA 4B48A 4W5QA 2FN7A 1MLDA 2CEKA 1CPYA 2IUYA 2ZJ3A 2I65A 2YCBA 2Z5LA 4KO2S 5KQPA 5IAJA 2GXQA 4JI1B 4DUYB 1E62A 1LW7A 3LX4A 3EF3A 3QX3A 4PONA 4B3HA 5EP2A 4M2LA 4AD8A 4ISBA 4MW2A 3PHHA 1GGJA 4XIIA 2IH2A 2B8EA 4DG5A 4EHJA 5JD3A 4D98A 4EEZA 1TAQA 1TQDA 4HZUB 4AZ3B 3UMRA 4HX9A 4XDHA 4J2OA 1PL7A 4YV2A 3LIPA 4M6WA 2Y76A 3D3EA 4UZFA 2VYNA 4ERXA 1X13A 1MA3A 2DBZA 2VQEB 4HEHA 4TMVA 3V8QA 2AR0A 3SP1A 3D6NB 4M9ZA 1XCGB 4MW0A 4W9NC 4X7PA 4DMKA 5K01A 3MTDA 4KQWA 3W3AD 2O4CA 2WAMA 5JBQA 1IWPB 1D0VA 5JECA 1NE7A 2OBLA 5IDYA 3IO3A 3GUUA 4E2XA 5IJ0A 3N2YA 2NAFA 4ZOLF 2F6RA 2OILA 1A4UA 2B99A 5FUBA 1OZGA 1FQOA 3QITA 4OK3A 4J4HA 4MCHA 4RD1A 5IEBA 4LE2A 3VZDA 1BYUA 3KEFA 2LR0A 2XY4A 2WMOB 3ML1A 4HGPA 3ZZ1A 3U7HB 1Z75A 3BS4A 3EPRA 1GT91 1R1DA 1ZJ6A 2ZQ5A 3FBTA 2PJUA 1N4DA 3NM6B 4L02A 1O97C 4P83A 4W1SA 1IHXA 4V1CI 5JZ9A 4CQMD 5LWHA 3CONA 4DMFA 1SIOA 5DYNA 2ET6A 1ZW6A 5E3JA 2YZMA 4K9LA 1GSHA 1WNTA 4QHSA 4EA9A 5JEDA 5F5LA 4EGAA 2ZWOA 4JCCA 4A0QA 4XD2A 4BMNA 2NTYC 3OU6A 2EX1A 4LDQA 4P5PA 1I33A 1CFZA 1V16B 3K71B 2VTBB 3W5IA 1Y8ZA 2GARA 5BW5A 1ST3A 1ZJWA 3OPQA 1XELA 2QAJA 4HH4A 4HQ6A 4OL9A 5CB4F 5DRTA 3RE1A 1A27A 3GLGE 3K7EA 1H0HA 2O06A 4PLVA 5ES3A 3OOSA 5J23A 2AE1A 1FFDA 1OGJA 1W94A 1H5NA 3KYCB 4AZTA 1DKLA 1P9LA 4BNIA 2W83A 5EIOA 3Q4GA 2J5XA 1OPXA 1TOAA 2F59A 3MWLA 1NJFA 1WEHA 2WTBA 5C7YA 1UEJA 2C61A 4NHOA 3TGPA 1SUEA 2DVMA 5BRNA 3CGWA 1H1TA 1HNXB 4FMCF 3TQIA 3C2QA 5IAAA 1SOVA 4WDQA 1KHTA 3GROA 4X71A 4CKWB 4V1CB 2ZUSA 3H86A 1SCKA 2B1JA 3M3DA 3TQQA 3LZCA 1FS4A 3GMIA 3T35A 4AG6A 5KU7A 2DTEA 2WT9A 4ZVMA 1M9NA 1Q1QA 2JFPA 4H3VA 4UE3S 4BZPA 1S89A 3TLMA 2RI6A 5AHOA 3B53X 4Z4EA 1T0UA 4BNVA 2ZBRA 2FTKE 1CNFA 4CKWA 3MA0A 4HRYA 4P33A 2P90A 4NKRA 2QRHA 5ILQA 4Q19A 4KXYA 2HWKA 3IPLA 5LYJF 3A3OA 3H6GA 4J9UE 7GPBA 2BCJQ 2IHZA 1G7TA 3DXZA 3JQGA 4BNMA 1R74A 1XZLA 3O0DA 2Z2JA 2O9JA 2JAWA 3ADKA 3AR6A 4I1VA 2ETVA 3PRKE 3T4EA 3THXA 3ZBTA 1X1DA 2LP4Y 1YCFA 4RH0A 4E6PA 2F8MA 3NV7A 4LDZA 3EIUA 5TR9A 3DHEA 4FFSA 2BE9A 3TL3A 1RD4A 1FFXA 2ZGVA 1Q0ZA 3R5XA 4FVTA 3RDPA 1V0JA 6GPBA 2DWCA 2A8YA 3Q10A 3A6KA 2NU6B 4NFHA 3H3XA 3I5UA 3JQAB 5E95A 3CUYA 3SR4A 1FOEB 3PT9A 3REQA 3UHFA 2H5JA 4XFJA 2JIDA 1HZZA 4EUHA 1A72A 4FFBA 1LRKA 1ZR4A 2VVTA 2I29A 5ALIA 3TFQA 1L6RA 3V97A 4WXHA 2V3WA 3LCVB 3ENWA 3ZH9B 5HE8A 4IP0A 2GXSA 3M83A 3LC1O 2R8XA 2FOLA 5DYGA 3ZI4A 4QNNA 5A7GA 4B4WA 1DDIA 1JJBA 3QQPA 2BFEB 2PKWA 1E6LA 1UBUS 1VHWA 4EYOA 1B0UA 1RQ2A 1K6MA 3NVDA 3OOHA 4KUHA 1L7DA 3QH4A 1P1RA 4IDAA 1NI3A 3PHJA 1XMVA 4PS1A 1YS9A 1KDTA 4WERA 4U39A 3MMXA 5FFMA 5IT9A 1N77A 2AS0A 3QOYA 2GFHA 1WQ3A 4CNQA 2QN1A 5BSUA 3DTTA 2ZRAA 3QYJA 4H7EA 2BT4A 3A3NA 1XRLA 1MQ8B 4TLLB 2AD1A 2JJ1A 3QYAA 4A8JA 3GLGA 3HKBA 1R9NA 1EPUA 3W34A 3QPUA 4GP7A 3AKYA 4GWLA 4X44A 2ZI6A 4IIVA 4D81A 3PITA 4K9NA 1LTQA 4XRGA 3IA7A 1UWCA 3F73A 3FROA 4P0TA 3CEPB 3ECAA 3DFIA 3THRA 4UNRA 1Z2PX 2C4WA 1L8LA 4XCQA 4PN3A 1NQ5A 1JLMA 2CDNA 4HYYA 4EJSA 3KTAA 4TV8B 1MOSA 3DEHA 2A4MA 1VKRA 2O50A 4AY5A 2X2FA 1W6UA 1ADYA 3H5RA 4HS4A 3TJMA 4EUKA 2VJLA 1HYHA 2OFPA 1NSYA 4ND2A 2J1LA 1JE0A 3I04M 1QR2A 1PQPA 2ZQYA 4R1TA 3IX7A 4GEKA 1WY7A 1M10A 2GPWA 4GBMA 5H80A 2FG6C 4EX6A 1EG2A 4RHEA 3F0TA 4R01A 4OQ4A 2IODA 4X94A 3DL7A 2VJPA 1T24A 1E9AA 1XGKA 3WQSB 3UPTA 1EGHA 4Y1RA 3X1JA 2RONA 1A98A 3L0PA 4KQGA 4JL8A 5JWHA 8OHMA 2X9VA 4KRYA 1UPBA 3B78A 7YASA 1LPPA 2QTAA 5L95A 3H99A 1G5QA 3OTQA 1R4NA 3FR8A 1GGHA 2QROA 3CTPA 1QMPA 4DR3B 1CEYA 3AT1A 1N5DA 1COZA 3QG1A 4KGXA 3E48A 4I4NA 2F2TA 3EBPA 3NXKA 3RYCA 4LZLA 3E5HA 3ZI7A 4GX2A 2PLAA 3UH0A 1YS1X 2B5OA 5HKKA 3BKWA 3K9LA 3OCJA 1HMPA 1U9IC 4D8VA 3EWAA 3ZE1B 1RHUA 1NU6A 3B6KA 4O59O 1NSFA 1MNQA 2Q4RA 4E5NA 3QVLA 1HEUA 1ZL2A 2GAOA 1ZITA 4GPTA 2IYVA 4HQKA 4RAQA 2V1UA 4YONB 2ZAMA 5BQOA 3NEJA 3ZWWA 3ZWAA 3U1BA 4CIDA 1H6DA 2FX3A 4OQMA 3BZBA 4MRMB 2IDKA 3U4QA 2M6LA 1TMGE 2RJOA 2WUDA 1AD2A 4FJ0A 3EXHA 4ME6A 3HR8A 2QWXA 4G0PA 4G5XA 1R6AA 3JWHA 1FUKA 1OLUA 4LK3A 5D3MA 5H82A 3ECCA 3V7FA 4YRGA 2FPMA 1OFUA 3O2QB 1JMYA 1O95A 3IDSA 4JYAB 2FVXA 4NY1A 5JZVA 3JRNA 2UYHA 2VAMA 3T9DA 4AJHA 4DIFA 4TXHA 5CX1B 3QNUA 4MVXA 4UQOA 1DFHA 2PVPA 2P2ZA 4IY1A 4KQKA 4YNBA 4ER7A 1FU8A 5LZ5A 2LW7A 4AF8A 3D3JA 2P11A 4YQEA 2ICAA 3RSQA 4PC3A 2N3ZA 1WPQA 5JCXA 1PD0A 2G9UA 3PUKA 5HKKD 1A5BB 2HSEA 3OQ6A 4TKUA 5EMMA 1H2ZA 2NTJA 2BFMA 2V65A 3THWB 1Z63A 2BELA 4QJ4A 1E1RD 1WP9A 3A6LA 3FJYA 1JSXA 3LY7A 3W3AH 4EB0A 3ED5A 2NP7A 3F71A 3G0HA 2AG0A 2HO5A 3H9QA 1EM6A 4IVPA 2FR0A 3COZA 5ALJA 4OLAA 3Q2IA 4Q4JB 4MCJA 3C43A 2AMJA 4CG0A 1RYHA 5ALOA 5B1EA 4ZYTA 3D5EA 4LHWA 2W6MA 3GLHB 1RCFA 2QQ0A 3KK0A 4REQA 4EZEA 2POQX 3RVMA 3CF6R 2XTJA 3NUGA 2JI8A 4Y2UA 3BIJA 2B4QA 3VYRB 4M1TA 5F2KA 4ARSA 1WUJS 3ZWVA 4S0ZA 1GPDG 5K9ZA 2YXBA 4OHWA 2VF7A 1D0SA 1LDEA 2Q7OE 4K8RB 4L2IA 3RU2A 4DMCA 3OEEA 1XLVA 1S01A 2WJAA 4J0QA 3TDNA 5JS2A 2VHEA 4UAGA 2VSYA 5GONA 4L85A 2MOKA 5L3RA 4K88A 5DGXA 2GFIA 3ETJA 1QOZA 2GJ4A 4JI0B 1CW2B 1FRVA 1WZCA 2BI7A 3CG0A 2VTKA 2JKVA 2ZRHA 3UWSA 1R0BA 2WFLB 2C3OA 4CF3A 4AX4A 5FHQA 4GI5A 1QWOA 2GGSA 4HXFB 3CIOA 4HLQB 1U6KA 2A9FA 2C0CA 4UTZA 3SYMA 1S8OA 3PCTA 1DAKA 3UMMA 2QKYA 4LWZA 4D3FA 2EYUA 2LPMA 5AYVA 1Z15A 1B2LA 5D3ZA 1Q1EA 2XYGA 3IVGA 4YUVA 4RULA 4OCZA 1EH5A 1EFPB 4KPUB 5KDLA 3T6KA 1GTZA 3MSXA 3VNQA 3J7AC 3C14C 4HAVA 5IJZA 4PFKA 2Q2WA 1YA4A 4UVHA 3WLOA 5B7NA 1DG3A 3DO5A 5KX5A 3QEAZ 5JJ5A 1PX0A 3VOBA 1KTVA 3DYBA 1NMYA 4N03A 2RAFA 2F1JA 1JEOA 2L42A 2O7SA 2DE0X 4FZ3A 4M0KA 3TD6A 1YVEI 3GJRA 3H4VA 4JI2B 1QGYA 3NPAA 4M0CA 4BKRA 1PG0A 2OCBA 3I8OA 5BN3B 1OREA 4QXPA 4D56A 1Q0QA 4DLBA 1TIBA 3STYA 1U7PA 5B2FA 4BBPA 1U2TA 4FDAA 2ZI3A 2OCIA 3FCOA 4U5QA 5E6RB 3G9TA 2ZYVX 4L50A 3B20A 2ZRGA 1O5TA 4S1TA 2PYDA 3WQHA 4PAGA 7ABPA 3VZPA 4UQLA 2QRPA 4D0SA 3HEAA 2WNSA 3N1UA 2A58A 4I36A 2OLJA 3M34A 4N12A 4BYGA 4ER5A 2QBYB 1JP7A 4KJXA 2HX1A 4MVJA 3RANA 2G17A 5JATA 1ZN9A 4Z9XA 3ZQKA 2H1SA 5EKUA 3L02A 1CF2O 4FC7A 4XQGA 3EIEA 2WYUA 4FMDF 3UAWA 4DFDA 4JI7B 3DZIA 2OAP1 3A1VA 1VOTA 1MG0A 4K26A 5HGXA 1IONA 1IN5A 5I9SA 5FLXA 1UWKA 2QLNA 1VDZA 4GGOA 4Z0NA 3BZWA 3BTOA 5DBEX 4ZREA 4ZEOA 1M2JA 3L8ZA 4ZCPA 3YASA 1V5GA 1YOVB 1R8XA 2EEZA 2JCBA 4A0FA 1ORRA 3CX6A 5DI3A 4ZK2A 2GETA 4IIBA 1QE0A 1YDWA 1E3JA 1R0KA 3EN0A 4GH5A 1PL0A 1G8GA 4MV7A 3UCEA 4GL2A 1A96A 2GHTA 3QUSA 3TI9A 4KYUA 3MNFA 3K9QO 4EB6B 3VX3A 5CFZA 5LSAA 1GM5A 1IEVA 2Q5EA 3PC8A 4V2IA 3ZWKA 5B30A 3L8GA 3CRZA 1FFCA 2QD4A 4F4JA 2Y2VA 1ONBA 3D6AA 2B35A 4KV9A 4OHFA 1PV2A 5CB4A 2QMHA 1TM1E 2WJZB 3KC2A 5A5GA 4CLOA 1P77A 2QSYA 4Q3DA 1MRZA 1SO8A 1Y82A 4RNCA 1O54A 4TQGA 4V0MA 3WSVA 4CNBA 1GKUB 1Q0RA 1A4RA 1ZOSA 2WP0A 4FE3A 2HMUA 4UD2A 5GJWC 2COKA 3HUTA 4Z9BA 5LQKA 1PEYA 4I19A 5ALLA 3D31A 1KJYA 2GF0A 3DP9A 4MVJG 3B7PA 4XM1A 3R7AA 3M5PA 1J4AA 3VHQA 3W5HA 4C06A 4MHOA 1GZ4A 3T95A 1MCZA 3LIIA 3R76A 2V6MA 3G9UA 3QE4A 1KP9A 1I6LA 2L69A 2QG4A 4LMBA 4MVJD 4BO4A 4UUNA 5BUQA 5KVCA 1G8AA 4FEGA 4P58A 2BGWA 1W52X 2QAGA 3OOJA 4XR9A 3UMJA 4C0HA 1M2HA 4DREA 2BGGA 2VHYA 1GWNA 1STOA 4BO3A 4Q9NA 3EGXB 2NO0A 1XZIA 2QF7A 3D8RA 3EPPA 5JPCA 2G08A 3L7AA 4CHGA 1SVSA 5CDTA 2Q0XA 2J0VA 5JG7A 1NNI1 2YJZA 1W36B 1BW9A 4B7XA 1L7AA 1T3SA 1JI3A 2QMZA 2ZS8A 2CVPA 3ICPA 3JAKA 1SQ6A 3BJRA 2A5YB 4RY2A 4ENUA 2VFAA 3SVLA 4WOCA 5JH7B 1UF9A 1CUEA 4F2HA 3G0GA 5HBRA 1XMIA 3HKBB 4HXYA 5CYPA 4EUNA 4EB6A 4DANA 3SHOA 5IHXA 4TZKA 4FP9A 3GEMA 3VI3B 4I6EA 1PDOA 1W76A 3P4XA 5HTKA 1GFWA 1AG9A 4HLUC 5K3CA 1ODFA 1SWWA 2Q21A 5CLQA 5G0SA 4EELA 1DX9A 1R15A 3NR2A 3O4HA 1UBEA 3E9MA 1NT4A 3KKQA 3TQRA 3ZLBA 1YAHA 1GUFA 3O8DA 5G2OA 5T8KC 2QTVB 4C1NA 3P9NA 1X3LA 1N57A 2MSDB 3VX4A 2JVJA 2W43A 3NHWA 1N6IA 4C0WA 2NVUB 5FO0A 5KVAA 1TLTA 2FK7A 2FNAA 4M7WA 3Q0TA 4B43A 4XOIA 5DNCA 3RS3A 1BDHA 2ZSAA 2G5CA 3FF4A 4NFSA 4YBZA 3WI7A 5TVGA 3FX2A 4JI4B 1LD3A 3N2IA 4JT9A 1IPFA 3H2IA 1H2FA 4LA4A 5IM5A 1QHIA 1QGDA 1BC5A 1XR3A 3M33A 3DMYA 3L4SO 1CQIA 1K2WA 3JQRA 3AESA 4JUDX 1UKYA 4KI0A 4NZZA 4RKFA 1CUAA 1DMSA 2R4UA 1L4KA 2YJ6A 4LDRA 3TOVA 3UAXA 3OZRA 4GZ3A 4EYSA 2G36A 3M4YA 1UFVA 3OF5A 4CR6A 4CIAA 1A1VA 5AIBA 3ER8A 4WGFA 5KPJA 2DT5A 4Y6SA 2V7EA 5F9FA 4BCCA 2H5IA 2I2XB 3MTAA 2NP6A 4UMVA 3FSJX 2AZDA 1N2IA 3HJAA 4NRDA 3HYLA 3WK8A 1R3UA 2HZ7A 4GBGA 4R8LA 1XZFA 3G0CA 1JI0A 4ITVA 3JY6A 4MRNA 1OVMA 3FVTA 4TTJA 2C1XA 1HNNA 1H66A 3KWFA 3NAZA 4OQZA 2O7QA 2Q4DA 2QIPA 1D07A 2OG1A 4QLBA 1U3FA 2E5LB 2MDTA 1ZINA 1I6MA 1AUVA 3LDUA 3UTDA 4AYWA 3GJTA 5KOJB 1Z62A 4RE5A 2D1TA 5EE0A 2JD0A 3AHJA 4LEIA 3DC2A 1Z8NA 1KJIA 2C5AA 4NFYA 2JFNA 4BEWA 4ZMBA 5ETJA 3TIFA 3HNRA 1EWQA 2P3QA 4F4IA 3VSDA 3G2LA 2ST1A 1VIMA 3VSAA 4NJEB 2G72A 5J5CA 3KYIB 1N3LA 3KJHA 4OLFA 5AM1A 4QUBA 3WB0A 1TM2A 3KXIA 1KEVA 2HMAA 4D74A 4F1WA 3KZXA 1IBLB 4ZYXA 2O54A 5AO9A 4HAOA 4C4YA 1H3FA 3T5MA 4ZZIA 3GLFB 2XOKA 2E5WA 2XHEA 4AL4A 1JB9A 1H05A 3N07A 2COEA 3OLVA 4KQXA 4YRRA 1EFDN 4IX9A 2FW1A 1ABEA 2X19A 3K96A 4NYMR 4EG7A 1NASA 4AQYB 1SD1A 4MQ4A 1HQCA 3QFRA 1AUOA 2F90A 4IHQA 1LB1B 1EBBA 1N0UA 1YD7A 4RUKA 3SEQA 4F7WA 4N0QA