2VTVA

Phaz7 depolymerase from paucimonas lemoignei
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
340
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHB depolymerase PhaZ7
publication title Structural basis of poly(3-hydroxybutyrate) hydrolysis by PhaZ7 depolymerase from Paucimonas lemoignei.
pubmed doi rcsb
molecule tags Hydrolase
total genus 126
structure length 340
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vtvA00
2HADA 2BAGA 3RK4A 3WQHA 1AUOA 1DX6A 1HKHA 3WWOA 5DLPA 3SK0A 3QZUA 2DFPA 1QIJA 3PUIA 2PSDA 3PI6A 5KWJA 2AJCA 1BRTA 3R41A 3L1JA 5C7YA 5AI5A 4OPMA 5DNVA 1EI9A 5AKJA 3RLIA 3A2MA 3LP5A 2BUBA 3O9VA 1R9NA 3QPCA 1VXOA 2ZVDA 4FKBA 2H7XA 4DTCA 2DQYA 3NWOA 3BF7A 3VKFA 3M3DA 4G4IA 3FBWA 1W6RA 3W06A 3PFCA 2WIJA 1JJBA 4X6YA 5SYMA 2VT7A 5JATA 4DMCA 2PUHA 2XUGA 3C87A 4W1PA 2ZSIA 1CQZA 1MT3A 3JYHA 4QLAA 5LZ4A 5T4HA 4Q82A 4BAUA 2RONA 1MAAA 3U1TA 4AO7A 2XLBA 1LPBB 3S8YA 4BAZA 1VA4A 2WUEA 5EHQA 5JD6A 3DL4A 4X94A 3L1HA 3G0DA 1CUSA 4AMYA 1ACLA 3I2HA 2QOEA 1HDEA 5LZ8A 2WG2A 3K2IA 5ALLA 4DM7A 1CUIA 4G8BA 1EVEA 3WWPA 5AOCA 3CXUA 3QMWA 2DSNA 1ZIXA 2WFLB 1PV1A 4BVKA 5DNWA 3NGMA 1XQWA 4U2EA 1BCSA 1MX1A 3I28A 1CLEA 1G5FA 2B61A 3ICWA 1XRQA 3WYDA 4UHFA 3I2KA 2HU5A 1G4HA 4EY8A 5C8ZA 2XUAA 1RWQA 3D7RA 3E4DA 4C6HA 3BJMA 2QVBA 4GLBA 2WIGA 3IULA 2HDWA 4OYLA 5AM4A 1CUFA 4QA9A 2Y2VA 3HEAA 2OAEA 4UFPA 2Z3ZA 3BIWA 4XX1A 5CTAA 4BVJA 1BS9A 4BE4A 3ZI7A 1ORWA 3R3YA 1EXWA 1P0QA 4J0IA 1AX9A 3A2NA 4RPCA 4B6GA 1E89A 4CG3A 4O08A 4W9RA 4UHEA 4BRZA 2XUJA 1ETHA 1O6GA 3DYIA 2WIFA 1R1DA 5EI5A 3RKSA 1FFCA 1EX9A 3FYTA 4F0JA 1SOMA 4ARBA 3DS8A 2WG1A 5AKGA 4KACA 4FLEA 2ORYA 1UK9A 3I1IA 3IUNA 3N0TA 5KWIA 4X6UA 4V2IA 2BGNA 1IVYA 3I6ZA 2XQJA 4N5IX 5AI9A 3G0BA 2PBLA 1QIFA 2DHDA 5I8PA 2XUQA 3HABA 1A8QA 3H2KA 4GI1A 4UBLA 4LYEA 3C45A 2VEOA 3VJMA 1LPNA 2OQIA 2DHCA 4H7DA 2ROQA 3H1AA 3VISA 1MAHA 2WHPA 2ZYRA 4Y2JA 3OURA 4H35A 4GBGA 4J0CA 1YB7A 4H7FA 3WIBA 1OXMA 1E3QA 3G0CA 1Q0RA 1AC5A 2FJ0A 1UK8A 1QONA 3G9ZA 1WCYA 4Y2RA 1USWA 3DDUA 5IVHA 4X95A 4BCDA 2YASA 1J06A 3W05A 3NUZA 1EVQA 4RE6A 4L3WA 1GKKA 1W75A 3EBLA 2XMSA 5AKIA 5AI4A 2CMFA 4X6XA 2I3ZA 2CEKA 1Y37A 3GELA 3SX4A 1QIIA 1WHTA 4KE7A 2FJPA 1BCRA 4B85A 1A7UA 1ODSA 5FP0A 2CUTA 2JGFA 4GEGA 4KE9A 4E14A 3H0CA 3KSRA 4K6GA 2OQVA 3I2FA 4AZ0A 1XLWA 1UK6A 2XQKA 1QIGA 5AKHA 4C89A 1JU4A 3FVRA 2PL5A 1UWCA 3PF8A 5K3FB 5JAOA 1FFAA 4HZGA 1N5RA 1EHYA 1NU6A 1XLUA 2C0PA 3FNBA 1AZWA 2HA3A 3KXPA 2OCIA 1SFRA 3B5EA 5EGNA 3GFFA 1QIMA 1MNQA 3SC2A 3H2GA 1SCQA 1WB5A 2C5FA 4Y2SA 3ZLTA 3DEAA 3C5WP 4QDXA 3IIIA 4GW3A 5HQ3B 1JMKC 3OTQA 2HFKA 1C7JA 1KU0A 1D07A 4FBLA 3RM3A 3MUOA 3F96A 5ALMA 3W9UA 5AM0A 4ZWNA 5E4YA 1YAJA 1BEEA 3E0XA 1HQDA 1G66A 1LPSA 3WKEA 4BRSA 2J3QA 1FFBA 1DQZA 3FAKA 1VE6A 1E8MA 5CH5A 4J0DA 4JUIA 4UFOA 3WK7A 4E46A 4FHZA 1BN6A 4Y2XA 1Z68A 1XFDA 4FFWA 2LIPA 1CIJA 1HPLA 1QTIA 5JALA 1VXRA 1H2WA 1Q84A 4G4GA 4W1SA 1CUXA 1CR6A 4N8SA 2JGJA 1XQYA 4WJLA 5EHZA 1WB4A 1DWPA 1XRNA 2OG1A 2WM2A 1K8QA 1YS1X 2JGIA 3CN9A 3BWXA 3F8SA 2XMQA 3HRHA 5HK9A 3N2ZB 4QEKA 2WJ6A 1G42A 4DMHA 3ANTA 4M0FA 3AINA 4HS9A 4MYSA 3D3NA 2G63A 4MEAA 1CPYA 3OOSA 1GPLA 5BOVA 1TCAA 5JASA 5I9IA 4AX4A 4AXBA 3ZPXA 3WK6A 3STVA 1QOZA 1PJAA 2WJ4A 3C8HA 3CN7A 3WWDA 4CG1A 5ALXA 1L7AA 2X8BA 5ALKA 2EDCA 4AZ3A 3D2CA 4MJ3A 4UFNA 2CJPA 1A8SA 3DCNA 4M0MA 1EK2A 1JI3A 1H2ZA 2WTNA 5KBYA 3O4GA 4FLMA 2BUCA 2VSQA 2H1IA 2XI4A 3BDVA 4GECA 4LIPD 1JJIA 3JWEA 1A88A 2Z5GA 2HU8A 3I2IA 2DR0A 1ZI6A 5HF9A 4X97A 3PE6A 3G7NA 5AJHA 5AO9A 4RE5A 1R88A 4X92A 4FWBA 5AI6A 4JYPA 5HFNA 4EY7A 2QJRA 5AKXA 4P93A 5EIEA 5JIBA 3ZV7A 2WSLA 1R4ZA 2WU4A 2XQGA 4BAGA 1AQLA 1IZ7A 1ZD5A 1ORVA 4LXIA 4UHHA 3EQ9A 2O7RA 5AOAA 5ALDA 1CRLA 3DNMA 5HK8A 3IA2A 3QPAA 4JH0A 4BYMA 5AK4A 3AJAA 4L72A 4AO6A 1WPRA 2W22A 3HJUA 2B4KA 4X7BA 1H2XA 2G5PA 3VXKA 2HIHA 2QXUA 1K6EA 2HA4A 2XUHA 3STXA 3YASA 1XZGA 1UK7A 4LXHA 3WWEA 2OGZA 3C6BA 3WK4A 5CW2A 1GXSA 1ODCA 3OC0A 3D0KA 4J0KA 4H7KA 4A5SA 4G8DA 2YYSA 4ZGBA 1JJFA 2EDAA 2WHPB 4DGQA 4FNMA 1F0NA 4DSAA 5AKKA 5FDFA 1UOPA 1GT6A 3WJ1A 1VKHA 1F0PA 2V98A 1W76A 4F21A 1JT2A 2QTBA 1IUNA 3VDXA 4K2AA 2VJDA 4YASA 3H1BA 1JU3A 4AB1A 1X70A 1E66A 4IQ4A 2C4HA 1CUBA 2VJCA 5JD4A 5CBKA 2B9VA 5K3EA 1DWQA 4KAFA 2PKYX 4QDTA 5DTIA 2HA5A 1P0IA 4X91A 5K3DA 2HA7A 4HRXA 3VVMA 4P92A 3I6MA 4K6HA 4Q3KA 3B12A 4QDZA 1XRLA 4Y2VA 4WFKA 4KJXA 1XZBA 2ZSHA 4BZZA 2AXEA 3LS2A 2BUAA 4LKOA 1KEZA 4H7EA 2OPHA 4GDMA 2GBIA 5A7HA 2HFJA 5FV4A 3R3UA 1H22A 1XKLA 2O2HA 1A8UA 4DIUA 4Q34A 1WB6A 1XZCA 1HBJA 1MX9A 5CT5A 1THTA 4EY5A 3PF9A 3PDCA 3OM8A 1CEXA 2K2QB 4P08A 1PFQA 5AM1A 5HCUA 5AM3A 5FOQA 5ALEA 4Y9SA 3GZJA 6YASA 2QJWA 4Y2TA 5A7FA 5HF8A 3TEJA 1QFMA 3V48A 3QPDA 4G9EA 4EUSA 2QR5A 4H7IA 3WI7A 1Q83A 1VZ3A 1VJ5A 5D3ZA 4OCZA 3R40A 1EINA 2EEPA 3WL8A 4H18A 4XWGA 2WTMA 3QMVA 2AJ8A 4KEAA 1LPMA 3O9MA 3WL7A 5AKLA 4JEIA 4CIBA 4NVRA 2J4FA 4N8EA 3AILA 3AIMA 4BZWA 4EY4A 5LKRA 2O7VA 4MQMA 3H19A 4WCVA 1QJ4A 3R0VA 3BE8A 3WA6A 1FSSA 2PSHA 1DWOA 3G0GA 2XMRA 5DYTA 1CUEA 3EQ8A 4QDUA 5BWBA 3ESBA 1LZLA 2XB6A 3R3XA 4MWSA 2X5XA 2P8SA 4BC1A 4X71A 5IKXA 5EFZA 3AUKA 1WPXA 2Y6VA 5JAUA 4B0OA 2R11A 2OGSA 2VF2A 5T4BA 5CT4A 5FXMA 3WZLA 5HF5A 2R8BA 2VQ6A 3H2JA 5HQ3A 3OPMA 2XUIA 1XZKA 5LKAA 2GYVA 4FMPA 5FUMA 1CUWA 3DQZA 4BDSA 3DYVA 3UUFA 2H9YA 4G1FA 3LIIA 5ALNA 3LCRA 2NW6A 5ALUA 3KWFA 2PSJA 4I3FA 4QDOA 3WKBA 5AIAA 1ZGCA 2VJAA 1OCEA 2JEYA 4Y2QA 4U2DA 5K3FA 3UMJA 5ALHA 5AOBA 5EHNA 5ALFA 3WLAA 1YCDA 3FLBA 3O4JA 1MO2A 2GZSA 3FWHA 5EHXA 4PO3X 4OYYA 5AM5A 1WM1A 4UBJA 4KE8A 4IH1A 3VJKA 5ALWA 4Y2YA 2RHWA 4B0PA 1XKTA 4CIAA 4PW0A 1E8NA 4DNPA 1XZJA 4ETWA 4OUKX 5D3KA 2Z3WA 3G9UA 5HZGA 2WKWA 1EB9A 4ZREA 5DWDA 5LLSA 1DT3A 3FYUB 4UHBA 3O0DA 3KOOA 1CUVA 1R50A 1BE0A 2ZJ6A 5ALVA 1W52X 2VTVA 2D0DA 1L7RA 2VJBA 3PICA 1RP1A 4C4YA 1Y7HA 3M82A 1ZD2P 3WKDA 5LP1A 5F4ZA 4U2BA 1UKBA 1YB6A 5CXUA 4KYVA 3G9XA 2WHRA 2OCLA 3IBTA 1SCIA 4KRYA 4C01A 4D9JA 2PU7A 1IMJA 1ODTC 2WILA 1OILA 1CUAA 1ZICA 2DCMA 3C8DA 1FFEA 1LPOA 2GBFA 4EHBA 2QXTA 4GHWA 4X00A 1CUUA 1SCKA 4GWLA 2XMDA 3F97A 2ES4A 2ZJFA 2BFNA 1LGYA 5ALZA 4INZA 4B9AA 1DQYA 3C6YA 3ILSA 5JADA 1QE3A 5HKBA 3FLEA 1QFSA 2XT0A 5IVKA 4UBMA 3DKKA 5BWCA 1VLQA 2CKMA 5LZ7A 5K3AA 3WA7A 4UBKA 5BV7A 2WIKA 4RNCA 4CG2A 4ARAA 4ROTA 4EY6A 2VATA 5FRDA 5ALQA 3K6KA 4AN1A 4BVLA 2HA6A 2J3DA 4LYDA 3KDAA 4QZVA 1U65A 4OB7A 2RHTA 3C5VA 3STWA 1VOTA 3HLKA 3WKCA 4Q3OA 1TKRA 4GXNA 1U2EA 2WG0A 2DQZA 2C7BA 3W2TA 4XIIA 4PF1A 4DYHA 1DTEA 1LNSA 4B9EA 4FNGA 3QYJA 1TCBA 3C43A 4A23A 3ICVA 2BGRA 1CV2A 2H7YA 2Z8XA 3HXKA 4QWWA 4E11A 2QS9A 2HL6A 1THGA 3HSSA 1B41A 2RGUA 3Q8WA 1C4XA 1ZD3A 1TCCA 2GBCA 3F67A 3HYSA 3UUEA 5JARA 4RGYA 2QUAA 3G9TA 2E3JA 2V97A 3O4HA 5AKZA 4CI9A 2ACKA 2AJLI 2ONCA 3MUNA 5ALJA 3WYNA 1T4MA 1ZGBA 3I6YA 1QGED 2CZQA 1QTRA 3BDIA 2WJ3A 1SC9A 4MYDA 3GBSA 1NU8A 4Q1VA 2XMBA 5LZ9A 3HACA 4U2CA 4G5XA 4Q3LA 4XVCA 2Q0XA 2RIPA 3JW8A 3DD5A 4ZXFA 2I03A 2PUJA 1F8UA 1WOMA 1MJ5A 4J3JA 3O4IA 5AI0A 1E5TA 4IH4A 4U2GA 1YSCA 3A2LA 3PFBA 3BF8A 2QT9A 3GROA 2UZ0A 1MN6A 3L1IA 4KR0A 4W1QA 2VA9A 3E1GA 4HXGA 4MQLA 1DT5A 4WFIA 3P2MA 4DMKA 2V96A 2FX5A 4KAJA 2PM8A 3R3ZA 1BU8A 1TQHA 4FFVA 2AJDA 4DNFA 4OU5A 3CCCA 2BJHA 1NX9A 1UT6A 4C4XA 5FLKA 2HA0A 4IH9A 1Q0ZA 5K3CA 3STYA 3QMMA 4LHEA 4BATA 4BP9A 3Q0TA 1J2EA 3WIOA 3FLAA 2JBWA 1GZ7A 3AFIA 3K9BA 1GGVA 1EDEA 3WJ2A 3WZMA 2X76A 4S0XA 2WQZA 4CCYB 3ZLUA 2QKYA 2VAXA 3FOBA 1VA5A 5FKJA 4TGLA 4U2FA 5A62A 1C7IA 4B82A 4UBOA 5CRIA 2ECFA 1JMYA 3FVTA 2JIDA 3U0VA 1EDDA 2XQIA 5I7UA 4J0GA 5C8VA 1DU4A 4H7JA 4DSZA 3G8YA 3OG9A 4OD0A 1P0PA 1IZ8A 4YK7A 3W04A 5JZSA 3BJRA 2XMZA 1LLFA 2I78A 1J1IA 2OXEA 1IUPA 4IO0A 3HZOA 5ISMA 1CUGA 5JAHA 2XUDA 1CUCA 4B83A 4EA6A 3ZWQA 4X85A 4AN0A 4UBNA 3ESAA 1E8DA 3WK8A 4IHAA 3TJMA 3ESCA 3VVLA 3V1LA 2PPLA 1N5MA 4JNCA 4CCWA 5ALPA 2PU5A 3VJLA 1LPPA 4BP8A 3GUUA 1S8OA 4FBMA 1YA8A 2ZYIA 1LPAB 1YR2A 4CCYA 3IVMA 1XQVA 2I3DA 3BL8A 4ZV7A 5JZ9A 5CMLA 5IVDA 1VE7A 2QRUA 5CT9A 1FFDA 3DOHA 3IURA 4B84A 2JEZA 1ZI8A 4KE6A 1MNAA 5AK6A 1KU6A 5JANA 2YXPX 5DNUA 1QIDA 4BCBA 4NS4A 1XZMA 1XRPA 5D7BA 5J3JA 4FLFA 1RYYA 5SYNA 2OCKA 5AM2A 3DLTA 3TGLA 2H7CA 1UFOA 2WFLA 2WU3A 3DKRA 3HI4A 2PSEA 1J07A 1GQRA 5JAPA 2RAUA 5ALGA 5AHXA 1JKMA 4B81A 2XQFA 4L0CA 2HA2A 2ZYSA 1W4LA 1XZAA 2O2IA 4PSUA 4CFSA 3H2HA 3SWWA 3STUA 5IVIA 1QZ3A 2Y2UA 4ZV9A 1XZFA 2OCGA 1MU0A 3WMRA 1QO9A 3E3AA 1EDBA 5CXXA 4BCCA 3WL6A 2ZYHA 3HC7A 3G0IA 4J0JA 4PQEA 2XDWA 3FCXA 5A71A 4KAAA 2IITA 2C5GA 5E2IA 5LIPA 3H17A 3AZPA 1JFRA 3R3VA 4PSDA 2JGEA 5HF6A 3WK9A 4BDTA 4DLNA 4I19A 5AKEA 2G5TA 1F6WA 1QLWA 4EZIA 1XZLA 4OSEA 5AI8A 5D6OA 1GPNA 2AJBA 4BE9A 5KREA 5CH8A 3O95A 3B3QA 3MGAA 2HM7A 2G4LA 5DTJA 4NZZA 5K3BA 5AIBA 2GBGA 4OB8A 1R3DA 1X2BA 2IX9A 3MVEA 3WL5A 1N1MA 1BN7A 1U4NA 1XZHA 4Z49A 5AH0A 4EBBA 1QIHA 2CBGA 5LYYA 5JD5A 2WFZA 4FTWA 1VZ2A 5E4TA 2ACEA 4G4JA 1FJ2A 4WFJA 3WKAA 3ZLVA 5AK3A 1AMNA 2VAVA 5T4EA 2RI6A 1BROA 4B7ZA 3DL7A 4PNZA 5YASA 1UXOA 2Z8ZA 1TK3A 3AZQA 1H23A 3W9BA 5A2GA 4G8CA 5CT6A 4W1RA 4HVTA 4PSCA 3ED1A 5ALSA 4MXDA 2PVSA 2WIDA 3BXPA 1EB8A 4F60A 3D59A 3RARA 1MPXA 1I6WA 4W63A 2J4CA 1UOOA 2QZPA 3STTA 2XUFA 3IUMA 2XE4A 3V9AA 1Y7IA 3ANSA 1WHSA 1ACJA 1K5PA 2HRQA 3AIKA 1UKAA 4FDMA 4YPVA 3H18A 3V1KA 1ZI9A 4N8DA 1DINA 4K6KA 5E4JA 5ESRA 1UZAA 1MTZA 3GA7A 5A6VA 4H77A 5IH7A 2GYUA 1QIEA 1CFJA 2WFMA 4QNNA 4B80A 4HXFB 5ALTA 1DX4A 4G9GA 3WWCA 5FPQA 4N5HX 4HTAA 2OAGA 5JZBA 5CH3A 3KWJA 3IDAA 5ALRA 4UPDA 4J03A 1ZD4A 1GQSA 4C4ZA 1CUZA 1U8EA 1T2NA 3T52A 4J0HA 1CUYA 1QO7A 2W6CX 2OLEA 2JGKA 2O2GA 1W1IA 2B20A 1H2YA 4H0CA 3DOIA 3TRDA 4BTLA 3C6XA 1XLVA 2GZRA 2IIVA 1AGYA 1ZJ5A 4BC0A 2Y1KA 2Y6UA 1K63A 2FUKA 3ESDA 1M33A 4YX9A 1XZIA 4C87A 5LZ5A 4E15A 1UOQA 1XZDA 2XUPA 1EK1A 4TPKA 4BB0A 1TRHA 2DHEA 4X93A 5AICA 1HLGA 4DNOA 5AP9A 1HL7A 1CVLA 4QLOA 3R3WA 3V1NA 3T4UA 3A70A 5JYCA 3EQ7A 2HHAA 5AK5A 1UKCA 1O6FA 1TAHA 3CCBA 3LIPA 4HRYA 3FYUC 3QH4A 4L9AA 3FSGD 4XJVA 4WDQA 4WY8A 3EIOA 5CT8A 3D2AA 1GKLA 2QM0A 1YAHA 3H04A 3A6ZA 5DJ5A 3IUJA 4HXEB 3BIXA 4I4CA 5C81A 1X2EA 2OGTA 4DNQA 3I1YA 4ITVA 5AKYA 4UHCA 1EA5A 1EH5A 1YASA 1QIKA 3AIOA 4FOLA 3M81A 1ISPA 2JGLA 3DJYA 3S2ZA 1XRRA 1R9MA 4DMFA 4Y2UA 3D2BA 3C6ZA 4NMWA 5H3HA 5T4FA 1XRMA 1CUHA 2JGMA 2BCEA 3AZOA 1BEZA 4QE3A 4Y2PA 1ZOIA 1XROA 4JYMA 2C0QA 5DYYA 3NOXA 4WY5A 2XMGA 5CURA 4TVKA 4F5ZA 2WUFA 3QVMA 1N8SA 3M83A 4QWMA 1ZJ4A 5EIAA 4EB0A 5HFAA 1P0MA 5ALIA 3QM1A 4ZI5A 2WUDA 4C88A 2C58A 2CB9A 4HAIA 4OU4A 4KRXA 5K5EA 1K4YA 1ZIYA 2BKLA 3D5EA 3I2JA 4WDRA 1LBTA 1XZEA 1L7QA 1CUDA 1LZKA 4MEBA 3WK5A 1TIBA 1CQWA 3I2GA 2XUKA 2HRRA 4AMZA 1IUOA 2XLCA 4PV7A 2ZJ7A 5LZ2A 2PSFA 3FCYA 2HU7A 4MWTA 4OB6A 5EIHA 1YA4A 2WHQA 1CUJA 2VT6A 5HKAA 4BTVA 2WLSA 3QITA 4P9NA 1AURA 3G02A 2XUOA 2XMCA 4K5QA 1MX5A 4AQDA 3V1MA 3H2IA 5C8XA 1GPKA 4Y7DA 1B6GA 3QBJA 5A7GA 4Q05A 4X90A 5FPPA 2QUBA 2PX6A 4UHDA 2V9ZA 4UUQA 3C70A 1YS2X 3X3HA 3PUHA 2JF0A 4H7HA 5ALOA 4UBIA 5ALYA 4X3CA 1LBSA 3LLCA 3KD2A 2WUGA 3FYUA 4ZRDA 4M0EA 3F98A 4AO8A 2QMQA 3IUQA 2YH2A 3EF3A 3D4LA 2D5LA 4A16A 4LXGA 2GYWA 7YASA 5DYWA 4J7AA 1AKNA 4BBZA 1XQXA 3FSGA 3IB3A 3F9CA
chains in the Genus database with same CATH superfamily
3JQ7B 1T1JA 2DSTA 2ZB3A 3C8UA 2C99A 3GA0A 3ND9A 1XDBA 1FVHA 2Y92A 4HX9A 1QX3A 4GM0A 3WRVA 1DX6A 4KQ1A 3G8DA 2C5EA 3AR9A 5LDGA 5KNBD 2ZYVX 1OWOA 1QQBA 3SK0A 1ULBA 4HO1X 3ICOA 2VWGA 1NRIA 1OFTA 4M54A 1CZNA 2QEQA 3B13B 1PSWA 1P29A 2HD4A 2ZB4A 3BE6A 2OT3B 1YBHA 4LXUA 4N0EA 5DMHA 1NJ5A 2I22A 2AJCA 2WVAA 3D6HA 4BNWA 1O58A 1ZFNA 3T38A 5BVHA 1IMOA 4PZ0A 4KPEC 3ZY4A 2Z9CA 2REQA 1E1YA 3FUVA 4J76A 5ANRB 5E3HA 2H5EA 3L1JA 1N92A 1OE0A 2I6FA 1R2QA 3BCHA 4J4TA 2ZRKA 4RD4A 3TL3A 3WGGA 5J2TF 4HNHA 3KEGA 2IE0A 2PV7A 4DPKA 3A2MA 3KDSE 4DUPA 4UMDA 3GP5A 4IL5A 4Q3CA 2BUBA 4IWXA 3OTGA 3ZJ4A 2L2QA 2X0FA 4JSYA 3TZQA 3LPMA 4BNJA 2DTEA 4D3DA 5ARCA 4RQTA 2H7XA 1NVVQ 2QA5A 4RO0A 4IHQA 5JXJA 4DTCA 3LBAA 1SA0A 5DXAA 4K6FA 3SHOA 3NWOA 1U6KA 4INAA 1TYZA 3NAZA 2HQ1A 4L9WA 2DWOA 3CC8A 3TPFA 3K9HA 3NT4A 2YHBA 3HZHA 3VKFA 3GY0A 1A9SA 4PZCA 1I5RA 1U1GA 3PUJA 3GUHA 3NIDB 1JRLA 4B8ZA 3DFMA 1H2AS 1U7PA 1ZJJA 2VNSA 3L8CA 4OJNA 1AZLA 1GTMA 3GIDA 4PU0A 2P9HA 1G8JA 3KEQA 1HF3A 4QRHA 1ONOA 5IT4A 1GAEO 2NM0A 5KSPA 2FUNB 4CVNA 3EVFA 2ZZMA 1D1QA 1KDTA 3OLVA 1KJZA 1SHZA 1JJBA 3HDQA 3K4HA 4FFDA 2O8VA 1X7GA 3G2IA 2YWBA 4E6PA 2D2VA 1MIHA 2VG8A 2J9FB 2I6QA 4A0RA 4NMXB 4IRXA 4BKRA 1Q7TA 2QUZA 2ZVQX 3BE4A 3CZRA 3E22A 4TS3A 4YCMA 3ZTTA 4QIHA 2QQ0A 5F21A 2I54A 2YIJA 1IQPA 3A05A 3FKSD 4YA6A 1MG0A 2W2QA 4BHTA 2I67A 4QQRA 1ZGZA 1BW9A 1QHXA 1ZX1A 3IRUA 4FZRA 4YMIA 4DDHA 3NAMA 1YJ8A 5CYPA 3GH3A 2PL1A 3C87A 1VSQA 1D2GA 4QOFA 3JYHA 4R01A 3DLPX 1I7NA 3EPLA 5LZ4A 3H1FA 3LE8A 5HMMA 2P9GA 2ETXA 1WUJS 1MAAA 2IY9A 3I9FA 3NVAA 2OB1A 3S8YA 2XVXA 3LQ2A 5C80A 1P6XA 1P5RA 2CVPA 3FAZA 1H9BA 3QHAA 4NMMA 1ZCZA 3CV3A 4UHKA 4WUVA 4ZODA 4KLZA 4TLLB 1PKXA 2R96A 3L1HA 3RK0A 1R5BA 5G1OA 3MXOA 1JS1X 1DS6A 1GNLA 2DX7A 1I1HA 1KI4A 3UJ9A 3AB7A 3DTTA 3I23A 3DDHA 3B85A 1QR2A 5DSTA 4PNEA 4XASA 3PA8A 3UHFA 1ACLA 2EWVA 3OLWA 4LWOA 3RUIA 5TQ0A 5CA1B 4MW1A 3KZVA 1HDEA 3I53A 4C76A 2ZI4A 4TV8A 4GLOA 2IT1A 4KGXA 5U4QA 3HMQA 3V7UA 5ALLA 1HDCA 3AFNA 2B4RO 1ID8A 1NUAA 3FPLA 1PTJA 3L92A 4G8BA 4B7XA 1QAMA 2OHGA 3CXUA 5IANA 1Y8RA 1XZPA 1DIAA 3GN2A 3ONDA 1Q0SA 1ESDA 2W11A 5F2OA 1ULSA 4ZVRA 1IPFA 4KN9S 4KXMA 1U9JA 4TVOA 4UJ3A 4F1JA 1LDMA 2WFLB 5FX2A 4CKEB 1VMAA 3W90A 2BH9A 3NEYA 4BNFA 5J4VA 2WTUA 2PK3A 4AJKA 2PS0A 3GUYA 4INJA 4DDTA 1BCSA 1L4GA 1MX1A 1ZCAA 1CLEA 1RLIA 1G5FA 1Z88A 1VJCA 1TJ5A 4AJ2A 2AQHA 2O0JA 4LRQA 5LA6F 1OJ7A 1M2GA 2MWMA 5B1HA 1VPTA 3LD9A 4LZNA 4DR2B 2FGJA 4GPTA 4YAUA 2QYSA 4LX0A 4JB0A 3B52X 3IUPA 5E38A 4QPDA 4ENQA 1R0KA 5C8ZA 1RWQA 4C78A 3QVLA 4C6HA 4JQZA 4ALIA 5CVVA 3WL4A 4DVGA 3A3NA 4IDPA 3C39A 3AFHA 2QVBA 4RVFA 1WL8A 3NP7A 2WIBA 1J0AA 3GX1A 2RMKA 5TGTA 1KIFA 3J81A 2WHEA 3FB1A 4G86A 5A5DA 2OAP1 5FF9A 3L8DA 3TNDA 5B3AA 3S2GA 5REQB 1YDHA 3FKSA 1NVUQ 1JVBA 1XTQA 1BGVA 1N6NA 2HDWA 2QSZA 3MJRA 5AM4A 1OLUA 2JIOA 4EMTA 3B3JA 3OOJA 4QGSA 1N6IA 2H63A 4TQGA 4BMNA 4M36A 4GFDA 2H2GA 2AR0A 1EEXB 1Q14A 2F17A 2Q9AA 4XX1A 5CTAA 4ZGGA 3FTCA 2IYLD 3ZGZA 1NTOA 4K6CA 2BKXA 1DSSG 3ORFA 2WYUA 1ORWA 3ZKWA 3R3YA 1H5QA 1RQGA 4MQFB 4QJIA 1CU1A 3HR8A 3PXEA 3GLIE 2YWEA 4F6RA 2XWQA 2FZGA 3ENZA 2Q5FA 1CULC 5DHPA 4YUYA 4HNRA 3O2QB 3OE5A 3DLBA 4CG3A 4HY3A 3USES 5D3MA 1AUVA 3CR3C 2JAOA 1NXVA 2V6GA 1F3OA 4KUHA 5JO9A 1HSZA 3MS7A 4KP7A 3FBGA 4C7VA 1X7WA 3VR4A 1HFEL 1R1DA 4JBWA 4DPMA 5JOQA 4AY3A 1FFCA 2O2EA 2ZTVA 2P6NA 1RJWA 4G1EB 2P9CA 3GFBA 3I34X 4HZUA 1I0ZA 2ZROA 3JWPA 4NX2A 5JDCA 3RU9A 1C7QA 2YN0A 4XEUA 4F0JA 2IPNA 5AVZA 4KFSA 2WA2A 3RLFA 3DS8A 5KMGA 2EFEB 4R69A 2ICAA 4ZVKA 3L84A 1JG1A 4KX5A 4GIBA 4DLXA 1J1UA 2D5AA 3P45A 3GYGA 1JB9A 3O74A 5LUBA 1I4LD 4BNKA 3QLJA 1MA3A 4S3MA 3TLGB 2LWIA 5F3DA 1QPZA 2C7VA 5K20A 1L4MA 1TYEB 5E6RB 3VGJA 1YRWA 2DUMA 4HMOA 1IN1A 2BGIA 2A9RA 4RD6A 2EX1A 4W9NA 1UWLA 2ZUTA 5KWIA 1FRQA 1IXRC 1IVYA 3KOMA 4HX5A 1REQA 1SBYA 1EBBA 1ZWLA 3CLUD 5EVJA 3RS5A 4LOLA 4DDUA 4N5IX 3PNVA 3SEZA 1EXNA 2IDJA 1LVUA 1QIFA 1SK8A 1X7HA 3QUCA 4EG3A 4RKYA 2FSGA 2OILA 4JBGA 3H2KA 4MWZA 2ZJOA 2QX8A 4PHGA 5FOWA 3VMMA 4X1IB 3VPDA 2CLLB 3W4IA 3DVRX 4IJUA 4LYEA 1VE9A 3QKSA 3WZ2A 5B57C 4KR3A 1JHAA 2HZ7A 3N28A 1JEJA 3VJMA 4EGCB 1NW5A 1WW3A 2HWUA 2FN8A 4KQFA 1GHTA 1E2JA 3DCYA 3WO1A 3RRZA 2M6LA 4E6EA 4ZCMA 1MAHA 2Q46A 3BD6A 3F4LA 4B5KA 3N59A 2NVUB 3OURA 2ZXFA 3AFMA 1U3GA 4PXAA 3RIGA 4CEHA 2EQAA 4B48A 1JPUA 4XPIB 1UP4A 3LK7A 4UEKA 3QU2A 4AROA 1YB7A 2AMFA 3OT4A 1ILEA 3LFHA 1J9EA 5AJZA 1E3QA 2D4HA 2XDQA 2KHZA 2UYHA 1XMSA 1XQ9A 4RXUA 1AC5A 1XCJA 3M70A 4F93B 1ZNQO 2AGVA 3JQPA 2DTXA 3KJGA 1UK8A 1QONA 2HPZA 2CV2A 5T64A 1YO6A 3IE2A 4DMMA 4D26A 2G08A 2PH7A 1UUFA 1IY0A 3U4IA 1ICIA 1J5XA 1SBCA 1ZAKA 2FWAA 3GO4A 4JVNA 4NE9A 4Y6OA 2YASA 1XRSB 2NTJA 2PNFA 5FUBA 4URVR 3SFVA 3WNQA 4EEXA 5AVUA 4GD3Q 4O2BA 4QM7A 2Q9UA 3F5QA 1RJ9A 4J1TA 4IAOA 1MB0A 3SQLA 2XMSA 3SIRA 5FUQA 1ECLA 1ZVMA 2C8JA 1O57A 2FN3A 2A9QA 3D54D 2I3ZA 4C30A 3GELA 1KZ9A 1RWVA 1ULZA 4K9MA 3SX4A 3V8RA 3WWZA 1G8KA 4B3GA 1XSEA 2ILTA 3JQAD 4YUZA 4JP1A 2Q45A 3M5DA 3KVOA 1C0EA 5GZ1A 2PX8A 2JGNA 4C4PA 4JYCA 2JGFA 4YRIA 1EAYA 3GB9A 2P68A 1G59A 4I4IA 1SUBA 3PPWA 3H0CA 2VTBA 2ZE5A 4H6PA 2RDMA 2IXFA 5B37A 4FFOA 1Z63A 5TF4A 1WQ4A 3JATA 4I08A 1CRPA 3LBHA 2J8ZA 2OQVA 2BH2A 2CFSA 4QQFA 2CXHA 3OUUA 3O94A 2RBKA 4KQ9A 2AFHA 3HWRA 1U2PA 4DQDA 2IP1A 4GG1A 3C16C 4AZ0A 4ILKA 3HG7A 1N3IA 2XQKA 5FWNA 3IR5A 3SXPA 5DCLA 5AKHA 4C89A 4R8RA 4WLEA 4MJ7A 3I42A 2FFHA 2JDIA 4I14A 2OEPA 2X77A 4QJ3A 1EZZA 4P5DA 1DKNA 1UWCA 4PWYA 3FHJA 2F1IA 4EGJA 5K3FB 3W2GA 1FEZA 1I2MA 4GGPA 1FFAA 2JHGA 4HZGA 2XCIA 1F12A 1FQOA 1M5TA 1N5RA 2J6BA 3DV9A 3RVNA 3U37A 2H1LA 4BP1A 4CV0A 3O8NA 3OM0A 4KMOA 1YNOA 1L5HA 4URYR 3KZKA 4DTIA 1U5CA 3E35A 3R4VA 4I9UA 4QU8A 4DV6B 1EVLA 4AMBA 3ZWXA 4RFSB 4OBBA 3OOYA 9LDTA 2BP7A 3LTNC 4LMRA 2GZ1A 4YPFA 1P73A 5GJBA 1RS0A 3T1VA 3H0EA 1SFRA 3R7AA 4F84A 3QE2A 2VCEA 4OY3A 4P0TA 3SC2A 3H2GA 1JTFA 1LW6E 2PAFA 2JFGA 5EZ6B 3OIFA 5FI3A 2AN1A 4WNCA 4K03A 1WB5A 4O63O 5LLDA 3BC1A 4Y2SA 4J1NA 2PRIA 2VLBA 2HGSA 3C5WP 3K2EA 4LCJA 1X13A 2ZWVA 1J97A 5JVDB 3MRVA 1IHPA 1Q1QA 4ZQHA 4GW3A 3EGWA 3SLKA 4PCUA 4BZPA 1JMKC 1RVDA 2I3GA 3LO8A 1VL8A 3SDBA 1ONNA 2GHIA 3ZHYA 1C7JA 2CCKA 5A6SA 3PJRA 3IVRA 3JWJA 4FBLA 3WB9A 4L2IA 2QR2A 1T8PA 1WXXA 3FDZB 3LUHA 2EFHB 1T3SA 1V95A 2NU7B 3F90A 3MUOA 1TCUA 1G20A 3AEUA 4B76A 3G82C 4EL0A 5HKKA 5JPDA 1YMVA 3MJHA 4PC1A 1RPZA 5ALMA 3M1IA 3L7OA 4ISBA 2I66A 2C57A 3LPCA 2GFHA 2LR0A 3GRVA 5JLJA 1NLFA 1Q92A 3LY5A 3IPAA 3WFZA 3TX2A 4CQLB 2AFHB 4H1WA 1GUDA 2ZIWB 3QY0A 4YAIA 1WUIS 3DWFA 4ZYLA 1I2DA 1BEEA 1ZY2A 2V7VA 3E0XA 1G66A 1JTEA 1JVSA 1LPSA 2MU1A 3TLGA 4D9HA 1K92A 2YXBA 4JC8A 3VAZA 3BD8A 1FFBA 3RBXA 2PFGA 3FF1A 4MMYB 1DQZA 3F2VA 1XMIA 3ZDAA 1M2VA 3CR8A 2LRHA 3PC8C 2V59A 1T8YA 1N0VC 2Q3EA 3FTNA 5TJ9A 3LUJA 1GZDA 4TTVA 1S2NA 5CH5A 5J2UA 3D3JA 4PN3A 5JXWA 4CRWB 3QGMA 3IFSA 3OQNA 1SG0A 2O8EA 3G2PA 2VXCA 3ZDEA 5FWXB 3L7CA 1L8LA 1EWKA 3BQ9A 2GASA 3GEPA 4JI3B 1BN6A 1GOTA 3Q5GA 5CB0A 3LT4A 1K6JA 1C1YA 3IXQA 1G6HA 2DFDA 2JLRA 2CHVA 2EX4A 2F9LA 3OICA 2NZ8A 2MSKA 1YKFA 2A5JA 4JBIA 5G41A 1UEJA 1YK0A 3ELYA 4E4TA 4JR0A 3L82B 1XD2A 1QTIA 1Z0DA 3H13A 3C3BA 3LX4A 4TSFA 3QQPA 4S2UA 4EMBA 1N8TA 3TBFA 1EGAA 2Z5LA 4IRMA 4P6VF 3WXMA 4UZSA 1H2WA 1GA4A 2HLHA 2WAXA 1V2HE 3DFIA 4R41A 4NZMA 3ZIUA 1GFZA 2XB4A 4J2HA 4IUDS 4LMPA 3COYA 3R0JA 3X1MA 4W1SA 2P4SA 1LDYA 2R79A 3RROA 3SFTA 2QXYA 1MVLA 3FRHA 1QYWA 2QTNA 1PNRA 1BX1A 1WB4A 2WM2A 1RRKA 3FPJA 1UDRA 1UPCA 3MOIA 1YS1X 3DTVA 4D44A 2OGUA 3ISJA 4Y1GA 2JGIA 1OAKA 3BWXA 3HRHA 5HK9A 4X84A 1I3CA 2DF8A 2WJ6A 4P3OA 5JBNA 1DAMA 2CEAA 2WYIA 2CCGA 1S8FA 3PG5A 4DMHA 3ANTA 4QD3A 3U7QA 3AINA 4RY2A 1NN0A 3TL2A 2VPYA 3VAAA 1CJKC 3ZE2B 1LRKA 3UHOA 1SCNE 4UCWA 2VPWA 4ZI7A 2P62A 5KKNB 1FQWA 2QX9A 4RD1A 1LNZA 1HTTA 1TC2A 2BI7A 1J49A 2VHTA 5ECGC 3DMNA 2WNIA 4MEAA 3KP1A 3UJ6A 5EJ2A 1HYGA 1Z0UA 1GPLA 2QTCA 2FZ4A 2VN8A 2WICA 3GLKA 4H7PA 4KI7A 4XD7D 1F06A 3AMVA 3L93A 4PPGA 2FUCA 5DYIA 3ZY2A 5LQMA 2HHHB 3G0HA 2AYYA 1H8ED 4AXBA 1FYDA 3NP9A 4Y9TA 1DE0A 1I4TD 1OYOA 4RQUA 2O7NA 2I4LA 2GILA 4E33A 1QQ6A 3F3YA 1XVVA 3FFBA 3S28A 3T06B 1NSFA 1W19A 2WJ4A 3CN7A 1ISIA 3AEKB 3COVA 1R6UA 3RCBA 2NSLA 3EZGA 4MVJE 2J67A 3QFSA 3OLQA 4NBSA 4CG1A 1DEAA 4L8YA 4ZN6A 1FP1D 1WXHA 4R9UC 1G1MA 3SEAA 2R4UA 5DTEA 1WDKA 2ZWPA 3PUXA 1XPOA 2GO7A 1JQDA 5THXA 4DCJA 2FF5A 4I4TA 3VH1A 3U9TA 2PWAA 2OZLA 1AO0A 2ZSFA 2RI0A 4JCOA 1TQ8A 2J08A 3CLRD 3FMGA 4MIKA 2CJPA 1P6QA 1X7WB 5I9TA 3DCNA 3GLFA 4ZDWA 4KR6A 2P9ZA 1LBHA 1EK2A 3FMPB 4FS3A 5B55A 1FDVA 4QBKA 3I3OA 4IV8A 2IYWA 4YROA 1E62A 5KBYA 3GEEA 3ZCPA 5T6MA 2D00A 1EFDN 4FM9A 4OFBA 2I76A 2BUCA 2GJKA 1RABA 1GG5A 1YL6A 1SKMA 1HNZB 3WGQA 3DZDA 3BDVA 2O2JA 3MB8A 1CTQA 2ZQ5A 3QPWA 4ZOBA 2H1SA 2QRVA 2Z2XA 4LIPD 4RFLA 5I51A 3KHKA 3UMSA 4RLQA 2DBVO 2HCFA 2VHQA 1W2WB 5FBKA 4YJFA 4O0LA 3MW8A 2FPLA 5JLAA 3ZTYA 1A88A 3IOCA 1AD2A 1KY2A 3OOHA 3ICQB 4LDJA 3A4MA 3GHYA 1XKXA 4RLSA 1Q21A 2YY7A 1OIWA 4JJKA 4M0KA 2DR0A 5K2MA 5HF9A 2Q1XA 2UZAA 3ELWA 1WIWA 4S24A 1I7DA 2UXDB 2QT0A 4FGUA 4PQGA 1OGYA 5FBHA 1NY5A 1R88A 1TD1A 5EZSA 4P3KA 1PQYA 3RUPA 3VR2A 3G2LA 3OLZA 4UE2A 2B5OA 4OHKA 4FI3F 4KBYA 5AI6A 3EXIB 4FDAA 3OO0A 4UVIA 2FPIB 5HFNA 1T0PA 1OZGA 1K3TA 1RJDA 3HDJA 5EA2A 3D4IA 3Q5EA 4G37A 3GGPA 5AKXA 4PNHA 5EUQB 2B8JA 1L7OA 2G72A 2J0EA 1BS2A 4O0MA 3WYBA 1KIMA 4EFMA 4J3NA 3IERA 1YQXA 1OX5A 1XVLA 3OIVA 2A59A 4LJYA 5BQ5A 1ZKDA 3TW4A 1OH8A 4HQKA 4QTTB 2QVXX 4LXIA 1V11B 1U31A 4MUYA 3C3WA 3Q98A 1QQ7A 1PWXA 3EARA 1U9CA 5ALDA 1CZOA 1L1QA 3GVXA 1XD8A 1G20B 1AKVA 3PQDA 2ZBEA 3IA2A 5CNKA 2AFHE 1ZM2A 1P1RA 4JH0A 3ZQ4A 1BE6A 3AUXA 3H8JA 1ZO8A 3RHSA 4EG5A 3EMVA 1KYWA 1WPRA 3WQSB 4MI3A 4WCDA 4DKXA 1BHJA 2J3HA 1AGXA 2ABWA 5COAA 2QBYB 5CGZA 3GW8A 1TFUA 3IPLA 4WN3A 4W5HA 1FDTA 1RAAA 1CW2B 2QXUA 3QVWA 1QVAA 5EMNA 4AFNA 4QOEA 2F1OA 4ZEXA 1SY7A 3PYXA 2Z09A 4EUHA 3KJQA 1K7EB 2Z4TA 2P30A 2XUHA 3YASA 4EG6A 2CNKA 1UK7A 4AMUA 3S2EA 1M0WA 4M89A 3WWEA 4Q9IA 5F2EA 1GADO 1HI9A 1Y1SA 1CHDA 1GCIA 3C6BA 1Z5VA 1QOQB 3RUFA 3O93A 3MS2A 2ZAYA 2C20A 2RH4A 2C5AA 3OC0A 4RU1A 3CMMA 3IOBA 3TZ6A 1PR4A 1GTZA 3NCHA 2IDKA 3OJ0A 1GARA 3CB4A 2L18A 4TV9B 1JLKA 1OX6A 4QRDA 1TLFA 1C8BA 2WHPB 1E3SA 3QKRB 5LB2A 3NG1A 4DGQA 5HS4A 2LZ0A 4FYJA 3ZZNA 1B14A 5FDFA 4OFZA 1GT6A 2ZRMA 4ZO8A 1GZ5A 3GI1A 3AHIA 3M33A 1JSXA 1IOVA 4WLFA 4AJHA 5JMOA 2FH5B 1T91A 4CLOA 1W76A 3OHMA 2P1RA 1LRLA 2X7XA 4IOMA 3GBPA 3OPQA 2JFXA 2JK1A 4F1WA 4AB1A 1DUVG 1X70A 1RIFA 3ADPA 4HQRA 1CF9A 1HOXA 1K27A 3K6SA 3ETCA 1P1HA 3E3NA 2BTOA 2C4HA 4L51A 1TMKA 2WAOA 5HOQA 1JE1A 5CBKA 2GD1O 1DJNA 1M1XB 1S9DA 1TTHA 1T2CA 4CT4B 4KPUB 4BQFA 5K3EA 4KAFA 3EZ2A 2YKGA 4QPJC 4I0WB 2IYUA 2F4VB 4KHPB 1O95D 1N1GA 1Y6RA 3KTAA 1J24A 2C07A 2QN9A 4QSHA 3UEOA 4EK9A 1YE8A 1SKYE 5F7OA 4IEIA 3M6AA 1TX4B 3VU9B 1F48A 1S2IA 4HRXA 1G9XA 2LCIA 4E03A 4DJJA 2V7WA 4C4OA 3N6VA 1ORIA 1YQWA 2FQYA 2PO7A 3EPRA 3OX1A 4D25A 1JTVA 3TG2A 2PGLA 3ZXXA 4GL4A 1B42A 3JAKA 1C3OB 1C8KA 1MEOA 3FCEA 4EDHA 4DUGD 4N12A 4RA6B 1XTPA 1N77A 1XRLA 4RTKA 4N49A 4EZEA 4PX9A 4IJWA 1YZ3A 3QX9A 3ZDYB 2RHJA 5DNAA 3W5SA 2P6UA 1B8PA 4QYSA 3L8FA 2XV1A 4G5YA 3E9YA 4F3YA 3Q2IA 4RLFA 3KZXA 3MLEA 2Z43A 1UXHA 2Y1EA 3FYHA 5AK0A 1PD1A 3WMXA 3BK2A 2OPHA 1UDAA 1V2GA 1P5ZB 2D6FA 1KI8A 2ZVJA 1V3QE 2BBTA 5A7HA 1YZKA 4GWKA 2CVHA 4G0VA 2Z4RA 5FUXA 4DSOA 3PYLA 3JASA 5IT5A 3AI1A 4CF4A 4JENA 4EH1A 2HLPA 4S05A 4JEUA 1G21A 2IQIA 1L7MA 3HEMA 3KHSA 3FWPA 2Q07A 1KFEB 4JLBA 4DIUA 1SZCA 3ZNOA 2QN2A 4EKYA 5SZKB 1HBJA 3T9FA 5FAKA 3CNOA 4GI5A 5HQJA 3PDCA 1V16B 1BVHA 3OM8A 4KCGA 2CLMB 2REOA 1SBZA 2RK3A 1AK1A 5TXGA 5LM3A 2FI1A 1IN7A 1JBEA 3RODA 8OHMA 221PA 2OPBA 5F51A 3UYKA 3DC2A 4D96A 4Y9SA 2PANA 1M7GA 5FOQA 5IZ4A 2P5TB 2BGMA 1KI2A 4QXQA 3MM4A 4AYWA 2XVYA 2O8BA 3JQ6A 4GKBA 4EO9A 3UT5A 2C95A 3Q4GA 3VR5D 1CT9A 2PGXA 3TEJA 5B5SA 3HRIA 2R66A 5HP4A 1ZISA 1NTRA 3REFA 5J5VA 1VJRA 3CZCA 1TVKA 1U2ZA 3EIFA 4P3NA 4Y9DA 3QPDA 2VHZA 3GZTB 2VSOA 5FTJA 5HKKD 4NCJA 2VPXA 5FCDA 4EUSA 5J43A 2QR5A 4I1IA 2C2GA 3W78A 4RVNA 3GJRA 4Y2HA 2ZYGA 3EXFB 5L8VA 2A7QA 3AHHA 4ZHQA 3MWEA 1E1LA 3SZOA 3UMBA 4E5VA 1B16A 3L7JA 3NFYA 3FMFA 3JWIA 1TU3A 4XWGA 4F45A 3CFYA 5CYOA 4LBYA 4BVGA 1ZQ1A 5EPEA 2FP4A 2ZR9A 3EXHA 4BZXA 3IQWA 2EJBA 3DMFA 5EINA 3SHQA 3RTAA 4A3SA 2GQ0A 2ZUVA 1LPMA 3O9MA 2GVZC 4GP6A 3PITA 2VC2B 3SQWA 2R6DA 3KU4A 1E2KA 1RPJA 2QTHA 4OREX 4KN6A 2G88A 2VT2A 3D6NB 2ZIGA 4TROA 5HCNA 2AN9A 5B64A 2ZJBA 3HDGA 2QV7A 3MBOA 2GUGA 4HVAA 3SLGA 3W6OA 2QMUA 2WMYA 1LLDA 1BQ4A 1EFPB 1RJ9B 4WXYB 1I2ZA 2CN1A 4ZVVA 2HJVA 2RKOA 2WAMA 3U6BA 4TTSA 5K0ZA 2V9CA 4ZYZA 4D0NA 5HG0A 2G1UA 1MQ8B 1R8XA 3PRHA 3H9QA 3QBDA 2MSNA 3EUEA 3NIFB 4P35A 2CZCA 1J25A 2QMEA 1P1CA 2R97A 4YDHB 3VVBA 3F3KA 5EIBD 1CS4C 1JGTA 3ZWAA 1H6AA 1GY8A 3KQHA 4CNBA 1NX6A 1OBFO 2IUYA 1B93A 5DTMA 1JSRA 2I8CA 4CEHB 1FFSA 3IH5A 2ZREA 3BVPA 3G0GA 2X1MA 3RAJA 2VZ8A 1ADYA 3Q7EA 4PYLA 1DKOA 1DBPA 1GQFA 1Y6ZA 3B6ZA 1RI3A 4N9QA 4QDUA 3IQDB 3T4XA 1X42A 3CWCA 3UF0A 2XB6A 2V7QA 2V74B 4Z1MD 1K06A 4B7AA 1B8OA 4MMXB 3NV9A 5HWSA 1XD2B 4BC1A 3F9RA 1PGOA 1R4MB 4N03A 4WT7A 4MTLA 5EE9A 4G5SA 2VHUA 1SUDA 2YY5A 3OMWA 1BDBA 3DE1X 5EFZA 4JI5B 5JAUA 2EKDA 5EKDA 4OUDA 5AVRA 3FPBA 1RJGA 3AVVA 2X2PA 4WE3A 1Z62A 2Z1DA 2OZVA 4JI0B 3TOXA 1SHUX 3H65A 2Z1MA 3OZGA 5ILQA 1QVVA 5T4BA 5CT4A 3N2GA 4JYBA 1ZK2A 4II3A 3VV2A 4B43A 2IJGX 4ZDKA 1OR8A 3B1VA 3EBOA 5HF5A 2P5YA 2R8BA 2VQ6A 2Q6KA 2ZUBA 1O08A 5DU2A 3H2JA 3OCVA 4DG5A 4L4UA 1W4RA 2I99A 2PCLA 1WG8A 3GA5A 1SULA 4NS1A 4E0BA 2JD0A 4R31A 4FMPA 4RETA 3E3OA 4GQBA 3TLYA 1URPA 1XEXA 4I2VA 1S1MA 3PFWO 3UAYA 4HWSA 1Z5GA 1Y8RB 1FY2A 1B8UA 3U3KA 2GZ2A 3SC3A 4P22A 2W6MA 3DEKA 4CKWB 1JDSA 1KZ7B 1SIUA 1JIXA 4GX1A 3HKBA 2X2EA 4RV9A 1SU4A 2QE7D 3IQFA 1GUYA 2NW6A 1XZ8A 4M8SA 5ALUA 3KWFA 4N7MA 1C81A 4KVGA 3CBGA 3TK1A 3RHFA 1L4KA 2VYQA 2WDPA 3QVUA 3UWMA 5AIAA 1ZGCA 2VJAA 1YVRA 4JOBA 2BVNA 1LTQA 1ZL2A 3KNZA 1A9XA 3LG2A 2IYTA 2CFRA 2XZDA 3I0NA 1Y3BE 3UMJA 2OC9A 4EPTA 4O2AF 5T7BA 2W8BB 1U0EA 3DO8A 4M83A 2W7TA 4COKA 2GEBA 5ALFA 1YDGA 5IMSA 4YMVA 1YCDA 4TLEA 1LVGA 1T3ZA 2IHVA 1VDZA 5CLQA 1FDUA 1KMNA 3PEEA 2GZSA 3DE6X 4N0QA 5AVOA 4TMXA 4EUFA 5C5IA 2H9AA 4TTJA 1Q7GA 4KQHA 4P80A 1BW9B 2OXFA 2AWOA 1LNQA 4OGKA 5DP2A 1NXOA 3KRTA 5HZHA 2PS9A 3SY8A 1D9ZA 2PLWA 3S7TA 3VJKA 5ALWA 5M04A 3DPUA 1IYZA 1WD7A 2RHWA 3T1QA 2IXBA 4PZZA 4BFSA 1XKTA 2HRZA 1DMSA 3MRXA 3MCAA 1D6NA 3DUFA 5D3KA 2Z3WA 5JEEA 1KETA 5HZGA 4DDWA 2OBYA 3D8RA 3JQFC 2JCSA 1G60A 4N5MA 1X74A 5GQSA 1W85A 4ZREA 2IH5A 1VHLA 2HHCA 3QYAA 1DT3A 4MR7B 3WSWA 1NI4B 1OAAA 4M1MA 2B8TA 2Q49A 3M2PA 4IJMA 3O0DA 3SF0A 4L50A 2PZJA 2GETA 3CZPA 4GZ5A 4B6OA 3F1KA 1WO8A 4AY4A 3R8XA 5IM4F 3HKCA 2WINI 2FY8A 2VTVA 1XLTA 3S27A 4FT2A 3B8EA 3N8NA 4KDEA 2OD9A 1KERA 4PICA 1G6KA 3NAQA 3UWSA 2FE1A 4ZVQA 1UJ5A 3DBIA 4BUZA 1YS6A 4C4YA 4MR8A 4WERA 2PGJA 4BXOA 1JF8A 3V1UA 4GLFA 3KLPX 1EUCB 1U3CA 1UZUA 5FPKA 3P19A 4BWFB 4DC9A 5ELMA 2QLNA 1PT6A 4FB5A 5A5GA 4QPNA 3G7SA 4FMDB 4G0QA 3V7WA 2N1MA 3ZZUA 4Z2AA 3P96A 4D92A 3UAVA 3KQLA 3KQWA 6ABPA 2QN1A 2IU6A 1JZSA 3DOJA 1WMEA 2XVAA 3DR3A 5DVZA 5JD3A 4RY8A 4P7BA 2HW8A 2ZE6A 2C94A 3VHQA 2Q3JA 3QLVA 1SCBA 3SC4A 3FZGA 3R20A 4KRYA 4PG7A 4Q19A 1NP3A 2ZGVA 3D1LA 1IMJA 1ODTC 4D9JA 1L8XA 4G5RA 4XX0A 3F71A 1JSLA 3BJEA 4UCQA 1CUAA 5GV7A 4EUEA 3HVIA 2BKVA 1IBLB 4B46A 5DWQA 4RH0A 4EI2A 1Z06A 1R6XA 4ASUA 1WP4A 1H0HA 1LPOA 3KXKA 1ST3A 2QD2A 1ZH0A 3WP1B 3QIVA 2JLVA 2CB0A 4DEVA 3I9JA 3VJRA 3OE4A 4Q7JB 3MCZA 4GHWA 3DJFA 3K1AA 3KQPA 2XDYA 2WP0A 2EERA 3KYCA 4X00A 3UJPA 1JEOA 2IEAA 2ZSEA 5FBZA 4FCVA 1N6RA 4JWKA 4QT4A 2ZJFA 5IM4A 3C97A 3G2QA 4O4HA 2BFNA 3PXXA 2E0IA 4MQ6A 4L5IA 4X9XA 4A8TA 5A5VA 3SLRA 1KJYA 1J5PA 1TAQA 2G9RA 4D4GA 1B2LA 3CUKA 2DUWA 1Y89A 2X15A 4U0JA 4B9AA 2UXCB 1YA6A 3OQPA 1VPWA 1DNPA 3FTQA 4FGKA 4ZOLF 4QNMA 1C9EA 5HKBA 4L74A 4FDVA 1Z56C 1DKRA 3AR7A 5BWCA 3DKKA 1U8TA 1VLQA 1EGQA 1TMGE 2CKMA 3GNTA 2VWPA 4Q4JB 5CA0A 3RS8A 1HDRA 4FUQA 5TEVA 3IHLA 4YP5A 5AHKA 1EJBA 4HC4A 5EMHA 2OV1A 2IEYA 1AHPA 1PV4A 2WJHA 5DNDA 2V7UA 4H1TA 5KYVA 4BNIA 2B82A 3H4TA 3K15A 4G97A 4JI6B 4LK2A 5BV7A 4H1UA 3NYQA 4M1OA 5L7YA 4AF6A 1I94B 2FSIA 3T0GA 4QG3A 4EY6A 2IVFA 4RPGA 3AXTA 4WD3A 1FOEB 2VATA 4TYMA 1MQ9A 3PT5A 2NPOA 1NMQA 3DE3X 3K6KA 3KPJA 1Y63A 1CRWG 2R86A 1S3SA 4NYIQ 1WEKA 3EJ6A 3S4YA 3OOEA 3ELBA 2VDWB 1NUSA 1ULHA 4LDRA 5HIJA 3D6VA 2P90A 1EWRA 3ABIA 4E32A 3BAFA 1DDGA 2Y4OA 1XU9A 1RKBA 3EODA 1YB5A 2GZMA 3C5VA 2PS3A 4BEJA 1ZMXA 3AF0A 3PCRB 4MV9A 4U7WA 3LQQA 2VTBB 4E3ZA 1G4UR 4H9GA 4R98A 4G1BA 4DMRA 1W7AA 2IFTA 5DCWA 2I4NA 5K2OA 2WG0A 1AKWA 2DQZA 2C7BA 1K4KA 4R2WA 1WW8A 4DQ0A 4KFCA 2O5VA 3I30X 4DYHA 2AQIA 4Q3BA 5IJ0A 3DXFA 4UM9D 3PXGA 5TLSA 1QTNA 1TM5E 3T15A 3C4JA 5JRDS 1NVFA 2PX0A 4NCHA 5FBQB 4EATA 3AI3A 2F62A 1U80A 4KQCA 2D2EA 4A7PA 3WSVA 1CV2A 2C9BA 4RD0A 3UPDA 1LQ2A 2H7YA 2IZ7A 2WE7A 3M0EA 4DG9A 4Q01A 3T0IA 1OF1A 2VO1A 4Q02A 3IVCA 2M6RA 1IM2A 2AX3A 5AJYA 3GAFA 5CDUA 3ZD6A 4Q9DA 1ND6A 1TD9A 3Q8WA 1C4XA 3QEJA 1UBSB 4QVGA 1OXKB 1E2NA 5DOZA 3X1KA 4DPLA 4EHIA 4E13A 3WGYA 3ZC3A 4DRYA 1Z74A 3NTLA 1Y48E 4G56A 2CGEA 2JCBA 3D31A 3JRNA 3RUDA 2V7EA 2A5LA 3WY9A 8AT1A 3EIEA 4HTFA 1DADA 1SIBE 2FR8C 4Y6GB 3C48A 3R5XA 4A27A 5B7PA 3U19A 3ILVA 2VPIA 2P4EA 1GGEA 3PC7A 5EJ4A 3PD1A 4D9NA 1YZTA 3LT2A 3NHLA 4HNGA 4PGGA 5BV0A 3ZZTA 4DCUA 2JZNA 3L6BA 2E3JA 4ZVMA 2NG1A 4WKPA 3IBFA 3RJ9A 3NHAA 2QMHA 1UWKA 1F0KA 3KR9A 3MUNA 1JHQA 4EB8A 4X8MA 4MW9A 3WYNA 1W4BA 3EG5A 1C9JA 1VCHA 2ZE8A 3AXSA 3IR6A 4IOKA 3WHKA 5AVVA 1ZGBA 3SYTA 1PUJA 1WSWA 2Y9MB 1UFRA 4HB4A 1YCGA 2GWRA 3UG6A 3WTBA 5CJJA 4OLHA 2R4TA 3BDIA 3PNLA 4BMOB 3UMGA 3MZ0A 4HLQB 5EXXA 3GR6A 4D4KA 1JFVA 1ENZA 1PCXA 4QOJA 3GBSA 4C43A 4GLJA 4RJTA 1U1DA 1ZR2A 4Q1VA 3BH0A 4WHMA 2ARKA 3DEHA 1PG2A 2PD4A 2XMBA 2QAJA 4GVPA 1NNUA 1NZFA 4LISA 3T7AA 5EE5B 1TO6A 2UUCB 3QFTA 2MYUA 4G5XA 4DLTA 2R8YA 4EO4A 1HG1A 2V7PA 1VBMA 4C0HA 1R64A 1W4ZA 4RSHA 3SYNA 1Y1KE 3PSAA 4H4DA 3SF8A 2A86A 2ZXEA 3GRZA 1C4OA 5KMGB 4LJRA 2COEA 1R4NA 5JPIA 2YJZA 2CFIA 3JW8A 4GMXA 1ESCA 3SS9X 4MR9A 3OIGA 3VTFA 1CB7A 1GSIA 4BO2A 3KQNA 1JU9A 3H3FA 2QIPA 3GK3A 4X1YB 3TLZA 1XMJA 4FGLA 4XQGA 4C5AA 1CZRA 1WOMA 3F46A 1MJ5A 3FCOA 4J3JA 1FZTA 2HJWA 4E1VA 3MERA 2YV5A 1XLTC 1L5YA 1P2VA 2GCNA 1E5TA 2ZBPA 5H80A 3BEDA 4F5DA 3A7DA 1W93A 1FLAA 3CG4A 5D6NA 4RK6A 5BORA 2VPQA 4QBFA 2OBFA 5GGYA 3JZMA 1PJ8A 4YRZA 2F55A 4LX8A 2ATEA 4U2GA 2P77A 3VBEA 3BF8A 4W5NA 1U7XA 4JUAA 4Z0NA 5KCMA 3VV3A 5FJIA 2UZ0A 3UT6A 3PUKA 5AOVA 1V7ZA 3L1IA 2WV9A 3KOXA 1QYRA 1TOAA 1OXBB 4FOTA 1D2HA 1E5DA 4FFPA 4JT4A 3ML1A 4KR0A 5B3JC 3AVYA 4XA8A 3CF2A 2WZCA 2O50A 3IILA 3E1GA 2JCGA 5BYBA 1ABFA 1PL6A 3AVPA 1S01A 3FDXA 3TZCA 3B60A 4S1PA 1M6WA 4LBZA 4LAFA 1OPRA 3EEYA 1YUMA 2VP4A 4XFJA 1T6BY 1DT5A 4WFIA 4FIZA 4G84A 1HDGO 1S96A 3OIUA 3C3YA 2OG2A 4NK4A 4J7CA 3DFUA 5CIQA 3S7ZA 3JD3A 2ZBDA 3QTBA 1WF3A 4N0DA 2FX3A 2JFPA 5GZ6A 5IKMA 4KAJA 1UIMA 2PM8A 4QASA 1HT1E 5LVAA 4EI7A 3N9IA 1T8TA 2B1JA 3OFNA 1WKBA 1YVDA 3Q10A 1WABA 5DX8A 3GRRA 4R84A 5LBIA 4XPZA 3P2KA 3TLKA 1XRJA 3KXDA 2PZ8A 3RVLA 1GZSA 1XDWA 3DOEA 3KVNA 4Q7MB 4AY5A 2I2FA 4X1KB 2A5GA 1HLPA 4WXPA 4PPFA 4KTVE 5EJGA 1RYDA 2DKNA 3SZGA 3GJXC 2CVOA 2JBAB 1JN0A 3H86A 4P2GA 5K3CA 2FMXA 5HEKA 1SA0B 1F20A 3QMMA 3CVVA 4NHOA 1E1QD 2LGJA 2UYYA 3Q0TA 4BP9A 5SZIA 4CBVA 1TAUA 2J6HA 4JELA 2YWHA 4CR7A 2V03A 1GZ7A 5TARA 2N46A 3JZDA 2EW2A 3WMEA 1KYYA 1M2OB 2JFBA 3UJ8A 4F11A 2TMKA 1SC4A 2XYRA 1K7SN 4R9SA 4NSNA 3SJAA 3V4FA 4S0XA 2RGEA 1GTJ1 3HA2A 4BNZA 1ZSNA 3UVEA 2WQZA 3CR7A 4CCYB 1R4NB 5CXQA 3NMUF 4WQMA 5CD9A 2QKYA 4BLUA 1IM5A 1HSOA 4TXNA 5LNK6 4EFLA 4YDQA 2Z9BA 5CIYA 4S1WA 5A62A 5KVCA 1EVIA 4DBLC 4BEWA 1PJBA 1C7IA 1K2WA 1WVMA 4B82A 4ZMBA 4O2BF 3CVWA 1CJTC 1ZOPA 3PNMA 3FWKA 1SUPA 4F9TA 1PJ3A 1UR5A 4CDNA 1I14A 5BUZA 2RCNA 4MVJD 2HSWA 4Q18A 1NY6A 1R10A 2CUKA 1G19A 3OF3A 1FC0A 1E2GA 1RP7A 3UMFA 2GWHA 3O8OA 4EW3A 5LXTB 1D1TA 1U7ZA 2Q5QA 4TWRA 1B00A 1QHHB 3HMKA 3M6MD 4DRXA 2OHIA 4HCJA 4C7JA 1IZ8A 4EHNA 4HYTA 4X8HA 3BJRA 2VUSA 5J5CA 2XJ4A 3MRTA 4KQ2A 1NXPA 1E5QA 1LLFA 1ZA1A 3OTHA 3P9XA 3VO9A 3VR4D 4CM8B 1HNWB 2JLWA 2OXEA 5J1SB 2AF3C 4EUNA 1KK3A 5CG1A 1CUGA 3O8DA 5EMJA 4DE5A 4RCVA 5EMKA 1MHPA 3TIIA 5IT0A 1E3WA 4ZQIA 1FFYA 3ZWQA 1GPH1 1L5QA 5AVSA 2PH1A 3AKCA 4UBNA 2BELA 4AN0A 2G82A 5D5QA 2G36A 1N2JA 2D5CA 3ESAA 5JSUA 1LI5A 2XUZA 4RLHA 3JRXA 5GOTA 2HN9A 2FN4A 1M6NA 3H5OA 1E9BA 3GU3A 4J29A 1GZ3A 1D0SA 4YI3A 4IHAA 3WK8A 5CNMA 1GEGA 1RLTA 4MUIA 5DM70 4RKWA 5AXCA 1VIYA 2FSPA 3CPHA 3O8QB 4HQNA 4AVYA 1QDEA 4BX3A 2XH8A 3E81A 5B7QA 2XSZA 3F4KA 3NEAA 4LRWA 3F7TA 1N5MA 3MQFA 2W6NA 4WZBB 4AAYA 5ALPA 1ZU5A 3LT1A 4N7BA 4OMCA 2B94A 4R0NA 3AYXB 4PO1A 3DHEA 4ZOAA 3DP7A 1MRSA 1BXZA 3GUUA 1S8OA 2HEIA 1M1YA 4IJ6A 4IX1A 1Y80A 2GAIA 4DWJA 5IXJA 1N3BA 3HM9A 1Z8NA 1JEDA 5H1YA 1YA8A 2L69A 3Q7PA 3EZLA 4FQ5A 1UINA 3NHUA 3RUEA 2JAUA 4Z2YA 4WKCA 3TDMA 1LPAB 4EUKA 3C3EA 5KTRA 1UFVA 5NULA 2OV6A 3B2NA 3NKLA 4JXJA 1XQVA 4R2HA 1T4GA 1XZQA 4ZV7A 2ADOA 2PUAA 4OHOA 5I4KA 4JLVA 4M7WA 3GLGE 1Y8AA 3ECSA 2PA0A 4LECA 5EWLB 5EZYB 2CE7A 3QKIA 5BVHB 1KVQA 4QFCA 1N34B 3O4FA 4L02A 3FPCA 5AYVA 2QW8A 2VSYA 3DOHA 3IURA 4EL5A 3GNSA 4RS3A 4DIOA 4XB2A 3P2JA 3R9XA 3P0IA 4OLAA 4KO8A 4Q47A 3AETB 4DCGA 5L3VA 1JI0A 2Y1CA 5TIIA 5B4UA 1MNAA 1PGJA 3HGQA 4GR5A 3ZIDA 5DW0A 4EEZA 2FHSA 3IX7A 4C3ZA 1WWKA 1KU6A 2WSSA 3QFRA 4MUGA 4TRMA 5I9MA 2YXPX 5JANA 1PVOA 4ENRA 2IHYA 4BCBA 1NVGA 5H0IA 3P4YA 4KWEA 5FNVA 4GSLA 4LJAA 2BRUC 2QM8A 4TT3A 4XM2A 2VZEA 4DJAA 4DDKA 4P2BA 3DCJA 1EVJA 1N7IA 3KLMX 1ZK1A 2EG9A 3HUUA 1TIKA 2LDBA 2OCKA 2VRCA 5SYNA 1JR6A 4NV3A 4JB8A 3LXXA 5EJ9A 4G23A 2YBEA 4LK3A 3TDNA 3TW6A 3TGLA 5FL7D 4F72A 3VOBA 1T13A 3I32A 2X9VA 5LQAA 2WU3A 3UENA 4E30A 2ZYWX 1UPXA 1ZGJA 3N58A 4TTRA 4U2KA 3RWMB 1GQRA 2VTDA 3A1UA 3BULA 1R8JA 3LXRA 3RYTC 1TB4A 2EC5A 3MINB 1L6RA 4GNRA 4RTJA 2GB4A 2F00A 3T3DA 1C29B 2EF1A 2VAWA 3NH9A 4DR4B 5TMEA 1KAQA 4UKDA 4LXQA 3RJTA 4FN4A 3HO6A 4Z4CA 2VSXA 4DXHA 4Z7OB 4L3VA 5B6PA 1W4LA 3EOZA 4L8VA 1XZAA 1O94C 1JFFB 4F9EA 3OCXA 2VUHB 3ZR4B 1ETUA 2H52A 4DN6A 3SWWA 2HGZA 3STUA 3VHLB 1QZ3A 4XRRA 2Y2UA 3W3AD 1FNCA 1YU9A 3B2QA 5C3UA 1QZUA 3ESXA 5AFSA 1XZFA 4DIKA 1H1LB 1OZAA 2EATA 1MU0A 1G5HA 1Y4AE 2BFBA 2DUJA 4P8RA 5I7FA 3V8EA 4XWWA 4DR1B 4B3RB 4AJOA 1EDBA 3LBIA 4TT8A 4XFKA 3V8NA 2UYGA 4F86A 3FUUA 4RA6A 3ZU2A 2YN4A 4FZ5A 4XUDA 1XXHA 2XHZA 4PQEA 2I6SA 2BKEA 2X23A 1W87A 2XDWA 2N75A 1FFXA 3FCXA 2IITA 3FR7A 3GCWA 2HJSA 3PR1A 3QVGB 4AYTA 5LQSA 4MV7A 4PFJA 1T1EA 3EVZA 2CV1A 1OYVA 2WWVD 4IQFA 3UH0A 4R7GA 1FVOA 2B83A 1A2QA 4OAQA 2JGEA 1QQTA 4I1RA 1SQ6A 4GNKA 1WV1A 2VDWA 4YJGB 4E94A 3IKTA 4HNAB 1VIMA 4LCBA 1QWOA 2IXAA 1GRQA 1NJ6A 1Y7TA 2G5TA 1UBFA 3KG2A 1PW7A 1M73E 3MWEB 3ZWNA 3N76A 3W5HA 4MB0A 5KWVA 5H7XA 4REQA 4TWZA 3MINA 5JISA 4GYYA 5BSVA 3D6FA 3D8BA 2VDUE 4BE9A 5KREA 2BSQA 2KW5A 4KTTE 3DZBA 1P60A 1YZVA 2TS1A 4Z9AA 6AT1A 3D9QX 2PXXA 5JWHA 3RSLA 1ZKMA 3BXHA 3D7SA 2QZ4A 3X1DA 4EG1A 4D82A 1W88B 5EJMA 1A96A 4P81A 2QTVB 2IHTA 5TS2A 2GCEA 3VYTB 4BMPB 4CKCB 4LZWA 1JG4A 1GG2A 1KPHA 1MJNA 1E2MA 2NZVG 4OB8A 1R3DA 3PGKA 4OMFG 1E3EA 3UXYA 4K88A 5ARDA 3AP3A 1VCMA 3LOPA 3W2FA 4QLBA 1ZRHA 3Q9LA 1NC3A 2JAHA 4R8SA 3TQTA 1X2BA 1W85B 2BJWA 4PR0A 1UMCA 2CDRA 2I55A 3MCWA 1BA3A 1WSBA 2IPMA 2Q5HA 3OIWA 4PZDA 2WF9A 4ONEA 5F78A 4BMYA 1X1DA 3PR3A 4J07A 1JPNA 4CF6A 3EDMA 3FPEA 4XYGA 4LFCB 3VH2A 2P40A 1SBIA 3FCAA 5TVKA 3TTTA 3LRTA 1SCDA 1XZHA 4HN4B 4A26A 2WU8A 4DLAA 2QZJA 3MRSA 1LK5A 3O90A 1Z12A 3S1SA 1YK1A 2JJQA 2CBGA 1PO7A 5LYYA 3G3EA 5H9VA 3JSXA 4CWAA 5JD5A 2HV8A 4CIDA 2WFZA 4BLSA 1G8YA 4G5GA 1CJMA 3GLQA 1WTAA 1T0HB 1OLXA 2OQ2A 2Y0DA 4CF5A 2I7XA 5CP8A 4WZAE 1UQUA 1D7AA 4IDEA 2ACEA 3GDFA 2QD4A 4F46A 1UMDB 5JXGA 3H9UA 1TT5B 5AK3A 3O84A 1GVHA 1LLCA 5DTRA 4EB3A 1N2OA 1A5AB 2VAVA 3GYBA 4QQNA 5T4EA 2VP6A 5A2QA 1KEWA 4RK0A 1YJ5A 1L7XA 2XGOA 1RKXA 4QC2A 4E7PA 1BROA 1F3LA 4KDFA 3EC2A 1XMQB 1ENPA 3L0PA 4WZ6A 5YASA 1UXOA 3ANNA 3K71B 1X7XB 1TK3A 3AZQA 2HXYA 1XEFA 3KJFA 2W0SA 5F7JA 3N6RA 2LV8A 2V4MA 5CT6A 1CNFA 1C1XA 3C3CA 3COZA 3PCTA 1T24A 3MWGA 3QK7A 1V8BA 4W1RA 2F8LA 2C8KA 2YCLA 4PSCA 3ED1A 3OJFA 2PVSA 1VBKA 2FA9A 3EUWA 2NADA 4JLUA 4RD2A 3ZX5A 3CG0A 3HKDB 4NJOA 2AT1A 3ACDA 3KO8A 3LLVA 4QYXA 4F60A 4CL2A 4XDYA 3CZ5A 4EB6A 1JKJA 2XA2A 5LXTF 4XWTA 2G4VA 3L02A 4GKJB 3K6SB 3D4PA 5DH9A 5FA8A 2J4CA 2DPYA 3MMXA 5A3SA 2QZPA 3STTA 2KPOA 3BIOA 4GXQA 4ER6A 3Q3JB 1OLSA 1I9GA 3ANSA 3CX6A 4NP6A 1ACJA 3Q11A 4M0DA 2G07A 3K70D 4Z53A 2QQEA 3BL5A 3B70A 2VK4A 3C74A 2WU1A 3M9XA 4QVKA 3PDWA 4TM8A 4UDXX 6REQB 1X38A 2H4JA 1KKLA 3KB2A 3NBXX 4N7JA 4W8GA 4DZTA 4OQDA 4RTQA 3ZDDA 2BCJQ 5KYKA 2R751 2KLBA 4M9RA 1X3SA 5ER9A 3BRQA 1IY9A 1ZI9A 3L8YA 3LYHA 3RYIA 4H1VA 2YZNA 5LWQA 1A8HA 2H1HA 1WHTB 5E4JA 2JLUA 2YWXA 4BWGA 1H2HA 4LOAA 4O4LB 4XQ9A 5SYAA 3TFWA 2A0YA 4DUYB 3NGLA 1ZQ9A 1T3LA 2XHEA 1MTZA 2HO5A 1Z4NA 3L0CA 3OOWA 3UB2A 4QRIA 3MWDA 5KDDA 3E9ZA 3VPAA 1T35A 2YS6A 4HQOA 3IMEA 4GE0A 4M98A 1FS5A 2TECE 3G6WA 5PGMA 1LWOA 2GYUA 3A4IA 3ONEA 1PT5A 2Z2ZA 1YQ9A 3ITNA 3GLIB 1JH9A 4AG6A 1TQ2A 4ND1A 1YRHA 2KQUA 2QQGA 2XCQA 2P2LA 1QO0D 1MOPA 3FVWA 4KPFC 3VTKA 2R44A 3VR6D 4QNNA 2NP6A 4OXQA 2VYFA 1DX4A 1XUOA 3UOAB 1T9KA 3WWCA 1C80A 2QSYA 3PI7A 3S2UA 5F4BA 1LX7A 3QHQA 2H16A 2R1TA 4NH4A 1O8BA 3AFOA 5A03A 4PTYA 3CLVA 4UNPA 3EW9A 2C1EA 1VYUA 1LX6A 4J03A 1ZD4A 3M1LA 4UPDA 4BNNA 4MTCA 1YDWA 1T9BA 2GPTA 3HZZA 4G0UA 3V2IA 3L7KA 4XIGS 1EK0A 1E9VA 2Z56A 1H8EA 3EC7A 1KJNA 4UEQA 1TW3A 2ZP1A 4OQYA 5DSZA 1B1CA 5EQTA 3UWDA 3TLXA 5BR4A 1T2NA 2D7JA 3EPPA 2GBLA 4TRRA 5CCDA 2PIAA 1MA0A 3KFLA 2Q21A 4FYPA 1GPUA 4ND8B 5KYXB 3T52A 4PXYA 3A6FA 5IRCD 3CZAA 1E4YA 2XX3A 4M2LA 5L6MB 3OM9A 3R0ZA 4PHCA 2O5CA 3RFCA 4Q4AB 3E05A 2W6CX 2IODA 2JGKA 1YZLA 2O2GA 4XDHA 1XDUA 4OAPA 4YJ3F 3I9MA 3FCCA 4QARA 2G6BA 1AHIA 3M5CA 2B20A 1H2YA 2J0QA 5JSHA 2YIVX 4IDBA 5HE9A 3AHCA 3TRDA 5KYWB 3DEFA 1ZVQA 3AVUA 3WGUA 4IVQA 2NVBA 5CVCA 2CHEA 3CWZA 2PO5A 4YRJA 4YJFB 3QPUA 1KK0A 1TVKB 2GD2A 3KC2A 4OHYA 2WFAA 4RHFA 4DBLE 4ZQGA 3TAUA 1ZJ5A 2CK3D 4J16C 5L3RA 3ZD7A 3LY9A 3QMPA 2P2GA 3BYZA 2Y1KA 4EKDA 3MF4A 1NRXA 4DDMA 4Q00A 4LF6B 1A82A 4RF2A 5JAZA 2FUKA 4DYVA 1QRRA 3G89A 1GPBA 4FGWA 4UAJA 4EI9A 3F6RA 3MTBA 3TLMA 1ODLA 2A1UA 1XZIA 2I7CA 4ZYXA 1Z7WA 5F33A 1MAWA 1NURA 2OK8A 1G17A 3EA5A 4NEQA 1FNMA 4BX8A 4C87A 2HV9A 2Z08A 5K0GA 1NZJA 1BSVA 2HSEA 1ONSA 1QMPA 1RKUA 3KQTA 1Y4DE 1P4AA 1UOQA 4RVOA 2WM3A 1QGUB 3W6PA 2YHAA 3N2GB 1IDN1 2OCXA 1C0IA 1VE3A 2PKWA 1G2QA 2R8ZA 3LF2A 1JQJC 3OCJA 1SURA 3Q6NA 4LHXA 3T35A 1GRVA 4X93A 4BLRA 4DNOA 4ZPJA 5AP9A 1AQYA 4WLVA 1H2BA 2F8TA 4K86A 3WLTA 1CVLA 1QH1B 2Q1TA 3R3WA 5E1OA 3L77A 3A70A 4C0SA 2OP0A 2XOKD 1NF3A 5IBQA 4BLWA 2HHAA 2QLMA 3AEKA 4HQ0A 1C0PA 4HQ6A 2O20A 3AR3A 4MUBA 5AK5A 5GAJA 3R6LA 1BXRA 1M7BA 5BWLA 2NXCA 3H9GA 5CFNA 3RVQA 4ZI7F 5BNIA 3TL6A 3VZPA 5E9AA 5HKLA 3FYUC 3ODGA 5D00A 2FYTA 2JLAA 4XJVA 5NLLA 1OJLA 4FMCF 1SVNA 4X41A 1YQEA 2WWIA 5C18A 1NZDA 3RGWS 4ALLA 2H65A 3WGVA 4BNVA 1P1FA 3KCQA 3TQRA 4P4NA 1N4DA 1YAHA 5LCXA 5BQPA 2C7OA 4I6EA 3T34A 1T2UA 2EL7A 1LI7A 3AF2A 5DJ5A 4DXAA 3I0ZA 3K53A 1QKKA 4HXEB 3DL0A 2VWQA 4YPOA 1Y3HA 3UQZA 1R5JA 3FNGA 4F96A 1TQDA 1CE8B 4WVFA 1NOJA 2AFIB 3NU1A 4B3TB 4POOA 5FLXA 1SO8A 2OGTA 3K0CA 4KQMA 1ESMA 2YXEA 3S6JA 4PEVA 3AUFA 1DEKA 3TI9A 2HJHA 4L95C 3M5WA 1DZIA 1KQ3A 2K4MA 3U7GA 3L05A 4V0RA 4LUCA 1VYHA 4WBNB 4Z4EA 1EVYA 2GPYA 3RASA 4D98A 1EA5A 1K97A 3THSA 4ID9A 1GRNA 1DC7A 3GJ7A 3WBKA 3CZ4A 3T9EA 3A1WA 4PCAA 4WOBA 3IP8A 4EY3A 5TSDA 4C08A 3OJWA 2FPPB 4WASA 4KOEC 3SFZA 3WLFA 4R71A 5D87A 1RQRA 3AIOA 2D2FA 1F9EA 5ESWA 1XAJA 3S40A 4AS3A 1FIUA 1JHPA 3S2ZA 4PHHA 2GO1A 1HE5A 3EVBA 5K03A 1R9MA 5CVEA 4EX7A 3JVVA 4DMFA 4NZYA 2D59A 1JFSA 2B0CA 1CBUA 4CM9D 4NMWA 3BK1A 3AHFA 2XB8A 4XOUA 1CUHA 2ZAMA 4FZVA 3W1WA 4FUTA 1PIWA 2FX2A 4OQMA 4MYUA 4NBRA 1QMGA 4U63A 2JLYA 2RGNC 4CM7A 1JQEA 4AZ3B 5BSFA 3T5GA 2BLLA 1U0TA 3O7MA 1GQQA 5JWOA 1XROA 1MB3A 1Q3TA 1UWVA 4Q3AA 2TRSB 4CDRA 5DYYA 2JGDB 2XBLA 4AP6A 2O8CA 3AUUA 1QS0A 1XX6A 4RVSA 4WY5A 1R0SA 1YR7A 2XMGA 1OB5A 3E53A 3BT7A 3M4NA 1N5KA 2WUFA 3SSNA 5ESXA 1T8SA 1UBRS 4FX2A 4NIMA 4DLZA 4F85A 2CD9A 1TW2A 5CXSA 3WSTA 1ZCBA 2R6GA 4EOGA 3RSOA 1OXVA 3ZQKA 2Z04A 4DT1A 4X24A 2GHQA 4I4TF 5IF9A 1BTOA 1USIA 4Q9LA 5DI3B 1NUUA 2QL5A 3GJ0A 4H08A 5DT9A 4HP8A 4YMHA 5JYEA 3UPTA 4TS1A 4HAIA 1VPVA 4LNAA 1P7CA 4KRXA 2EVWX 2BKLA 3I2JA 4Y6RA 2FCAA 3JASB 1FSGA 3QELB 4ID3A 5KKCA 2IL1A 2IU3A 2NU7A 3PRKE 4I50B 4ARZA 1RZRA 2HWYA 1LZKA 2YWFA 3EG9B 2EARA 1Q0QA 4MHSA 1XVAA 5IP5A 3OZXA 2XYHA 5JJKA 4UEWA 3LECA 4UUBA 1CQWA 1IAVA 4UVHA 3LFUA 1D3AA 3VDQA 1GDTA 1ZGAA 2YNMA 5C37A 2R84A 3DWGA 4S04A 2HRRA 2DMRA 3OZCA 3RYHA 1PFVA 3I39X 5TC4A 4BKPA 4LDQA 1NWCA 1RQLA 2XLCA 4OQLA 2H4HA 2A9PA 2FW9A 3R9IA 3NUQA 1KR5A 2FQXA 4I50A 4PV7A 3W0LB 3N2EA 4ALKA 2B8WA 1Z0SA 2ZJ7A 2ZBFA 3IIKA 5LZ2A 3FZEA 4M1SA 1MZVA 1SBHA 4NC9A 4RKFA 1GAJA 2CL6X 2DQKA 5C4IA 2DYKA 4B4OA 2F1RA 3KD3A 3SC2B 3IAS1 4FMCB 2E48A 4HH0A 2AMLA 2P65A 2WHQA 1UJ6A 3L9XA 2IEIA 3BFKA 3BMOA 3LKBA 4M0UA 1UXJA 2WJJA 3PE4A 2WKSA 5FHRA 3T1NA 3U48A 2FWMX 5L7WA 1U0JA 4FB4A 5BQ3A 2VT6A 1PX2A 5HKAA 3Q88A 4BTVA 4NK5A 2FWNA 2WLSA 5IN4A 1DMRA 1U0GA 3EGIA 4WLUA 2W2XA 3OPXA 3RU3A 2VQSA 2A9KA 4E5MA 5D84A 1AQJA 3CLKA 4COOA 3O47A 2XMCA 4YNBA 1F1BA 1I0LA 3A4LA 3T7DA 2P0YA 2Q3HA 4UM9B 3V1TC 1XVIA 4RHEA 2YIMA 4CLRA 4DCOA 1SXJD 3LNCA 1T5TA 2P11A 2FDRA 4XYBA 1TM4E 1XGKA 1NDQA 4YUXA 2OA0A 3TTXA 4D4MA 5JAMA 2HCJB 3QBJA 1ZUWA 3NNSA 1FX0A 4JL8A 5AJUA 1PR1A 1QWSA 3DVAB 3H16A 5CLLA 2HMUA 3VZDA 3H6KA 3AVXA 3X1WA 3CH7A 1NBOA 1T8UA 3QU5A 1EFVA 4ZYYA 3DA8A 2HSJA 3RBAA 2ENUA 4QATA 1A2BA 5FPPA 3WLKX 1LUAA 4OXNA 4PZEA 3RRFA 1RMQA 3IEUA 2QG4A 2J5BA 3QE9Y 3BMNB 2PX6A 2BDEA 2H06A 1XG5A 3A9WA 3JATB 2R7KA 5U4XA 2R6AA 4N6GA 1GTSA 3PEYA 3A06A 4GGOA 1YS2X 2EL9A 4H17A 5BMOA 2KI5A 1NHWA 4R8KA 3BGWA 5DE3A 3X3HA 2DG2A 3PUHA 4TMWA 1KMHA 3ROZA 5A3JA 5IKPA 4MV5A 3AKYA 1V11A 2JCXA 3FOFC 3JQBA 5CM2Z 3HNRA 5ALOA 4G0YA