2W2VA

Rac2 (g12v) in complex with gtpgs
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
177
structure length
171
Chain Sequence
MQAIKCVVVGDVAVGKTCLLISYTTNAFPIPTVFDNYSANVMVPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 171
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2vA00
1C9KA 3EIQA 1XTJA 4N0DA 1PUIA 1TQ6A 3BAFA 5TV2A 4C0KA 4US2R 4G5QA 3M0EA 2WJHA 3IIJA 4LX0A 1KY2A 3B60A 5DYGA 1PLLA 2PZFA 1XXHA 1E9EA 1YKSA 1JBKA 5E7JA 1T4GA 2FPMA 1JALA 2Q3HA 1FUKA 1NP6A 1Z2CA 1P9WA 2D2FA 1E9BA 2J0QA 4Q1CA 2EW1A 1KAGA 5HCNA 1WP9A 1E79A 3UK6A 1ZU5A 2H7VA 2A2ZA 1OPXA 1WCV1 1Q12A 3GFPA 2F3RA 4FCWA 3CNLA 1JXOA 2OLKA 4QGGA 1MO4A 3NEYA 3FTQA 1Q57A 1XRJA 5EE3A 4DLTA 5CDFE 2W58A 2N46A 3FMIA 1P73A 2OAP1 4B48A 821PA 1W46A 2NMVA 1DG1G 1IONA 1HT2E 2IYLD 1WQ1R 1Z5ZA 4C0AC 4Q4JB 3IEVA 3DOFA 4IEIA 3GLGE 4CEHB 4IVRA 1TQ2A 2R44A 2WJYA 5FPKA 3GJ7A 1AZSC 5AR1A 2W6JA 1E2EA 4LZZA 4RD1A 4WVFA 2DPXA 3TRFA 1BIFA 2RH5A 3TKLA 5FOTA 4V0ME 1S8FA 3A8TA 4V03A 4BUJA 2XOKA 2WSSA 3NDBB 4MYUA 1HA3A 2V6JA 1IN6A 2ONJA 3IEUA 4MYHA 4TMZA 2O52A 4Q19A 4XJXA 2YWFA 2VLIA 5KPJA 1W49A 1KI9A 2YHSA 1TF2A 4GMDA 4HB4A 2AKAB 3OIWA 1E2FA 4G5RA 1VMAA 4ZIRB 3AF2A 1LFDB 4LHZA 5H68A 1ZBDA 5CB6A 4TMWA 1M7GA 5KYKA 2R6FA 2VP6A 1W48A 1L4YA 3CNNA 1OB2A 2MMCA 1N5JA 2NO6A 1S96A 1SVMA 3QSYA 3Q5DA 1CP2A 2GXAA 2PBRA 4Q18A 2WICA 3FKQA 2ZJZA 4AWXA 1QVAA 2HJVA 3SJZA 2OT3B 1KDOA 2VO1A 2F55A 3GFOA 5CIWA 4DCUA 2O5VA 3THYB 4A0HA 4KSCA 2VSXA 3LBHA 1KOFA 1X86B 3VMFA 3T35A 2V8OA 4HAUA 4RCZA 2JLXA 4QGHA 3IIKA 1Z6AA 1DO0A 2C03A 3CLVA 5GJWC 2X1VA 3RS0A 1FTNA 3NXSA 3QJYA 1IOZA 3QQ5A 2XNSA 2GETA 4P33A 3K0SA 2Q0HA 4QRHA 4C3ZA 4MH0R 2IT1A 3AP3A 4KBFA 1P60A 4N3NA 4ZDWA 1HUQA 3QVVA 1GILA 3HYRA 4I1VA 1P2TA 2FV8A 3S1AA 3IQXA 3VNUA 4GL2A 3UXMA 3X1XA 4OL0A 2BHRA 3CZQA 4FMCB 4E5UA 5EP1A 4E22A 4O3MA 1ZNYA 1N6KA 4XVRA 1YR8A 4RFSA 1IN4A 3C14C 1DTSA 3VR3A 1YVDA 1DE0A 3U7HB 2QU8A 4BQSA 3AUYA 3AF3A 1G1MA 1RIFA 1T9HA 2FSHA 2JJ8A 1XMSA 1NVWQ 1R5OA 4NZYA 2GDJA 1GRRA 1A4RA 4OK3A 4FMDF 3Q3JB 5HKKA 3UANA 4YDSA 3LW7A 3MUFA 2FGKA 3ICQB 2A5JA 4YQFA 2AKYA 4WZAE 3R8CA 4C2UA 2JDID 5DISB 2HYDA 1ZP6A 1COWA 3P20A 2QGNA 3I72A 1NBMD 3KJIA 1LV7A 1A5TA 1OFTA 2XOKD 4NONA 4QG7A 3AVYA 3VHXA 1UADA 2ZU6A 1F2UA 1OXUA 3LLUA 3NBZC 3VTKA 1GL6A 5EJEA 721PA 3HDTA 2X19A 5IK2A 1T5IA 2E9SA 3QKRA 3THXB 3A1UA 1KYIA 4ASUD 5H70A 4N0EA 2QSYA 1AQYA 1ZM9A 5JHHB 2G0TA 5UKDA 4KCGA 4D0GA 1FW6A 1DOAA 1IN5A 1GKIA 1QHGA 4GOKA 3ADKA 2YOFA 2WHXA 3EARA 4YXWA 1MO3A 4UJ5A 2O8DA 1D6JA 1OXSC 4A8JC 2UZIR 1W0JA 1W5SA 3GEEA 5KSYA 1RVDA 2YKGA 2QORA 3CR7A 2B7CA 2RAPA 1JR3D 3B1ZA 2FG5A 5EZ6B 4BPBA 1XP8A 3C4JA 3B8HA 2WKQA 1J2JA 2VP5A 1JQJC 3C5HA 5JRJA 3FMFA 4Q7KA 1OH7A 2AWOA 4JLDA 2B8TA 1ZM7A 2GJSA 2EVWX 1XX6A 2R2AA 3I8SA 5AJZA 4QJ5A 5KSZA 1MABB 1XPRA 1X1SA 1YZQA 4XD7D 4Q9IA 1G4AE 2H8KA 2WOJA 3B85A 4TYPA 3IBGA 1P2SA 2IYZA 1E69A 3AV0B 4BEBA 2FFAA 1ANKA 1UFQA 2Z5FA 3LX5A 4LV5B 4B2PA 5L3QB 1H8HD 2EQBA 1TEVA 1F60A 1E0SA 2KBEA 2IHBA 4WXPA 3EZ9A 2PMKA 5JJLA 1COWD 2QENA 1A82A 3I73A 3CRMA 1L8QA 4TTPA 4URUR 1W36C 1SKYB 1ZM3A 4R2HA 2PT5A 3MD0A 1F2UB 3CX6A 3JZAA 4PHTA 1FZQA 3EC2A 4GNKA 4BZXA 5JECA 2KSQA 3K9LA 3EZ7A 1ZU4A 3THXA 1ZJ6A 2GCOB 2REOA 2G6BA 3BRWD 2GXUA 3DKPA 2GJAA 3SYKA 1X6VA 1QVRA 1ZNZA 2FOLA 2ZRMA 2CCGA 2CNWD 3P1JA 2G1JA 4ITRC 2ZI3A 3GLHB 1XEXB 1Z0JA 2XTZA 4AYXA 1GKYA 4F91B 1XCMA 2G77B 2HLDA 4V0KA 4BLSA 3G0HA 3CRRA 1YR6A 4KLZA 2VP0A 5LBIA 1XTIA 3JVVA 4RZXA 1U0JA 4D2IA 4W7SA 2FSIA 3PUZA 1S3GA 5DI9A 4ASUA 4MRVA 3GEHA 4ZIRA 3PEWA 5FOXA 3EPKA 1SVWA 4Q9JA 2DFTA 4EUNA 5DN6D 4P0TA 1YZTA 2WWWA 3AKDA 4LK2A 5KDDA 5P21A 2FZLA 3LDAA 2JATA 4G3XA 3GQBA 5JZVA 4HLUC 3AF0A 2EFGA 4MKGA 4FI3C 4JIMA 4IRUB 5FUVA 1OJLA 3UKDA 1Q44A 1T3HA 2DB3A 1ZM4A 2CJWA 2V6IA 4LBYA 1DAIA 1AKYA 1Q21A 2CVHA 3MGCA 2CHQA 2NO9A 4QHSA 1MR3F 1GOTA 4G5GA 3SU8A 4QBGB 5SZJA 3BBPA 1EK0A 2OFOA 5EP4A 3E1SA 3OEHA 1G3MA 1YE8A 2R6GA 3PFIA 1ESMA 3T1QA 2IW3A 1IAQA 4C0SA 4IOMA 4AYWA 2ODEA 2AWNA 1OIXA 3R7WA 1O87A 2F1IA 5A5GA 3VNVA 4PO8A 5SZIA 3BFXA 4BASA 2C9YA 4Q7MB 4B3XA 2P5SA 4XD7A 4RY2A 2ECKA 3PV0A 3D31A 4PC1A 4S2EA 5L8VA 4IOLA 1F48A 3MFYA 4Q1FA 3GMTA 3OE7D 1TUEA 3KQKA 2GKSA 2ZI4A 3QBTA 1DO2A 2QT0A 3PEYA 4WW0A 4Y0VA 1BYUA 2RGDA 3SE0A 1ELOA 5DO9A 3SYLA 4I99A 1YZKA 4LC0A 5CJ2A 3ZZ0A 5B58C 5JEEA 3L0SA 1KO1A 1B23P 1DVRA 3N2IA 3L43A 3IPYA 4RFSB 4S35A 4OQMA 2RHDA 2R9VA 1RW4A 2BBOA 2J7PA 3FWYA 3WHKA 5C4MA 4TYWA 1G8PA 2HYIC 4Y0AA 1BOFA 2NZJA 1VCNA 1W0KA 5TDHA 2CE7A 2WMNB 1QRAA 5TARA 1UBEA 2QAGC 1E6CA 3PIRA 2O0HA 3DM9B 1E96A 1AIPA 5F9HA 3M1IA 2VRWA 1FUUA 5L3RA 1X8LA 5J40A 5GJCA 1KI4A 3GFTA 4G5OA 2X8AA 5K8TA 1E79D 1VCIA 4EJSA 1TU4A 5KHOC 1RC8A 1AN0A 3KKOA 4O2LA 3QXXA 4TQUS 1U2RA 5J4VA 3I32A 2A9KA 2ZVQX 5ELXA 4I81A 2ATXA 4DCSA 2ZRLA 1ZM2A 4EQ6B 4ZDKA 2VP4A 3QKRB 1P6XA 4LPSA 1TUIA 1N3BA 2FX3A 121PA 3CNOA 1IN8A 1SXJE 4Q1AA 1KSJA 2Z4RA 3CF0A 3TAUA 3BB1A 1E1QA 2FWRA 2BMJA 1TPZA 4CF7A 5G3ZA 3RS3A 4TT3A 2RGXA 4C0QC 2ZYWX 4JLOA 2QZ4A 3QKSB 1DADA 2UKDA 1HURA 1FP6A 2BVNA 2AFHE 1QG2A 4QJ3A 4PHHA 4LBWA 2JAQA 5KDLA 3SC3A 4EPYA 1W47A 5JI2E 1N0WA 1TL7C 4TTRA 1KDTA 2IEYA 4Q4LA 3ADBA 4NP6A 3OAAD 3U7EB 4JSTA 4M4SA 1UKZA 2N42A 4TLBA 3C16C 2XSZD 2VH5R 3ZGXA 3T61A 5H8WA 2D3WA 2ZRKA 4JL5A 3U3JA 4CIDA 1AJEA 4QNMA 3AUXA 4Q7LA 5CK4A 1R0WA 5EP3A 1TF7A 1NG1A 4J0QA 3GCGA 4MKFA 4AK9A 2GBLA 5LB4A 4NTZA 3AB3A 5FBVB 2ZJ8A 4JZKA 1SVIA 2G9NA 3ND8A 4HAYA 1Q1EA 4GOJA 4OHVA 1HV8A 2FEMA 3RSOA 3K0FB 3RS5A 3TNFA 4BECA 3VKHA 1XTKA 2FNAA 2W6IA 4LJ6A 3TK1A 1W4BA 1N0VC 1P2UA 3FMPB 1Q3HA 1VECA 2WOOA 1Q1BA 2ODNA 2FA9A 4JVSB 1G64A 2ZSEA 4NU0A 3THOA 4CEHA 2J7KA 1G41A 1G9XA 2JCSA 2ZEJA 3H0KA 4JT2A 3W6PA 2IYWA 1WF3A 2YZ2A 3RWOA 4IKEA 2PLFA 1YQTA 2HT1A 4EFMA 4A6XA 2A7QA 3I5XA 1W0KD 1T6NA 1D5CA 1IXSB 4GP7A 2Q3MA 1G19A 4V02A 4DLYA 3QIAA 3P32A 4LJ8A 2IUSA 1VDZA 2F1RA 1OHHA 4DLUA 1QHYA 3GP8A 2UZ3A 5D3QA 4A0FA 1KI7A 5BN4A 5CITA 3NKVA 4OBEA 3KKQA 1W4CA 2QN6A 3DDCA 2C99A 2QTHA 4A15A 2NPIA 2RGNA 2BM1A 1KJYA 1U98A 2G3YA 2JJ2D 2NG1A 2BJVA 3BWDD 3GEIA 3HPRA 1BKDR 4Q4AB 3U44B 3WRYC 5K8LA 3B7GA 2VL7A 3VR1A 1E2QA 3B82A 1F3OA 1QHSA 4NKRA 5L3SA 4KFUA 4B3DA 4B73A 4DBLC 1ZD8A 1VHTA 2BEJA 4TTQA 3X1DA 4DSUA 2GEVA 3DZ8A 2WAYA 1CJKC 4A8JB 1W7AA 1TAGA 1IY1A 3K70D 2DWQA 1EX6A 2ZRIA 3GJ0A 4A36A 4FXPA 2ZIAA 4PSAA 4BLOA 1X8KA 3L2OB 4XVQA 2CXXA 221PA 3KX2A 3UIEA 3WYFA 4A6PA 1G4UR 1CS4C 2HCJB 2MSCB 2W0MA 3MLEA 4JMPA 3K0FA 2D06A 4UNRA 1N25A 2N1BA 4KHZA 2QBYB 2LKDA 2V7QD 3ZIAA 1XXHB 2G88A 3MSXA 2PCJA 1WA5A 1FP7A 1YZUA 3K0CA 4U00A 3P27A 4IOJA 4IOKA 3UG6A 2QE7D 4W5HA 5FL7D 4B6EA 4FCVA 1MO5A 3DHWC 5JS7A 4E03A 5KPDA 3X1ZA 2ZJYA 4Q9HA 3DMDA 3K9GA 2XTMA 4M1SA 1BH2A 2OSBA 2VA8A 4NDZA 1XNJA 1RRCA 1DAFA 1E2HA 2BEKA 2PEYA 2IA5A 2ATVA 2OCPA 4H1VA 2IXFA 4JLNA 3U61B 1XZPA 1WMSA 1GITA 1NMZA 1RRPA 4CT4B 4KV9A 1EFRA 3T15A 2VHCA 2WV9A 1ZRHA 4Q48A 4NYMQ 2HXSA 2OUKA 2YVUA 4KITB 1E9CA 3V9PA 1U8AA 3AVTA 1G7TA 4KFRA 1EESA 3K9HA 2J0VA 2JLYA 2IWHA 5M04A 3RLFA 2AXPA 1RZ3A 2ZJBA 2RCNA 2XB2A 4AY2A 1WDTA 4Z1MD 1SXJD 2ZJOA 3Q7QA 2PEZA 2ZUBA 2OCAA 4M2LA 2J5XA 4KFSA 3RS2A 4YC7A 1Q0UA 1SKYE 1WBDA 4JL8A 4BGDA 2QSZA 1NIPA 5E95A 2ZSAA 4OHXA 2P2LA 4V0OA 1H8ED 1QZXA 3AKYA 3NC0C 1G7SA 5FTNA 2YYZA 2OM2A 3WBJA 3P26A 4HB3A 3AVOA 4OI4A 5JEDA 2QTVB 5JSZB 1NLYA 5DIFA 1R0ZA 4CT5A 1GL9B 4MUBA 2VSOA 4L15A 2DBYA 2J45A 4Q21A 2CLCX 1VG8A 2OAQ1 1VPLA 2ZYTX 3LW8A 1KI6A 3LAWA 4LOAA 3KL4A 4KU4A 1M7HA 1JPNA 2ZPTX 4ZO4A 4ZI2A 5FUYA 4TZ0A 5CIQA 2ANCA 4O25A 2YWGA 4HI0E 4I1SA 5IF9A 2C8VA 3U4QA 3FVQA 1RJ9A 3EAQA 2WAXA 1E2IA 4UXIA 2OCBA 3I8XA 1M74A 2H17A 1YR9A 3OEED 5FL7A 1E2LA 3NC1C 3WMFA 4G0NA 2C04A 2J41A 4B47A 2FSFA 2WM9B 5F2EA 1LB1B 3NIBA 3UG7A 3RVBA 2VF8A 2CL0X 1YU9A 4I4LA 4YMWA 1NLZA 4B3FX 4DCTA 3L0PA 1H8HA 1OV4A 5LPNA 3LWNA 3E2IA 4UNNA 4QGAA 1Z2AA 1NL3A 5BYKA 3L0IB 3ZS8A 3N5CA 1FFHA 1E1RA 4F4IA 1XJ0A 1EFUA 2R8RA 1OXVA 2V3CC 3PXGA 3I4LA 4ZKEA 4NYMR 3NBYC 3FGNA 5JCZA 1RE0A 4C0HA 4M1OA 3TLXA 3K70B 1AS3A 5JCPA 4DRZA 1R5NA 4BRUA 4ERNA 1OFHA 2IYUA 2OILA 4PC2A 2FEOA 4BEJA 2JLVA 5G3YA 4A2QA 1YJ5A 4HYYA 3FMOB 4R98A 2QAJA 3CH4B 2F43A 4B3CA 5FBLB 3AVPA 4LBZA 5FBWB 2I1QA 2PX3A 3KFVA 5JS8A 3A4LA 3QBVA 2R6CA 2FFHA 3L8YA 1L4UA 2NTYC 3K0AA 1KK1A 2GTPA 3FPAA 3VR4A 1FX0B 1F2TA 3TUIC 4ZDJA 3TSZA 4MGYR 3C15C 1E9AA 3VFDA 3GLGB 1T8UA 3W6OA 1LNZA 2IF0A 3SJCA 3WYAA 1FPMA 2ZR9A 4CVNA 3WNDA 2IEZA 5CYOA 1I2MA 3GJ8A 1D8TA 5F3WB 3NWJA 1Z6GA 3MWYW 3W3AA 5LD2C 1SZPA 2PJRA 2NO1A 1XB2A 3FFAA 1AQUA 3RWMB 4A92A 3U4QB 4TWZA 4YONB 4B3BA 1J8MF 2QGZA 4TYYA 5TXGA 2ZE5A 2ZRHA 2O8BB 1NIJA 2BM0A 5CDFA 1Z0DA 2VEDA 4KO8A 2GZHA 5FOSA 1SVOA 5EUMA 2XGJA 1Q3TA 3ZZUA 5G53C 3OZXA 3TGPA 4P31A 1DBSA 1XPOA 3QF7A 1UAAA 1XD9A 1QHHA 3A1SA 1Q1QA 1PZNA 2RMKA 4PFSA 4US1R 2H16A 1DAEA 3BE4A 3IILA 2GA8A 2KWIA 3TIFA 2LKCA 1NBME 4AKIA 3RANA 2KI5A 1FTSA 4OQLA 1TTTA 2ZS9A 4TMXA 2ZAOA 1ZCAA 5FBRB 1R0XA 5HCIA 2I3BA 2H18A 2VHQA 2A78A 1G8HA 4A2WA 1XTSA 4DIEA 2ERYA 3C8UA 2HJGA 3LH5A 4DLZA 4XWKA 3DPUA 1E1RD 1D2NA 4GDFA 4RFVA 3EZ6A 4C9BA 1OIWA 2ZS7A 1MABA 2CBZA 2D74A 2IUUA 4BRWA 3GJ4A 1ZD9A 2CLDX 2ZE8A 1E32A 1N6LA 2F9MA 1GNRA 4PZLA 5FPHA 4Q00A 3QF4A 4RD4A 4NCNA 4URVR 2OZEA 1BYIA 2RGGA 3C5CA 4Q5IA 2J0SA 2QTFA 5EZ5A 3KJHA 3B9PA 1KKLA 2RGEA 4LJ5A 5EE0A 1N6NA 2ZU0C 1U9IA 4G5SA 3B6EA 5L3VA 4F4JA 1E0KA 1CR1A 3U60B 1OT3A 3KXLA 3RC3A 2IYQA 2QP9X 4ESVA 4JT4A 3RRZA 2ZR7A 3Q72A 2IXEA 2VSFA 1WRBA 1JPJA 3ZJYA 1Z0KA 3CRW1 1YRAA 1LY1A 2GCNA 3EASA 3AF4A 4TSFA 5KO2A 2PZEA 1XEWY 3I62A 2EFCB 2GVDC 3A36A 1DPFA 5LD2B 4M9ZA 5KU1A 2WIAA 4B74A 4OHZA 3TW8B 2FDCA 1AGRA 3FYHA 2X2EA 4ZCMA 2FMXA 1Q20A 4TYQA 4QM7A 4XVUA 4TT3D 1BMFA 2W83A 3HP1A 3LBNA 3MWKA 1QHNA 4D4LA 3NHAA 1IJFA 2SHKA 1G5TA 2W6ID 3THYA 1Z6YA 1GVNB 4JYBA 3V00A 3EIEA 1JB1A 3NH6A 1G3RA 3QI2A 4GPTA 2QPOA 4MRSA 5EE1A 2FJUA 1B0UA 2NZ8A 4KFTA 5CYPA 3ZVRA 3ZD6A 1AZTA 1D2EA 1G5RA 2BOVA 2HUPA 4XOIA 5FFMA 4QXAA 4PANA 4NBSA 3ICEA 4JVLA 2CHVA 2R6DA 1KNQA 1UF9A 2JLWA 2AHOA 2A5GA 2B21A 4JLJA 4PZZA 3EX7C 3LD9A 3VU9B 1R10A 3W90A 1E2NA 4EKDA 5HKKD 1Q1ZA 4I1OA 4PX9A 5JWRA 2WKPA 4YMTA 2OG2A 3PUYA 1VYTA 4KVAA 4PPNA 4US0R 4EFNA 1X3SA 4TLAA 1DAHA 3CPHA 4ARZA 3QENA 3PENA 1P9RA 1R6BX 4BLRA 3N70A 4M1MA 5A0FA 1IN7A 3Q7PA 2ZRPA 2JIZD 3VQTA 2P65A 4QL3A 1W4RA 2DFKB 1I4DD 1UKYA 3SBDA 3R8FA 1IHUA 2JLZA 4Q01A 5HE9A 3G5UA 4RJLA 3BFVA 1P4SA 4GFDA 3RNLA 4NPHA 4XSGA 3MRSA 5AJYA 2E87A 4R2IA 3TSWA 2D7DA 5CK5A 2A30A 1S1MA 2QAGA 2OXRA 1US8A 2MSDB 2W2XA 1N0UA 4AKGA 3IUYA 5KTYA 2C77A 1A2BA 3RC8A 1JJVA 3AVXA 3I1FA 2FFQA 4OHWA 1JAIA 3VHLB 4LC1A 4P32A 4HDOB 5EE9A 2ZAMA 1TNDA 5EXXA 2OO7A 2WJJA 1W0JD 4EAQA 2FFBA 1CKEA 3WHLA 1NNEA 3T06B 2FE4A 2V55B 3HU2A 1S1CA 2B8WA 4TLCA 2WMOB 1K6MA 1GNQA 3KUDA 2V1XA 5GJBA 4M53A 3TH5A 4BFVA 2BKUA 1TQDA 2XZOA 4MYTA 1TX4B 2QE7A 5JBQA 4TL7A 5EXPA 4PQRA 4JLAA 1PUJA 2QM7A 4JLBA 5J4YA 2QP4A 3A1WA 4X8LA 3UMRA 3VR6A 4DCVA 3B1WA 2GAAA 4E09A 2QP3A 1NLFA 1ZC4A 1EWRA 3QOFA 3M4YA 4GZLA 4OQFA 3RRYA 4LHWA 4BLPA 5DI3A 1ODFA 2D7CA 4LPKA 4B6FA 3E70C 2V7QA 2O8EB 3THWB 4PQFA 4DWJA 4FMCF 3TSOA 2ZR0A 4Q1BA 1N6HA 1OW3B 1EWQA 1VCMA 3U7FB 2WPDD 3BH6A 5KNDA 2W6JD 3TVDA 1OF1A 3ZS9A 3BD9A 1A1VA 1II0A 3P4YA 5DE3A 1QBKC 2J46A 2PZGA 3B13B 5HR5A 4IFEA 4EJSC 1X1RA 4QGFA 2XXAA 3MMPA 2NPFA 3A1TA 5KNBA 2V9PA 2AN9A 1NMYA 3Q5EA 3T5DA 3U3KA 1VG0B 4HAZA 4OK5A 4FMBB 5D3MA 3WNBA 1KK2A 2JASA 2Q21A 2CNWA 4AC9A 2W2TA 2PT7A 2QAGB 1US8B 1CR0A 1II9A 2B7BA 3S1AB 3BK7A 4TN1A 2QQ0A 4D4MA 2DYKA 3GJXC 4JLMA 3I5YA 3QNUA 2Z4SA 1E2MA 4OQXA 4LDJA 1J8YF 1ZIPA 2ONKA 3BIFA 4FMDB 5TY0A 4AKEA 3N2EA 1XD8A 1PVOA 3NH9A 3SOPA 3PUVA 3WRXC 1UBGA 3BERA 1N6OA 1VCOA 1IM2A 4D25A 3PEVA 4PR0A 3ADDA 1PJRA 4JJZA 3R9WA 4AYTA 4ACBA 2OESA 4FWIB 5BW8A 1SULA 1VTKA 4NMMA 1R4AA 5IT5A 2EWWA 1KO5A 1F5NA 1S9HA 2ZI5A 5FBQB 4P4TA 3OAAA 3CM0A 1U81A 2XX3A 4BFUA 4PAMA 3OF5A 4LHXA 2ZQ5A 3U3OA 1FMLA 1NKTA 5B57C 2XJ9A 1Z0IA 2ORIA 4LWZA 4RD3A 5DSZA 4URZR 3I3SR 5DI3B 2RB4A 1XU4A 4II7A 1AA9A 1JR3E 5JWOA 2QY9A 5K8UA 1FNNA 1XMJA 4X8MA 421PA 3AEZA 4UNSA 4XTCS 4HB0A 2F6RA 5FL3A 4GI7A 3FDIA 3DM5A 4JS0A 2F3TA 4FN5A 1KZ7B 4AG5A 3OIVA 1E2PA 3W9YA 3NDPA 1G6HA 2QG6A 2GHIA 2MMGA 2AR7A 1EGAA 1U0LA 3PUXA 2ZROA 4TMVA 2GXQA 2JDIA 3PVSA 4IW3B 3RSLA 3W3ZB 2C96A 1YZLA 4Q1DA 4WOPA 4L5BA 4CEIB 3D6TB 3EPHA 4TLEA 3GJ5A 2P67A 3AP2A 5IK2D 3PCRB 1JEEA 4F4CA 4EDHA 3SQWA 4M22A 4GBMA 5LDDC 3LRPA 2ZJ5A 1QDEA 5FR2A 2GRJA 2J87A 2WWFA 1J90A 1SXJB 2P6RA 3J81k 3W6NA 2CLSA 3CBQA 5DYIA 1AGPA 2JLSA 3AF1A 4IDNA 4BLTA 5H1YA 1A7JA 4KBGA 4I1UA 4GOXA 5CJPA 5B2ZA 1E94E 2UVQA 4M9XA 3IPXA 1UPTA 1II8A 2PMDA 3B1YA 4K8OA 1NN3A 2IK8A 2RKOA 2GJ8A 4KJZA 5DHFA 5AUPB 3WBKA 3QEJA 2OBMA 3LQQA 1JQLB 2IUTA 1RFLA 1CXZA 1J7KA 5B30A 4R71A 3A1VA 2ZI7A 5EE5B 4LRWA 4ZV4A 2BDTA 3KJGA 1ZW6A 1KJWA 2QNRA 1T0JB 3WP1B 3NBXX 1M6NA 3L82B 4QFMA 4JSYA 4V0NA 2V4ZA 1JXMA 3E5HA 4O0MA 5DHAA 2IYYA 4DLVA 2H92A 3PG5A 4KODA 4X8HA 4DUGD 1NJGA 2AD5A 2BBWA 4HDCA 5EXTA 1XD2A 1E2GA 3ZLJA 4Q03A 4DLWA 3BXZA 1W36D 3KB2A 5ANRB 1NF3A 1JI0A 5E4FA 4U5XA 3VAAA 2OEPA 2ZRNA 2FSGA 5E7MA 1W1WA 3ADCA 2OBLA 4M0LA 4TQ9A 1KSFX 4BFWA 2YOHA 1U90A 1NG9A 4DLRA 4LCBA 4QBHA 1CJMA 1PLJA 3L8ZA 1E9DA 2QA5A 4XIGS 5DN6A 5BWMA 1W4AA 3OFND 3H2YA 4UXHA 2O8BA 5AUQA 1R2QA 2HLDD 3CX8A 4NCJA 3TR0A 1QHIA 1CULC 4IFBA 1OYWA 5EXSA 2GK6A 1KTVA 2BC9A 4EPTA 3BGWA 1VKJA 3QKSA 4OJKA 4LJ4A 1SXJC 5KUTA 4K81B 3HJNA 2R6AA 3L0OA 4DB4A 2A5DA 3FHTA 4P4SA 4AD8A 4B75A 4TLDA 3X1WA 2DCUA 3VX4A 1OKKA 4Q4HB 3RS4A 1HYQA 2CVFA 4TSFD 2I4IA 2IX3A 1T8TA 3R7WB 1OH6A 2OLJA 5FOWA 4PPQA 1KMHB 1KI8A 3FFBA 4L9WA 1WXQA 1FQJA 2P3SA 4Q4AA 3U44A 4LBVA 1Z07A 2DY1A 2EWVA 2WSSD 1GZSA 1KDPA 3WXMA 1VYUA 2P0EA 1SQ5A 1W5TA 3TQCA 3K0EA 1RYHA 3AGPA 4A1FA 4HAXA 2W00A 2AK3A 3MAAC 1Z28A 4IJMA 4B71A 1DG3A 3LXRA 1S4QA 2ZVPX 3NBFA 3UWKA 1E2KA 1Q22A 3F8TA 4LYFA 3RRMA 3AVVA 1IXZA 1T91A 5F98A 1LW7A 2ASEA 3W5IA 5F9FA 3ZQJA 3DMNA 2QI9C 4CEJA 4DEYA 1XXHE 4IXNA 4PC7A 1EFCA 2R62A 3MJHA 5K8IA 2HV8A 1SVLA 1MT0A 2YWHA 3QEOA 3D8BA 5DLQC 2REXB 3QG1A 2EU8A 4IHQA 2AL7A 3HR7A 3T5GA 1DS6A 3ZIAD 1XJQA 1VG1A 5HZKA 5FTKA 5CLQA 1AKEA 3U3RA 3T12A 3OE7A 4EPXA 2IYTA 4K46A 1OKKD 4NHOA 3IO3A 5FI1B 3W8NA 2CCKA 2J0UA 4MDEA 1EFTA 2C2HA 2RGCA 4QNRA 3W34A 4LV8B 4M21A 1ONBA 1VIYA 3IIMA 4EQ6A 2K5UA 3K09A 2QMEA 3CRQA 4LSGA 4FIDA 3M6AA 1EXMA 1MOZA 2IL1A 1NI3A 2AK2A 3KXKA 2VBCA 4FW9A 2NO7A 5AWFC 5L3SB 1XMIA 2IF2A 3LBIA 4C7OB 3KFXA 1UM8A 2PLRA 1U0HC 4G01B 4D6PA 4JBXA 4LHVA 4IDQA 3LY5A 4A8JA 1U8ZA 4Q66C 4B3GA 2BMFA 1R7RA 1E1QD 2Z83A 2C9CA 1ZNXA 1CU1A 5A4JA 2WTUA 4WXRA 4U7DA 1LF0A 2O8CA 2WJGA 1HE8B 4Z1MA 2IHYA 2VP2A 4G1UC 4F38A 1ZC3A 2IS6A 1W36B 2NIPA 4ZCIA 3RRNA 3CH5A 4CZ2A 4DT1A 3BB3A 2XZLA 1W2HA 1C4OA 3T34A 1F6BA 1AM4D 3EC1A 3FB4A 1GFIA 5KOYA 5TB5A 1KJZA 4PSVA 3SHFA 2GCPA 3CO5A 3EIHA 3SJBA 1GAJA 1QHXA 2IXGA 3KTAA 2QT1A 3NEJA 5FH9A 1DAMA 2EFDB 4P3YA 2B92A 3QVUA 2E1RA 4DDWA 4PO9A 1KI6B 2D2EA 5G41A 1XCGB 1OLOA 2QPTA 2HDNB 3JVUA 1II8B 3GLIE 2ZI9A 3TQFA 3LFUA 5J4HA 3WP0A 5G40A 1CLUA 1CJTC 1HH4A 1RRGA 1XEXA 1KO7A 1CTQA 2BMDA 2JJ1D 4PAOA 1G5PA 2ANBA 4TL8A 4TQAA 2IYXA 4PXAA 1R8SA 3X1YA 1V5WA 1NSFA 4JVNA 4EPRA 1NBMA 2ERXA 2PH1A 4LUCA 4BZPA 1XEWX 2ZI6A 4DSTA 2Z43A 1VIAA 1H65A 2YOGA 2EFEB 3CF6R 4C0LA 2FGJA 4JKIA 2O0KA 4MYCA 2J1LA 3KUCA 3V4RA 4HEJA 2ZTSA 1Y3AA 1KMQA 1NJFA 2ZE6A 4XH9B 1P5ZB 1DARA 4A82A 3HPQA 3QPUA 2Q9CA 2PX0A 4HZUB 4CGZA 5DGXA 3GJ3A 2RGNC 1KHTA 3D7MA 1UBFA 1G21E 1E98A 2I1VB 2KB0A 4F93B 3GLFB 2FF7A 4OJQA 5CB8A 4D82A 2GF0A 2F9LA 3W8RA 2YWEA 5CM8B 2DR3A 4NYJR 3SFZA 2BKEA 4TMTA 3SJAA 1C1YA 1OSNA 1AS2A 4C0BA 1XWIA 3B2EA 4B43A 1ZINA 2C5LA 3Q9LA 2HF9A 3SBEA 2WWHA 5J4LA 1E9SA 2Y8EA 4JJKA 1KZGB 3PUWA 4LHYA 2FU5C 3CWQA 5FPSA 4IDHA 2OV2A 3AP1A 4DJTA 4MRNA 4DVGA 3ZVNA 1XJCA 1Z08A 3Q8XB 3GLGA 3F5FA 4FINA 3QY0A 4FWTA 3TW4A 1U9IC 1OHHD 3QE0A 3LLMA 3O8CA 4P4SB 1LF5A 2QRNA 4Z8YA 5JWHA 4WZBE 4L9SA 4KYUA 1XTQA 1J70A 2ZRFA 5GVSA 4JBYA 2BCGY 2QBYA 4GRAA 4LJ9A 3BC1A 1OXTA 1G3IA 2ZITA 4HZIA 1KSGA 2GF9A 2ZREA 5FUWA 3TMKA 3TVTA 1TQ4A 5BN5A 2IYRA 521PA 4MRRA 1SVKA 4IDOA 1LVGA 1XBTA 3T1TA 3CONA 2VHUA 3CPEA 1OH5A 3QKTA 1KDRA 1QHHB 5C1BA 1NMXA 4URYR 1JECA 4RCYA 3VKWA 4DC9A 4N1AA 5C2JB 1Z22A 1FOEB 1JJ7A 2JJ1A 4DEXA 3IGFA 3KQHA 1O3YA 4Z51A 3BH7A 2O8FB 2GAOA 1UEIA 3C41J 4LY6A 2QMUA 1XEFA 4Q9LA 2ZSBA 4NYIQ 4C2TA 3GLFA 4B2LA 4JYCA 4GSYA 2ZSDA 2ZYVX 2C78A 2XZPA 4C30A 5SZKB 4BFSA 3CZPA 3IBYA 1T0HB 1GP2A 1AS0A 4M9QA 3KJEA 3QPWA 2Z6VA 1KK0A 2FPLA 4EIWA 4HUTA 5KSPA 1PLKA 1CR2A 2AFIE 3MG9A 1LS1A 1YZNA 2CDNA 4RD2A 5E3HA 4MUAA 2Q9BA 3BJIC 2XITA 1P9NA 1D2MA 3KB1A 4DCNA 1JR6A 4KLNA 2IS1A 1ETUA 1S0UA 2WSMA 3MCAA 2GJKA 3PJRA 2ZRGA 4CEIA 4M1TA 3TJZA 2WWYA 2GWHA 4KAXA 4OI1A 3LVRE 4PSKA 1GG2A 4HLDA 1X8JA 2HEIA 4TL6A 4JLVA 4ZCLA 4TYNA 2YC4C 2VHJA 4B32A 5GVRA 2IWRA 1DAKA 4DUGA 1RJ9B 3F0TA 4HAWA 1OFUX 2ZYUX 3F3YA 4JVMA 1E2JA 1DEKA 4LYHA 3SYNA 2NQ2C 2REBA 4ACAA 3ZVLA 2WKRA 1BMFD 3CKLA 3K0CC 4PHGA 5HPYB 2LCFA 2CJWB 2X77A 1ZUIA 4TZ6A 3QXSA 1E4VA 1GIAA 4BWYA 4XWAA 1N5IA 4IDPA 2GESA 5CLLA 5HTKA 3RHFA 3IHLA 3I61A 1HT1E 4HDQB 3EA0A 3DKVA 1XMVA 4U02A 5EQTA 3BS4A 2ODBA 4L4UA 5BXQC 2J9RA 2P5TB 2PL3A 2B6HA 3LVQE 4GT1A 4OKSA 2WJVA 5FUXA 5IDVA 4D4JA 1NSTA 2L0XA 3KTAB 4HSEA 4ILEA 3T1OA 2GZDA 1YHNA 4R7ZA 4LYJA 4FCTA 1W44A 3A37A 3K1JA 3CF2A 4DDVA 5AK0A 4YXWD 1Z63A 1IY0A 5FPYA 1QF9A 3KKMA 3REGA 3KQLA 4UXJA 1JEDA 2BIFA 4CW7A 5FOUA 4Z54A 1UEJA 4A2PA 4JLKA 5HE8A 5L3QA 1L7VC 1RYFA 2D62A 3DO6A 4PHFA 4UJ3A 3A4NA 3FKSA 4DHEA 5JI3E 5JRZA 3DVLA 2GEDA 4MA4A 1YR7A 1EG7A 4MRPA 4HAVA 3VX3A 3R9XA 4NCIA 3PITA 4AI6A 3BH0A 5SZHB 2XTNA 4BFYA 4HUQB 4L16A 1M2OB 1I4TD 4RZUA 3TBKA 3VR2A 4ZDIA 2HT6A 4POAA 2XAUA 2GCOA 1CJUC 3ASZA 4M1YA 2EYQA 2ZETA 4KSBA 4PTLA 1KK3A 4PAQA 1P61B 2QUZA 1SKQA 3LO5A 1NVVR 1G6OA 2XSZA 3GJ6A 4B44A 1CEEA 2DWOA 5KNCA 1ZD1A 3RYTC 1NKSA 1OE0A 1MRNA 4QOSA 3U2QA 1HE1C 2CCJA 1XF9A 1NY5A 2PJZA 2CE2X 2G83A 3JZMA 1N6PA 3LXXA 3O8DA 4MKIA 2P6UA 5AJWA 2XNDA 1PV4A 2RGBA 1MO6A 2XEXA 1GDDA 2WBLC 5HZHA 1G8GA 1L2TA 4QHYA 1KO4A 3IKJA 3BOSA 3R9IA 3SHWA 6Q21A 2Q6TA 3ZYCA 3DZDA 5JSZA 3CW2A 1G7CA 3EA5A 2QM8A 4YMUA 1KKMA 1P2VA 3OIUA 4BZQA 1OFIA 3QXCA 4URXR 1KSHA 2C98A 1RRFA 2IYSA 3TAHA 3ZD7A 2KBFA 1E3MA 1HQYE 1Z0AA 4OQNA 4WZ6A 1K5GA 1NY6A 2VQSA 4M9SA 3QF4B 5KDOA 1KI1A 1G18A 4TL9A 1M1YE 1G8FA 1T5LA 3NHBA 3SDZA 3QXJA 4MKHA 1TEXA 3GLHA 3FKSD 4LV6A 2Z0MA 1GSIA 2BBTA 2D4HA 5KSOA 3RDPA 4NE2A 8OHMA 1KGDA 2CL7X 4MITA 2H5EA 3QPVA 4UKDA 3A4MA 2RHMA 3PR1A 2HF8A 3H4MA 2WPDA 2BWJA 3RS7A 3WYGA 4LI0A 5AJXA 3WY9A 2H1LA 2YJTD 2KE5A 1Y63A 1G7RA 4UNQA 1SHKA 1U99A 2PCLA 2Q3FA 1OH8A 1Z0FA 3HYTA 2ZANA 2EFHB 3IO5A 4Q4JA 4ZI3A 5BN3A 1TU3A 2WWGA 5JFGA 3KXIA 1HTWA 4A9AA 1CJVC 4B33A 3K09C 3EZFA 2CL6X 4HLCA 3GLIB 2GVZC 2ZRBA 4M1WA 1G20E 2JLRA 4D26A 4RD6A 1R8QA 4PPGA 3BORA 5FI0B 3CIOA 1Z47A 1CF4A 4UNPA 2CEAA 3UATA 3THWA 4MGIR 4YLGA 1GM5A 3LQRA 2JLUA 2YNMA 2QEQA 1KNXA 2OFWA 2FZ4A 2YV5A 4XSHA 4H9GA 1XZQA 2QMOA 4LYAA 3LX8A 1R0YA 2VIIA 3OIYA 2C95A 2JEOA 1M7BA 3ZH9B 5FTJA 4V0LA 1N6IA 4FD2A 1DELA 3EWAA 2QQEA 1P72A 2O8CB 1QG4A 3EZ2A 4PQYA 3PEUA 1G3UA 2J7PD 5D3MB 3GD7A 5TVKA 2F7SA 4Q02A 3B78A 4OI2A 1P75A 1ZCBA 2LWIA 4ESHA 4BE7B 2EYUA 5JJIA 4DZZA 5J5CA 3K70C 4B34A 2BMEA 1CBUA 2CHGA 4QM6A 2WWXA 5J47A 2OHFA 1Z6XA 3REFA 1VG9B 3PQCA 2BV3A 2J59A 3B5JA 4QHTA 621PA 4F7WA 2NGRA 1GRNA 2JJ2A 2ZSFA 5DNYB 4C4PA 1GRQA 2ZRDA 4KI0A 4ZPXA 3DL0A 5C4GB 3C7KA 5AUOB 2FPKA 4M8NE 2VPPA 1EX7A 4EFLA 3ZZTA 3ONWA 5C46F 5IHPA 2WIBA 4DXAA 5JHGB 3MJRA 4GMXA 4CYMA 4KYIB 4P4UA 1EFRD 2JLQA 3ZQ6A 3R20A 4XTRA 4GZMA 4BFTA 4JKYA 2DWPA 3EPJA 3CWZA 4GP6A 3H1TA 5EUQB 4F92B 1E0AA 1S2MA 1UJ2A 1Z3IX 4BFXA 1SXJA 3SNHA 2QROA 3X2SA 1FX0A 2VHTA 2J3EA 1IBRA 1FL9A 1K8RA 3ASYA 3I92A 5C18A 2GBLC 2QMHA 4RKFA 3SR0A 3B9QA 3AGQA 3SFVA 1K5DA 3CX7A 3TUJC 4D81A 2ZXUA 3A58B 1CIPA 2GEUA 4AIIA 4ON9A 2QL6A 1WBBA 1MRSA 4ABYA 1IY2A 3U6KA 2NO0A 4D4KA 2GILA 4RZ3A 4WAUA 4W9MC 2MSEB 4RD0A 3AVQA 4A4DA 2OBNA 2GK7A 1KO8A 2J0UB 3AKEA 4HATA 4WIAA 3QKUA 1J99A 4DLSA 3VR5A 3CUEF 4EPWA 2HXYA 2ZM5A 1A2KC 1FMJA 1Z29A 1LTQA 2VTKA 1W2GA 1I4LD 2GZAA 1YRBA 1GKUB 1M8PA 2O8EA 3A6PC 1XCPA 5CM9C 1R5BA 1NN0A 1Z06A 4C7OA 2H57A 2JA1A 1KI2A 1E4YA 3WNCA 1H8EA 4M1KA 4R9UC 1BO6A 1P62B 3AM1A 2YC2C 3CRVA 4HLQB 3SI7A 1LS6A 4E07A 1I2DA 4D0LB 1G3QA 5TMPA 2ZRAA 1M34E 1KI3A 4PPFA 1WB9A 3UPUA 2RGAA 4LGMA 4NL4H 5JJKA 5LB2A 1SGWA 3EWSA 3AQ4A 2O8DB 2XB4A 3O8BA 3W5JA 4PZYA 2Q9AA 5DH9A 3DEFA 1GUAA 4DT1B 1OXXK 2G0NA 4HLUA 4JBWA 3LA6A 2FN4A 2XJ4A 1ZNWA 3CR8A 3ECCA 1ZIOA 3G82C 5JLJA 1RPZA 2OXCA 2OCYC 4RVCA 3SQXA 2V54A 1ZUHA 5IRCD 3EXAA 4LJ7A 3KKNA 4QBIA 1XFAA 1SHZA 5JMTA 1GNPA 2WJIA 4WBSA 3VU9A 3RAPR 1TMKA 4QC2A 1GWNA 3V4FA 2V1UA 4OK6A 1XPUA 5E7IA 1U94A 1P3JA 2IC5A 3AKCA 2BBSA 1T3LA 3QG5A 1E9RA 3OFNA 4IVPA 2QRZA 2A5FA 3OEEA 1UDWA 1JR3A 1OB5A 3O47A 4NYJQ 2IYVA 3OESA 4NCKA 1XDBA 1RKBA 3NVAA 4D80A 2OE2A 4DB2A 4Q47A 2ORVA 2VYFA 4NYIR 4NH0A 4LJAA 1CRPA 1VHLA 5FTMA 1KIMA 3CPJB 2ZJ2A 1NRJB 1Z6TA 1MV5A 3D3QA 3K9NA 2A5YB 1NN5A 4BFZA 4URWR 3U6BA 1BS1A 2HCBA 2QPAA 3NTUA 2DFNA 2AX4A 2CK3A 1TADA 4Z8XA 5GJVC 1S3SA 4IXMA 1DAGA 4EJSB 4NCHA 1D9ZA 3K0AB 3GLIA 1N2CE 3FOZA 2AD1A 3EW9A 4CEJB 3IQWA 1F2TB 1HY3A 2F1HA 3SN6A 3LNCA 4O2RA 4KXFB 3LV8A 4QKQA 1FNMA 1S9DA 3U3MA 3K8YA 3BB4A 2GNOA 3WMGA 4C0JA 1FQKA 4V0MA 1UKVY 4ARZB 1XTRA 1HQCA 2ZJAA 5B64A 2TMKA 2VP9A 2P6NA 3ETLA 4DIDA 3KDSE 2ODWA 3FE2A 4Q4HA 1JNYA 1P7CA 2JGNA 1UBCA 3FHOA 1OIVA 4UQOA 5FPTA 4DDUA 4JLPA 3TUZC 3B1VA 3SEAA 4B35A 1ZAKA 3KQUA 3CB4A 4MQBA 3U7GA 1IXRC 2IS4A 4DSNA 4RSGA 4CDGA 4YMVA 4A0GA 5AUNB 2KJQA 2X2FA 3KKPA 4WA7A 5BYJA 2OFXA 2GJ9A 4OHYA 2ZUDA 1E0JA 5FR1A 1MKYA 2VF7A 4W5JA 3AVUA 5EP2A 1G16A 3NG1A 4L8GA 3OEHD 4IVQA 2F1JA 4QJ4A 2W0SA 4H1UA 3SZRA 2WVJA 4DDTA 1HEIA 1KAOA 3DOEA 4X8OA 3UMSA 3FHCB 1IJEA 2BCJQ 4IEEA 4Q1EA 3T1VA 4KVGA 3VKGA 2CK3D 1UKEA 2BJWA 1CRQA 3HWSA 3H84A 3AH8A 1E2DA 1ZUNB 3KQNA 4B2IA 4PO1A 4DLXA 2AXNA 3GLHE 1V43A 1D9XA 4AURA 1SVSA 1G8YA 1ZYUA 2CMKA 4ZKDA 3RABA 3O8RA 1EFHA 2O0JA 2ORWA 1YZGA 1N6RA 1ZMXA 2XNDD 2ZE7A 4JL6A 1G17A 4Q9KA 4OYHA 3TE6A 4OI0A 3ND9A 3Q85A 5FTLA 2IS2A 1AK2A 2YINC 1E9FA 4PC6A 2DHRA 3H86A 2FH5B 1XD2B 2O8FA 2C9OA 3QUSA 4AG6A 4BLQA 2A3RA 4W5WA 2NOAA 1JAHA 3ZDQA 4AKHA 2DFLA 2WWIA 4XWOA 1TF5A 2ZUCA 1Z83A 4HUQA 3HR8A 1ESNA 1T3SA 4RZ2A 2G1KA 2GXSA 3SS8A 4CRWB 4QBFA 3AVWA 1NVUQ 1VYVA 1GL7A 5FOVA 3GPLA 4DKXA 4MGKR 3P4XA 5AJVB 3HU1A 3K53A 1NVXQ 4DSOA 1NN1A 2F43B 1MH1A 3QXHA 4B76A 3WMEA 1N5KA 1Z8FA 1KY3A 3EPLA 4EPVA 2XXAB 1NVVQ 1OYYA 1E99A 2ZS8A 2WZQA 3U5ZB 2R65A 4PC3A 5J4KA 4MDFA 3ZVMA 1CR4A 4HB2A 1WE2A 5BQ5A 2W2VA 3BFKA 3GLFE 3B1XA 1ZVQA 3OHMA 4Q7JB 4LJYA 4YDHB 1UDXA 1U8YA 4HZUA 4D0NA 5GADl 4TMKA 3IDQA 1N5LA 3UMFA 3EG5A 2JIZA 3UWOA 2ZRJA 1IQPA 2IBMA 4A0RA 2ZRCA 4RKEA 4MGZR 4YMSA 1G291 1GTVA 3IHWA 3TR5A 1KMHA 3MWLA 3HU3A 3KZ1E 3MWJA
chains in the Genus database with same CATH superfamily
3EIQA 1XTJA 2FOIA 4N0DA 5I6DA 1TQ6A 2VPWA 3DHNA 5DNUA 3L8CA 4G5QA 1T9GR 4LRUA 4A6EA 1KY2A 1V8BA 2HKIA 3AFNA 4NAHA 2HGZA 3VOSA 3DXYA 4EZBA 5CB4F 4L4XA 2FRDC 1T4GA 1N75A 2GEJA 1JALA 2FPMA 2Q3HA 3NEAA 1Z2CA 5T5QA 5TQ2B 3L4SO 3DLHA 2FLWA 3ZZ1A 1JFFA 1QO0D 3O82A 3IC5A 4Q1CA 2WZDA 1X94A 5HCNA 4J9UE 1E79A 4WK4B 1ZU5A 2H7VA 1ZI9A 2PRKA 2V6GA 5FLEX 5GZ6A 4D3XA 4DCJA 4LF9B 1OPXA 3WNVA 5ECWA 2H7YA 3AB7A 4YECA 5KNLA 2DP4E 5B2EA 5IFKA 4PPYA 2NSHA 4QGGA 1MO4A 4JITA 2AN5A 1Q57A 5TPZD 3CZMA 1QKKA 1KYQA 2XT0A 2XVAA 2W58A 2N46A 3FMIA 5CDFE 1P74A 3G1UA 1E7SA 4Q3KA 1Q7RA 1L5MA 1UINA 2GD0A 2R5NA 1MC4A 3IP8A 1PWYE 3PF9A 1DG1G 1JIXA 4L8YA 4QELA 3ZE9A 5DBHX 3HJUA 3BTOA 4Q4JB 3CJTA 3GLGE 2XHZA 3L0YA 1JVBA 4IVRA 4QU5A 1TQ2A 3I2GA 1W34A 3V9AA 3ZE2B 5BUCA 3FZYA 5FPKA 1PZEA 2W6JA 1E2EA 3NTLA 4Z7QB 2DPXA 1YDFA 4DJFC 2G1AA 3AHIA 3LT5A 1S8FA 2CMFA 4D9GA 4V03A 4ZYUA 4EGAA 1J7JA 1GR0A 1MUUA 2WVAA 3CS3A 2CVPA 2PV7A 3P9SA 1Z4NA 2RBKA 5JQGB 4XJXA 5LJIA 5LCXA 3M6XA 3QOWA 1W49A 4DIOA 3FOFC 4GMDA 4DXHA 2AKAB 1ZKDA 1Q2XA 3OFSA 4G5RA 1VMAA 2WHPB 4JB2A 4U5QA 4ZIRB 3AF2A 5BW4A 3DVQX 5JNSA 1YJ8A 5H68A 2G63A 2R60A 5CB6A 2J4DA 1KR2A 1M7GA 1W9MA 2ECQA 2IIPA 4LY3A 4H18A 1AQLA 4MUIA 3NANA 3BHMA 3BZWA 3CNNA 4QBKA 3T3IA 1PR1A 1N5JA 3DJFA 2NO6A 1N4AA 4CLHA 1MPTA 1OV6A 3VJRA 3PC7A 3QSYA 1F0NA 3BIOA 4V0RA 2G5GX 2ZJZA 3NRCA 1QVAA 2A7XA 1CRZA 3LXUX 4M7WA 3SJZA 2F55A 1WXEA 2OMEA 5BNIA 3HVJA 3R0IA 3NZEA 3QFFA 5CIWA 2C3MA 2FMUA 2O5VA 1C0PA 3I3OA 3KXPA 4DCUA 2DPGA 4CKBA 1T3GA 3MPOA 5B3JC 3LBHA 2MTBA 3BHJA 3AIOA 2BN4A 4L1KA 3DAPA 1TXGA 3DDUA 1I7NA 4PYNA 4CN9A 4D8XA 1PG2A 4R69A 1EKXA 4FHCA 1G2IA 4OM8A 2H1RA 5GJWC 5IBCA 3RS0A 4PYJA 4IJ6A 2DHCA 1DIOB 2VDOB 4O4IA 2OK7A 4MVJH 3NTXA 2Q0HA 3K0SA 2XMSA 4JP5A 4QUDA 3RT9A 8MHTA 1P60A 3E0QA 2CF6A 3GGDA 3HZRA 4ZDWA 1LD3A 3PLNA 4QT0A 5FV4A 5I48A 5ES4B 2NUTB 2WHRA 1GILA 3HYRA 2RK6A 5I3ZA 3ORRA 2P9GA 2A35A 1BN6A 2FV8A 3JVIA 3IMEA 1J06A 3E0XA 3IQXA 1EK6A 4KPYA 5HRUA 1NYQA 2BH2A 3UXMA 4ETNA 4GL2A 3VNUA 5BNWA 3BGSA 3NIGB 4OL0A 4O5OA 4QEDA 5IAJA 1QG6A 3HCAA 4BN4A 4W6QA 2QJFA 1W5FA 2QQGA 2R6ZA 4MUKA 1YKGA 3PZBA 2O2SA 4XVRA 5CLIA 1KS2A 3KTFA 1G5QA 3I9JA 3VR3A 1K7EB 5KWVA 2QU8A 1UOQA 5WRFA 4DV1B 4MVCA 2C2BA 1PYDA 4S0ZA 3IS3A 1DQZA 4NZYA 1NVWQ 2G9VA 4FILA 3P4UA 1HZJA 3Q3JB 3EXIA 3U17A 1O8CA 1KEVA 2IEIA 3SSAA 1CUIA 3A9RA 3FPCA 3MUFA 4KYTA 3R6WA 4N49A 2PKWA 3F6YA 4XGKA 3TOVA 4EOGA 3NT2A 1XNGA 3JW8A 5CHEA 4YQFA 3OUZA 1H85A 2VHWA 5A02A 4LC9A 4IJQA 4OKNA 2W2LD 3AEUB 4MP6A 2IDMA 2XOKD 2H2GA 4O4LB 4D8TA 1E3DA 4TS1A 1R4ZA 1DU4A 1JA1A 4HN4B 1GL6A 2L42A 1JDUA 5KYVA 3W9UA 1J2EA 1T8RA 4J43A 3QKRA 5IK2A 3LHDA 5LMUB 2QVXX 3IQZA 4XJVA 5LD2C 2C7PA 1ZHFA 1ZPDA 4N0EA 1TE2A 2R6HA 3DV9A 5H70A 3V34A 3WIVA 4KQMA 4Z53A 1MAVA 2H2FA 2FRVA 2QSYA 3D6VA 1CUYA 2X5KO 3OPMA 4Y6LA 5JHHB 3E2MA 2ZPAA 1IN5A 4LAFA 1IVSA 3N7AA 3EARA 3EQ8A 4MV5A 4K6MA 2AYXA 3SQNA 1EDEA 1MO3A 5A71A 1PTJA 5JS6A 4HNAB 2GBPA 1D6JA 2F8TA 1KVUA 2WF7A 4H6PA 5DM1A 3STWA 4A8JC 4BBJA 1W0JA 1W5SA 2ID4A 4E33A 5IG2A 1GT91 1A69A 2IUFA 3EBOA 1CVRA 4TX1A 2R48A 3GVHA 1FP4B 3MMZA 1Z4JA 2R751 1JR3D 2WTXA 1L4LA 2FG5A 3B1ZA 4F0JA 3GH1A 2WKQA 1JG4A 3HXPA 3C5HA 2BFDB 5JRJA 1TGYA 3L02A 1CQJB 4CV3A 3NAZA 3R5HA 2B8TA 2EHDA 3GRFA 1XX6A 3S1LA 1ZN9A 2JFQA 1H4QA 2PFGA 4UFPA 2DTXA 3LPNA 1HNWB 3LVFO 1J1UA 3GQVA 3GZJA 3WBBA 3U1BA 3QK7A 1U63A 2AR0A 3OZTA 2C7VA 3DW3X 4S3MA 4EYSA 4DKJA 1N2IA 4P4LA 3ZG6A 5LDGA 4F96A 1Q95A 2DJIA 1UJBA 2BT4A 1N9ZA 2FKNA 1P2SA 4BEBA 4ITUA 3F3SA 2Z5FA 4JJFA 4ZFNA 3VPSA 2CLLB 5FT9A 5KYWB 5L3QB 1H8HD 3DTNA 1TEVA 2PJDA 3VYRB 5BVHB 3BTUA 1USWA 4B3HA 1COWD 1IIBA 5AJTA 2DKOA 3SM3A 3CRMA 2BI4A 1IOVA 1KFCB 2VDLB 4KQGA 4CMBA 1GNTA 1EVZA 1PJ4A 2ZBPA 3I34X 3C1AA 4FYPA 4WJLA 3CX6A 4PHTA 1V5FA 2ZSHA 2GSDA 4JUCA 4P22A 4ZT7A 1J1ZA 4PZUA 1RM3A 3E9MA 5F4BA 3VH3A 4ND8A 4L28A 2N0SA 4UQPA 4U2DA 1YZFA 2GXUA 4L02A 3V8BA 1UCFA 1D2GA 5CVEA 4OA8A 3GGGA 3NCTA 4HBZA 4ITRC 3WGNA 1M83A 4M89A 5ERGB 3TOXA 5YASA 4WERA 2EF1A 4PGMA 1F2DA 4D98A 4MRMB 1PS0A 4TKVB 4V0KA 4FFVA 3G0HA 3I2FA 2EFJA 1E3SA 4BLUA 2Y1LA 3FNFA 3MJDA 4BVLA 3N2KA 1MPXA 1GFZA 2VWQA 4KO1S 4D2IA 1WUJS 2UUAB 4BUZA 2VJAA 1RR6A 2DBVO 2PRYA 3F74A 3GDFA 1Z5WA 5FFFA 3PEWA 5FOXA 1ONPA 3AJEA 3ZY6A 5J23A 4EUNA 4XEUA 1B7GO 5JD3A 3B1JA 4R9VA 2VNSA 2H2DA 3NUQA 4Y7DA 2WWWA 3ZTWA 3IE2A 3ML1A 1PNRA 3WK8A 4UCWA 2HBZA 3COWA 3RWBA 1C7ZA 3AKDA 1CFZA 1TM4E 4HFRA 4IIEA 1KJIA 4PGFA 3RIMA 1YDWA 4GGOA 3LUPA 3RC2A 4D9FA 3L04A 3LDAA 3NV9A 4G3XA 1FNCA 2QF7A 3FAKA 1A7AA 2XA1A 3UKDA 4CZ2A 4KB5A 4IRUB 4BN5A 5HZMA 2XVMA 1MEOA 4Q3NA 4UPVA 1CUUA 1QYXA 1IM5A 4G9BA 3OT1B 2IY7A 5E6UA 2CJWA 3HSKA 1DAIA 1Q21A 2CVHA 3MGCA 3PDIA 2CHQA 4MP8A 1MR3F 3BN3A 3IAXA 4G5GA 1OLSA 3SU8A 3G9QA 1ACMA 1SU4A 3D3WB 3VI4B 1TECE 4YUVA 1YFZA 3G0OA 4XPIB 5EP4A 5IU6A 5HMMA 2PKEA 3WGQA 2R6GA 3AQIA 3FSGA 3B5EA 1IAQA 4C0SA 4IOMA 4UMFA 3RC9A 5I8PA 3OCJA 4W9NC 4AYWA 2ODEA 1DKOA 3U13A 1U7DA 4QU0A 3DLPX 4OXYA 4L75A 2D2IA 3BFXA 1SOMA 4YR9A 1SEVA 2C9YA 3DE2X 3OF2A 4Q7MB 4XFJA 2DHQA 4CE6A 4O33A 4J0KA 2I8AA 1NRIA 3HKBA 2GCGA 1TM1E 2ET6A 4WZAA 2I99A 5DT2A 2H52A 1LLCA 4X63A 4JXKA 3AFOA 1YR2A 2G36A 3GMTA 4CR6A 2E4WA 3BRWA 4DR5B 2GKSA 2ZBDA 2ZBVA 2OENG 1ETHA 1DO2A 2YJ5A 3CEMA 2DPYA 3QBTA 4M0MA 3VOAA 1DSSG 4TTSA 1KEWA 2M6LA 2RGDA 1ELOA 5DO9A 1J2RA 2CDCA 5JEEA 1QZZA 1KO1A 1OD6A 2VAWA 1L9KA 4KBYA 4PX5A 2R9VA 1RW4A 3ES9A 2BBOA 4PEVA 4QXQA 2R0QC 3G85A 3D5QA 2R96A 3U4GA 4XRGA 3H11A 4NSNA 1G8PA 4HC4A 1ECLA 4U3JA 5BQOA 4Y0AA 5BSFA 5JMOA 4MWGA 2XNCA 1WZNA 2JD0A 3S5UA 1HLDA 4DZRA 4K0KB 1FFYA 1W0KA 1NXXA 4HNSA 1QRAA 3E15A 5TARA 1T9AA 1OBFO 3GNTA 2OVFA 4EB6B 1SQGA 2O0HA 2I2FA 2ZAGA 2X1HA 3ZWKA 4ND2A 1AIPA 4Z9XA 5MF6A 3ME5A 4RS3A 5L3RA 3U0VA 1X8LA 4LYDA 5J40A 2VXBA 1KI4A 1GPNA 5CFRA 3EF1A 1RPJA 1TU4A 2C3OA 3FSGD 4RH3A 2H4HA 4EJSA 4BNNA 4TRJA 3VO9A 1SU6A 1PG5A 3AIIA 3KZKA 2A9KA 5ELXA 3NW9A 2HWKA 4DREA 2G06A 2O5RA 4NCXA 4JLSA 5BUSA 4MVXA 3S70A 5FO0A 2FX3A 121PA 1UMBA 5AQEA 2QUBA 4Q1AA 1KR5A 1RXVA 3JALA 2OZLB 1CG6A 1PBNA 3HBFA 4L72A 4MP3A 5D5HA 5K3EA 5I7AA 3AK4A 2EC5A 1JEYA 4YRTA 2BMJA 1UDAA 1Z2NX 5G3ZA 4BPRA 1AOXA 3TW6A 1S7GA 1UPCA 3WLQA 3WJAA 3WOHA 1IRXA 2ZYWX 4JLOA 2VDNB 5NLLA 1Q7BA 1P0CA 2VDPB 2HRZA 2VPIA 3RAGA 2XKAA 3OTOB 2O6HA 4LBWA 5G1PA 5KDLA 5JI2E 4HL6A 5LUAA 1TL7C 3ADBA 5EIOA 1ZLYA 4NP6A 1PQPA 3IOEA 1KPGA 3V4VB 2OCKA 2QTMA 3B51X 1M34B 2DQZA 4JSTA 1JUDA 3GLSA 1UJNA 2N42A 3U7EB 4I9GA 1XVIA 4IICA 1UWLA 3U62A 2C0PA 1QCDA 4O2AA 2QL7A 4OUDA 3ZGXA 4DXDA 2EARA 1OLUA 3GH3A 3U3JA 1KEKA 4CIDA 3NEPX 4QNMA 5GQSA 2QLLA 1ZA1A 4RTOA 1JWAB 4MVJM 1NG1A 2PSEA 1E0DA 2DPMA 4JQZA 4CF6A 5BSWA 1NUPA 4R7GA 3NHFA 4OMUA 4G1BA 3AB3A 4N0PA 3H11B 4U3JB 2A6PA 1QK5A 4I1IA 2BW0A 1F38A 4QQFA 4HMPA 2VDKB 2HSGA 5M3BA 1Q1EA 3QM1A 2HDOA 4OHVA 4P7BA 3RSOA 1CUSA 3RS5A 3VKHA 4JK3A 3EWNA 4KUEA 3TK1A 1W4BA 3NYIA 4IG4A 1ULBA 1N0VC 3QE3A 2Q4EA 5ALYA 2WOOA 1Q1BA 2ZZKA 4KWIA 4JVSB 4P35A 1G64A 1I5OA 1FYFA 3HB4X 4CEHA 1QB7A 1WW3A 2FWIA 3NNDA 3E8MA 1L4EA 3TSAA 2J9XB 3D0KA 4RENA 4JT2A 4NJOA 4Q93A 4MI9A 3SF8B 4UCXA 1N2HA 4IKEA 2ACKA 2QM0A 4Z4QA 1GG5A 3K4HA 3M33A 2YVKA 2D2VA 1WLYA 4ZOEA 2ZBEA 2MCFA 3OOYA 2GKGA 3DV0B 3JQGB 5LJLA 3A6LA 1T6NA 3U56A 2Y68A 3IBTA 3KAKA 1SVNA 2B4YA 3ROMA 3TSCA 5H4GA 1G19A 3HCDA 2X22A 3MCZA 3ZWQA 5JCZA 4MR9A 4DLYA 3WE7A 1TZJA 3DEJA 3WIEA 1C0LA 3VPFA 1Z0ZA 4KR2A 1IWBB 1QOPB 3AW8A 2F1RA 4INPA 4KACA 1DWUA 2Y9PB 2A4MA 4B7CA 6ADHA 1QHYA 1DPGA 3F8SA 1GV1A 1L7QA 2UZ3A 5D3QA 4CMGA 1JEJA 5BN4A 3NKVA 3AB8A 4MJXA 4OBEA 2V03A 3C8DA 3ZGLA 1C8LA 3H1EA 1W4CA 1YMQA 3DDCA 2QTHA 3W05A 1Z75A 1N2EA 2BM1A 2NPIA 2RGNA 1VKZA 5ALKA 1JEYB 3JWEA 3UEOA 1EHYA 4MI3A 1D03A 1Q0SA 1U98A 1VZ2A 2PANA 2NG1A 5U1PA 5K4HA 2R7MA 1WG8A 1L5NA 3ZGOA 3TZQA 3HLTA 1BKDR 4QIHA 2ISCA 3WRYC 1ISSA 1LKZA 3CUVA 3NHLA 2PRSA 3LUFA 4F5WA 5IC4A 4HQRA 3VR1A 1SELA 4PXYA 2IVZA 4NKRA 1IULA 1MXHA 3SS7X 4KFUA 1NOIA 1SWWA 2XQIA 4B73A 4DBLC 4TTQA 2BEJA 2HWXA 3KKZA 3LCCA 1UL1X 1FTWA 2GN4A 4QLAA 4Y2JA 4LFBB 3PXCX 4HG2A 4Z86A 4A8JB 5JCOC 1EUZA 2B1JA 4L27A 4X3OA 1YULA 2X0JA 3UMGA 2RJNA 2WFZA 5B7PA 2R79A 4BJ5A 4EHDA 2Q1YA 3WGKA 3RJ5A 5IUKC 4A36A 4G56A 3EIXA 1KFBB 1N3IA 2JAWA 1X8KA 3IP6A 2Q8NA 3VVBA 4GE3A 4GYWA 4AJLA 1IZ8A 1HYBA 2P77A 3IDZA 4QAJA 4UHDA 3KSRA 4JMPA 1OREA 3L92A 1N25A 2H65A 2N1BA 1SHLA 5JXWA 4YGYA 2LKDA 3HR4A 5LUBA 2W2LA 3MSXA 2XNHA 4KGVA 1FP7A 3K0CA 3P2MA 2GNPA 2XHEA 1F6WA 1TJYA 2JCYA 2AYYA 5DWQA 2PS3A 1HOXA 2RKWA 1QVZA 2QE7D 4IOKA 4IOJA 4NY1A 4XX0A 5FL7D 2Q7DA 3VH4A 1NVEA 4OX9B 5KPDA 2P9QA 4RY8A 4GLFA 2HI0A 3SQLA 4RKRA 4M1SA 3IX7A 1JSZA 4ZAWA 1XNJA 5E38A 4D3FA 5AW9A 1SCIA 5I9BA 1KH3A 4G0OA 4JJGA 4YK7A 2VJYA 2YMLA 4HXGA 1W52X 4C0XA 2JK1A 1QRRA 2IHTA 5KQLA 3JR7A 4CT4B 4G0MA 2CDAA 1BROA 1TZCA 1F2VA 3JYPA 1GG9A 3PT9A 4NYMQ 1JFVA 1SBZA 4QICA 3BHNA 4N65A 3EDYA 3GU3A 3KEFA 4KFRA 4O4LA 4A0SA 4PLHA 4DMFA 1EESA 2PD3A 1F9EA 2IWHA 3HCWA 3WLKX 3VR5H 1N77A 3DXZA 1RZ3A 2G70A 2OBXA 2RCNA 2XB2A 1Z15A 1XMQB 1YZYA 3LGAA 1UDCA 2OC9A 2HO5A 3L77A 2ZJOA 3NC4A 4FFMA 2OCAA 5GONB 5AM0A 2ESRA 2MOKA 4KFSA 4TUYF 4YC7A 3TTWA 1Q0UA 1WBDA 3TLCA 1QE5A 4ER0A 4YJ2B 3JQAD 4JL8A 4JN6B 4BGDA 5E95A 2ZSAA 4LRQA 4V0OA 4HQOA 2NX2A 1SHUX 4OGKA 5FQOA 4AUNA 1UMCB 4MIOA 3WBJA 1JHRA 4TT8A 1U7PA 3BXEA 1NI4B 2R5FA 2JD2A 5FCDA 2QTVB 4Q16A 1D2RA 3BEOA 4MUBA 5EUCA 4L15A 2J45A 2VTVA 3IJEB 1EFKA 2D0DA 2H11A 1I7SB 1VG8A 2ZYTX 1SIUA 3QBEA 1EM8A 2Y1CA 4MK4A 3LAWA 1SUAA 4LOAA 1MG5A 1SUFA 4PRKA 2PX8A 3T7RA 5I9MA 4HGQA 3F49S 5FUYA 4TZ0A 1CY1A 2JK0A 2VBFA 3ICOA 5HDBB 3G6WA 4J3FA 1QZTA 1AD2A 1NF9A 2XY4A 4OIMA 2GFIA 1CUAA 4IINA 5J1SB 2WAXA 4UXIA 1EWYA 2GUGA 3K2BA 2VCHA 1CQZA 3NFYA 2IPLA 4MS1B 2FKAA 3RYFA 1APBA 3IUEA 4CM1A 2J41A 5HK9A 3R0ZA 4AQYB 5T8KA 4JU8A 1DKUA 1Y5IA 1LB1B 2P91A 2YJ3A 2YV2A 2UYOA 4UHKA 1L5QA 1T0IA 2AHRA 3B20A 3EY9A 1E3QA 3DFZA 5AOBA 4YMWA 1NLZA 4DCTA 1TGVA 2PDAA 4ALNA 4P0QB 4EJFA 1UOEA 4X71A 3M81A 3C70A 1SY7A 3E2IA 4HCJA 3JS5A 1TK3A 3A6HA 2RFLA 1EK1A 2HMYB 3S55A 3L0IB 3ZS8A 4Z49A 3N5CA 4NU6A 2IODA 2LDXA 3CH6A 4BGIA 4WK2B 2OBBA 4DNQA 4P84A 1FYXA 3FDZB 3RK0A 2V3CC 1IEQA 3I4LA 3QYPA 3NBYC 4MARA 4ZKEA 3WSTA 5KOJB 4C0HA 2XD9A 3CBGA 5TQJA 1VSQA 1Q92A 4H2DA 3I04A 2W2NA 1OR8A 5JCPA 1C30A 1TPYA 2F3SA 3BDIA 2P2CA 4XIJA 5JT1A 4LK3A 2IYUA 3PGJA 1QTRA 2OILA 2FEOA 3H9EO 4Q4DA 1XLTA 1OC4A 2IELA 1SUWA 2Q8QA 1KIAA 1TT7A 1O6FA 4GZ6A 3FMOB 1A9XB 3WNQA 3X44A 5FWXA 2QAJA 5EHQA 1C9NA 5FBLB 3E5NA 5FBWB 5LA6F 2PX3A 3KFVA 3HMQA 4EYKA 2NSDA 3I53A 1U8CB 4ZU6X 1OT5A 1RAEA 3WMWA 1KK1A 1X92A 2GTPA 2GPTA 3QELA 3C43A 3WQRA 4B6GA 3TUIC 2VWHA 3OPXA 3PD1A 3SS9X 4K9RA 1N2GA 1E9AA 2RB5A 3OZAA 1Y37A 3VYUB 3GLGB 1NT4A 1N3YA 5AI0A 5K6AC 1T8UA 2W2PA 3SJCA 4U2CA 1JLMA 1FPMA 2EDCA 2ZR9A 3WNDA 2IEZA 1T5HX 4MW4A 4B5KA 1XQYA 1JQAA 1Z6GA 2VJNA 3NP9A 1IUNA 2O7VA 3FFAA 2PJRA 1UP4A 1XUOA 2AZMA 4FLMA 1AF7A 4UU7A 4H4CA 5F73A 4TWZA 1J8MF 3ZR4B 2QGZA 5K0EA 2GCEA 2XA9A 2ZE5A 2BTEA 4XM2A 1HSOA 2QN9A 1JU3A 3VPDA 5IXYA 5FOSA 3TI7A 1NR5A 5KNCD 3L6DA 4NECA 2XYHA 5G53C 3OZXA 1XF1A 1EHIA 4I5EA 5LZ5A 1TZMA 3EGXB 3PDIB 4KIUA 1VE1A 4N8SA 1XPOA 4Z0TA 4BVEA 1KC1A 1Q1QA 1BCSB 1PZNA 3D3WA 4ZQIA 3KYIB 2UUCB 1K9VF 2KWIA 3TIFA 4EWLA 2LKCA 4COOA 4AKIA 2QSJA 3ONVA 5DW0A 1P1IA 4YJ3F 1UWKA 4PLVA 3F97A 2JGEA 5FBRB 5HCIA 2I3BA 3PFGA 4RZHA 3B48A 3DLCA 3G2QA 3GGJA 5B1HA 2BKVA 4DIEA 4DLZA 3LH5A 4R1PA 1N0HA 4GDFA 2PS0A 3OQOA 4NAVA 4Q4CA 5AT1A 4C9BA 2ZS7A 3D1VA 2CBZA 3AY0A 3FROA 1FRVA 4RF4A 1ZX1A 3FDZA 1EE9A 5IM5A 3EUEA 3PIIA 1EU1A 1MIOA 3HS3A 3FZEA 1U2ZA 1H22A 4KRGA 4ZQEA 3TEJA 3DEYX 1UBLS 2R5WA 3SR3A 1Z18A 4FDTA 1JHZA 1GNRA 4P81A 1RQLA 2ZDQA 3MWDB 5FPHA 5EKUA 4URVR 3FI9A 1ZOLA 1BYIA 2RGGA 3C5CA 3WA7A 1FMTA 2E48A 2QTFA 4CHGA 2ZBFA 4BWVA 3KJHA 2ZBRA 1EWVA 3PDHA 1A9PA 1N6NA 2FN9A 2O7RA 3JQ7B 3KALA 2ZU0C 3OZIA 5KOHB 1GUBA 4CL3A 4CLRB 1RJFA 4LNUB 4CUZA 1CR1A 1RQGA 4A27A 3U60B 2ZTUA 4IFIA 3GIWA 5HEKA 2EP8A 3UT5A 3WAKA 1GDTA 4ESVA 1GUZA 2WIKA 2H7XA 5B1SA 3OI7A 5EYPB 2ZR7A 1O54A 3NWBA 1LLQA 2NZVG 1K0UA 3CLKA 1FRNA 1YRAA 4E94A 2O1EA 3EASA 3AF4A 4U39A 4EVIA 4NMXB 1A9RA 5I9LA 5KO2A 2VT2A 1BVRA 3VTAA 3A36A 1LW6E 1X87A 3A6KA 2Q0SA 2DSNA 2F3UA 3QWAA 4TKLA 2WIAA 2PT9A 1Y8AA 5KU1A 3U9SA 4RVNA 2ODTX 1HOTA 2E4YA 4ZCMA 1C7QA 4OGFA 5A7FA 1Q20A 4TT3D 1BMFA 2DWUA 4ADSG 3GUVA 4XQ9A 2CZCA 1QHNA 1QONA 3F6CA 5JH7B 3OE5A 2UYCA 2WD8A 1NYLA 3K0HA 2PWYA 5DV9A 1A97A 2GOYA 3HCPA 2J6CA 3EIEA 1BXRB 5K0NA 4BX0A 1G3RA 4KQ6A 2QPOA 1ZJZA 1WMAA 4EY7A 2FJUA 2JCXA 1QP7A 4X1IB 1AZTA 3JALB 1SAYA 4DDHA 3ZJ4A 3QVWA 5JYEA 1KS9A 3DYIA 4UUAA 4YASA 4D99A 1FRZA 3HDVA 4OLFA 4PAGA 1KNQA 1C4XA 4ZJPA 2G40A 2H1CA 2B21A 3REQA 1ZW1A 1G4HA 2JFNA 2A9JA 1RXWA 4RTPA 4M8LA 3TDMA 3B3QA 5HOQA 1MTOA 1R10A 3UWDA 4C1NA 3DD1A 4I1OA 2WKPA 5A6SB 3IT1A 4HR7A 4EFNA 1QGYA 1SD5A 4HDSA 1DAHA 3GUZA 2I2AA 4F46A 2OCXA 3K71B 1IDOA 1V8OA 5JCOA 3GDWA 1W35A 4R2XA 3VQTA 4LI3X 2P65A 1NW9B 4FE7A 4QL3A 1NBAA 1QUEA 1HKUA 4GWLA 1ORHA 4GWKA 1Z2EA 3ZWPA 1SB8A 4IQGA 4F7DA 1UKYA 3V1NA 3SBDA 1IHUA 3PC4A 1I51A 3I05A 1KZ1A 1MJFA 2DT5A 2O3TA 3H8JA 3G5UA 3DLIA 4WCDA 1P4SA 2AF3C 4NPHA 2ZIXA 3MRSA 3OF3A 2AKEA 2OOSA 5AJYA 4R2IA 2H7CA 5ALNA 1S1MA 4PNZA 1PT7A 2Y6VA 1N0UA 4TYMA 4C3OB 4LJKA 4R1TA 1A2BA 1UQRA 3AVXA 2NYVA 4WE3A 3FUWA 3I1FA 4J0GA 4DN6A 4UASA 1XAHA 1VKRA 2O4CA 4ZMRA 3R5XA 4YEDA 2UAGA 4LC1A 3CG0A 4PVCA 1BGVA 4UUNA 1X7YA 2QK4A 4QUGA 4X61A 5LQCA 2O3UA 1JLHA 1CKEA 2FFBA 3Q0EA 2CV0A 1RQRA 4IIHA 3D8NA 4EYEA 3LC0A 3FF1A 3PPVA 4MR9B 1JKIA 3I9LA 1G8SA 5ESXA 1M54A 2O0LA 3HU2A 4TLCA 2O7QA 2PKXA 4WFQA 5FF9A 1GNQA 4DBVO 2I6TA 4WNAB 3AR2A 3WWPA 1K97A 1UAGA 5L4NA 5J43A 3H9BA 2RBGA 2UVDA 2O3SA 1IATA 3JQAB 1Q1AA 1R66A 1RCTE 4TL7A 2O5CA 4JLAA 4JLBA 5J4YA 3UCFA 2QP4A 2FX5A 4K9NA 4RHCA 5KTMA 3OCYA 1AX9A 2AF4C 3HWX1 1Y42X 2QP3A 1NLFA 3JQEA 5T6BA 2RG1A 5JZ9A 4OQFA 2PVCA 4GZLA 3ZIUA 3E8SA 3HZHA 4BLPA 2CB0A 2FJPA 4IIXA 2D7CA 4BFLA 2VDUE 2V7QA 2OY0A 5BURA 1Y34E 1HEYA 4DWJA 2AUMA 1N6HA 2ISSD 2NU7B 3AERB 1NOJA 1VCMA 4QFBA 3U7FB 1BJKA 1WMFA 1OF1A 3TVDA 5ALVA 2E0IA 3BD9A 2XUZA 1II0A 3M3PA 1XRRA 2YYSA 1A1VA 2UVPA 1DJOA 3EMDA 1EVJA 2Y05A 4MW1A 2I4RA 1NASA 1O2DA 2VVTA 2Y1FA 2GM5A 2ROQA 4U2GA 3OD1A 1LSJA 4QGFA 4YH1A 4PZ0A 1QH8A 2JGRA 2GEKA 3RTCA 5GPBA 3KOXA 2OV6A 1U0EA 4H1WA 3NAGA 1UEXC 3U3KA 5K7SA 4MIKA 3ZD8A 3OBIA 1VPTA 2PUJA 4ZOQI 4N7BA 1T2UA 6YASA 4CETA 4CFZA 2JVIA 4JXXA 4X1YA 5CH5A 4QYTA 2CNWA 2NN3C 1WD7A 2QAGB 1BXKA 3BWEA 2HL6A 4TN1A 2QQ0A 4D4MA 2O2ZA 1YQUA 1Y3HA 2EG9A 1I1HA 1ZJ5A 2DYKA 3DV2A 4MQMA 3FJ1A 3IT3A 3I5YA 2NVOA 1K4YA 2Y1DA 4MLPA 3X1KA 1E2MA 1Z73A 4OQXA 4LQ4A 2FCAA 4LDJA 5TY0A 3BIFA 1NBOA 2ONKA 3OQJA 4LDQA 4FK8A 5CFLA 4DV7B 3RFCA 1TA0A 2R8EA 3OIDA 5E6UB 2BFCA 3BERA 2OO5C 3AR6A 3HUUA 1N6OA 1VCOA 3SDBA 2ADOA 2XUIA 3WFZA 4BVJA 2QTGA 3GUUA 1Y8RB 1U5BA 4G4SP 2G07A 2OUIA 3DFFA 1EA5A 2JGFA 4JJZA 1NUAA 5FADA 2OESA 3UJ6A 4A6DA 5AVUA 1NZDA 5B5SA 1AQJA 3ZDBA 2ETXA 4NMMA 4UE6A 5F1OA 2IGTA 2BFAA 2XX3A 4NS1A 4LWPA 2N3ZA 4OM7A 2ZQ5A 1EK2A 1NPDA 4HP8A 4M9CA 2EERA 1NKTA 3CKKA 3U3OA 2GLUA 3HJAA 1LJLA 1RYYA 2VXCA 3BL6A 3I0NA 4X60A 4DHWA 3K3PA 4FGKA 2D5AA 1JS1X 5DSZA 3I3SR 1M2OA 4II7A 1OAOC 4BNGA 1AA9A 3TPZA 1BWSA 3G8YA 1CWUA 2CXOA 5JWOA 2QY9A 2MR6A 1MC8A 5AK4A 1FNNA 2E4XA 1K68A 3AEZA 2YN0A 4H17A 4XTCS 1M0EA 2JKVA 1GLNA 5FTLA 1E5DA 4H7DA 5DLYA 4JS0A 4AG5A 1CE8B 1NU6A 4GM0A 1E2PA 4RQUA 3G68A 2EKLA 1E60A 2A5LA 3GF4A 3VC3A 4HRVA 4Z9BA 2AZ4A 4ZJUA 1HNZB 1EGAA 2PIAA 2J3KA 1J9EA 2ZROA 1YZVA 2JDIA 1T13A 1V11B 3W78A 4IW3B 3RSLA 4RA9B 3W3ZB 3BTSA 4EUHA 4DY4A 2DVMA 1Y89A 2C7OA 1YV9A 2G04A 5T57A 3DZBA 1Y3FE 4L5BA 1RLJA 4O5AA 1MC5A 5JZMA 1AE1A 1PWXA 3WLIA 5CDUA 3PHHA 4RIHA 3HB9A 2H1OA 1YS6A 4B3TB 4TLEA 1ZHHA 4YHBA 5D1NA 3SPXA 3TNDA 3AP2A 1OQAA 4LE2A 4Y18A 4GPD1 2FG6C 3WK6A 2WMYA 4UNIA 2A84A 5C37A 4ZCTA 4F4CA 5ISMA 1GPJA 1TM5E 3M2TA 3SQWA 2BFEA 4MS1A 4M22A 4GBMA 2XCLA 3D6FA 1WQ3A 2D00A 4EA6A 5FR2A 3AL0C 4X20B 1C4WA 3PGKA 3FNIA 2J87A 2WWFA 3S2ZA 1J90A 4ND6A 3IL2A 3J81k 2CLSA 1SCAA 3PQ6A 3TQOA 3LA8A 5AO9A 1KFEB 2JLSA 3L0DA 2V96A 4BLTA 4GPIB 1Y6ZA 3EBPA 3TJMA 4M6WA 3V7NA 1T0BA 1A76A 1RJEA 2R4TA 4IHJF 3PLRA 2OORC 4AJPA 5B7QA 2HHHB 2IK8A 4H15A 1BU8A 5ER9A 4HTFB 4KJZA 4XX1A 5HIKA 1C3JA 1PR5A 3QEJA 4RBNA 5AH0A 6REQA 5KJCA 2OBMA 4RK6A 2YBDA 4RANA 2N1MA 4RF3A 5MGBA 3D4PA 2YQZA 1Z34A 2OD9A 3PJEA 4II2A 3DNMA 4FZJA 1M1ZA 4F3YA 4HY3A 5BMVA 3ONFA 3T5TA 3VA7A 5EE5B 4LRWA 4CLDA 3VTFA 4F72A 2BDTA 2QNRA 1KJWA 1YR3A 4PTYA 3WP1B 4FB5A 3WYCA 5B1DA 2CB9A 2PAAA 3I5UA 4JASB 4Y2TA 4QFMA 3FIUA 4ZODA 2BFPA 2IYFA 2V4ZA 4V0NA 4ZJZA 3LL4A 4EKGA 1YCFA 4OJMX 3LPMA 2NP7A 2H92A 3LRXA 4KODA 1NJGA 3GPCA 1CQWA 5DM4A 1WDWB 5CCDA 3ZJ5A 1A9XA 4PLCA 3ESAA 5EXTA 4R31A 3W7AA 5CB4B 3JTEA 2QSUA 4OJYA 3DLBA 3ZLJA 3EE6A 5KVCA 3QUAA 2IFTA 4IWXA 1JB9A 3BXZA 1UJ4A 3HJTA 3LYAA 2Z4TA 1NHGA 4RQAA 4MWEA 1JU4A 5E4FA 2IYPA 3BCSA 4U5XA 2OEPA 1SMKA 1LXCA 4P5EA 3Q0TA 1I1NA 5C3UA 3NAMA 4C4OA 2YOHA 5A3JA 1NG9A 4DLRA 3HCRA 5F2OA 5FLYA 4GG1A 1PLJA 4DC0A 3OBBA 1EFVA 1ZJ4A 5CT5A 5BWMA 5ERYA 4YRBA 5CA1F 4AICA 4K03A 3OFND 3H2YA 1W73A 4I6JA 2ZAYA 2HLDD 3MCTA 2YXBA 4K6HA 3IODA 2RI6A 2GJ4A 1YJQA 3T4EA 2R8OA 1CJCA 2CBGA 1KTVA 4EPTA 5F51A 3WSWA 2G1PA 2H08A 3O6VA 2I55A 5BRJA 1P0QA 1ORDA 5ITSA 5KUTA 1AC5A 3HFRA 3L0OA 1UPXA 1JFSA 1L7EA 3FHTA 4P4SA 1V48A 3FZGA 3IE1A 3DNFA 3GWGA 5TPZA 2PIDA 3WRWA 4NOKA 4QODA 1A9SA 1YJAA 2DCUA 5FWAA 4H3SA 4C07A 3RS4A 1TT5A 3N39C 1HRKA 1VMEA 5J5AA 2PR7A 4Q82A 4Z7JA 3IQFA 1A4UA 4JQSA 1RWMA 2R00A 2OLJA 3X0DA 2H2WA 1JJBA 1MF7A 2QD3A 1M67A 4L9WA 1GQSA 1WXQA 4KN6A 2P3SA 4BBAA 3CU5A 2ZQYA 4QGBA 5FEUA 1WU7A 1H23A 1N7JA 4H0FA 3BYZA 1MOQA 3HXKA 1W5TA 2AN3A 2CXPA 2I67A 3TQCA 2IGBA 2JHFA 4GH5A 4CV2A 3AU8A 3MAAC 2BKAA 4Z7NB 5EMJA 2JVJA 1B8NA 1P0IA 2WYHA 3NOOA 2PZMA 1IUPA 3G49A 1VE6A 1S4QA 4M9RA 1LLFA 3F8TA 3OZFA 4PGAA 1T91A 2IOQA 1J8FA 3DS8A 3TRJA 3RREA 4ZEXA 4YA6A 3EEQA 1LVHA 3DMNA 3Q7SA 4XIYA 4CEJA 1LLUA 2C4UA 4XYGA 2HMVA 4PSUA 2RD2A 4AS2A 3GEMA 4EHLA 3Q6IA 3MJHA 1EM6A 2DUNA 1SVLA <