The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
78
|
sequence length |
250
|
structure length |
250
|
Chain Sequence |
GYVGIKIRLTDVAPQAQELFKKESLDVKENKVYLVAATLRPETMYGQTCCFVSPKIDYGVFDAGNGDYFITTERAFKNMSFQNLTPKRGYYKPLFTINGKTLIGSRIDAPYAVNKNLRVLPMETVLATKGTGVVTCVPSDSPDDFVTTRDLANKPEYYGIEKDWVQTDIVPIVHTEKYGDKCAEFLVNDLKIQSPKDSVQLANAKELAYKEGFYNGTMLIGKYKGDKVEDAKPKVKQDLIDEGLAFVYNE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Ligase
|
| molecule keywords |
CYTOSOLIC LEUCYL-TRNA SYNTHETASE
|
| publication title |
Crystal Structures of the Human and Fungal Cytosolic Leucyl-tRNA Synthetase Editing Domains: A Structural Basis for the Rational Design of Antifungal Benzoxaboroles.
pubmed doi rcsb |
| source organism |
Candida albicans
|
| total genus |
78
|
| structure length |
250
|
| sequence length |
250
|
| ec nomenclature | |
| pdb deposition date | 2009-04-05 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Isoleucyl-tRNA Synthetase; domain 2 | Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domain |
#chains in the Genus database with same CATH superfamily 5AGH A; 2WFG A; 1WNZ A; 1OBC A; 1H3N A; 2AJI A; 2WFE A; 4ARI A; 1WZ2 A; 3PZ6 A; 4K48 A; 5AGS A; 4ARC A; 4CQN A; 3ZGZ A; 1UE0 A; 1WKB A; 5AGJ A; 5AGI A; 3ZJU A; 1WNY A; 1WKA A; 2WFD A; 4AS1 A; 2BTE A; 1FFY A; 2AJH A; 2BYT A; 1ILE A; 1WK8 A; 3PZ0 A; 1JZS A; 1QU2 A; 2V0C A; 1GAX A; 1OBH A; 1WK9 A; 1UDZ A; 1JZQ A; 4AQ7 A; 5AGR A; 1IVS A; 5AGT A; 1QU3 A; 3O0A A; 4K47 A; 3ZJV A; 2V0G A; 2AJG A; 3ZJT A; 3PZ5 A; #chains in the Genus database with same CATH topology 5AGH A; 2WFG A; 1WNZ A; 1OBC A; 1H3N A; 2AJI A; 2WFE A; 4ARI A; 1WZ2 A; 3PZ6 A; 4K48 A; 5AGS A; 4ARC A; 4CQN A; 3ZGZ A; 1UE0 A; 1WKB A; 5AGJ A; 5AGI A; 3ZJU A; 1WNY A; 1WKA A; 2WFD A; 4AS1 A; 2BTE A; 1FFY A; 2AJH A; 2BYT A; 1ILE A; 1WK8 A; 3PZ0 A; 1JZS A; 1QU2 A; 2V0C A; 1GAX A; 1OBH A; 1WK9 A; 1UDZ A; 1JZQ A; 4AQ7 A; 5AGR A; 1IVS A; 5AGT A; 1QU3 A; 3O0A A; 4K47 A; 3ZJV A; 2V0G A; 2AJG A; 3ZJT A; 3PZ5 A; #chains in the Genus database with same CATH homology 5AGH A; 2WFG A; 1WNZ A; 1OBC A; 1H3N A; 2AJI A; 2WFE A; 4ARI A; 1WZ2 A; 3PZ6 A; 4K48 A; 5AGS A; 4ARC A; 4CQN A; 3ZGZ A; 1UE0 A; 1WKB A; 5AGJ A; 5AGI A; 3ZJU A; 1WNY A; 1WKA A; 2WFD A; 4AS1 A; 2BTE A; 1FFY A; 2AJH A; 2BYT A; 1ILE A; 1WK8 A; 3PZ0 A; 1JZS A; 1QU2 A; 2V0C A; 1GAX A; 1OBH A; 1WK9 A; 1UDZ A; 1JZQ A; 4AQ7 A; 5AGR A; 1IVS A; 5AGT A; 1QU3 A; 3O0A A; 4K47 A; 3ZJV A; 2V0G A; 2AJG A; 3ZJT A; 3PZ5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
