2WKPA

Structure of a photoactivatable rac1 containing lov2 wildtype
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
pubmed doi rcsb
source organism Avena sativa
molecule tags Transferase, cell adhesion
total genus 108
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2wkpA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wkpA02
4QXAA 4URZR 4NE2A 4V0KA 5TARA 5KU1A 3QEOA 4NXFA 3SW1A 3QKUA 2J80A 3SJCA 3WYFA 4C0QC 2W0MA 2FE4A 2IS6A 2QUZA 3IO5A 2GZDA 1ZC3A 1LL8A 1E9CA 3AF2A 3H82A 4YMUA 1Z83A 2PJRA 2CCKA 2VSOA 2YC4C 2F3RA 4PHGA 2AR7A 1HEIA 1GIAA 4F4CA 1MO6A 5L3RA 3CKLA 2ZJYA 3A0SA 3SJAA 2F1RA 5F2EA 1HQYE 4KVAA 3L8YA 4BZQA 1E2HA 4BBTA 5SZIA 2HV8A 1DBSA 4RQ9A 3CONA 5BQ5A 2ZBBA 4NXGA 4NONA 1MABA 3IBRA 1YQTA 4ASUA 2A5FA 3QF4B 1E1RD 3KQHA 1OKKA 2NQ2C 1MKYA 3JZAA 5F68A 1QVRA 3OE7D 3OEHA 3JVVA 3BK7A 1PUIA 4O2RA 2EVWX 1KTVA 2QQEA 5DSZA 1KMHB 1G4AE 2J3EA 1W36C 2FPMA 1G3RA 2W27A 1G64A 1K5GA 1ZNYA 3R8CA 3NBXX 4KYUA 4HDQB 3TK1A 4DLZA 3PYPA 4HQAA 1XPRA 4I1VA 1E9BA 3T15A 3W90A 4P33A 3X1DA 1OT3A 5CB8A 1E79A 1W0KD 4OBEA 1G18A 4Q4HA 2ZPTX 4EESA 3SN6A 1EWQA 2IYRA 3Q3JB 5AJYA 1KI7A 1KO1A 1ZAKA 2XNDA 1HUQA 2EQBA 2BMJA 2NO0A 1N0VC 1PLLA 2ZRDA 3C5CA 1YHNA 5CJ2A 4TSFA 2AD1A 3W3ZB 1GRRA 5J4VA 1NMXA 2WWHA 4JVLA 3ADCA 3AF1A 2RGNC 4CYMA 3NHQA 3TMKA 4MITA 1TAGA 1XBTA 4NYIQ 4RFVA 3C2WA 2ZE5A 4I1SA 3IPYA 2L0WA 4PZLA 3B13B 1NRJB 4O2LA 5HE9A 3GLIB 2O5VA 5F3WB 4HUQB 1HT2E 4BECA 4Q7LA 4JBYA 1ZM4A 4Q47A 3KUCA 5KO2A 1DG1G 4L9WA 2PH1A 1PLKA 4N0EA 1EFRA 2C77A 5JS7A 1AM4D 2QMOA 3LQRA 1OPXA 4AYXA 3DM5A 3I3SR 4G5OA 3K70D 1AGRA 1Q12A 3HU1A 1PZNA 4X8MA 3ICEA 5FR1A 5E7MA 1LT0A 1N6LA 6Q21A 1WQ1R 2H1LA 1NVUQ 4LJYA 4WIAA 3P1JA 1W36B 3EG5A 1LV7A 4QHSA 3THOA 1KHTA 2GXAA 4KXFB 1P60A 4Q7JB 5SZJA 2AKYA 4PO1A 4HAXA 4UJ3A 3WBKA 2G6BA 3R9XA 2QN6A 3ICYA 4YWZA 2HLDA 2VV8A 1T4GA 1ZC4A 3TLXA 1VIYA 4IXNA 2JJ2A 4PO9A 1F5NA 4R38A 1R7RA 3GJ6A 4Q1FA 4B2LA 4I99A 2IXEA 5C2JB 2RGBA 4EFNA 1XPOA 1D5CA 3LNCA 4A6XA 2CLCX 1ZM7A 1FMJA 4F91B 1EESA 5CLLA 4B35A 4ZKEA 1S4SA 3T50A 1MR3F 2QP4A 2JN7A 5BYJA 4R98A 2AFHE 3HYTA 1ODVA 2OWJA 2JLRA 3WMFA 2VF8A 3OIYA 2X8AA 4JL5A 4B74A 1SVSA 4NL4H 3RVBA 2QU8A 3ZVNA 5JJLA 1XJ0A 4R2IA 2ZSFA 2PX0A 4TSFD 5FTJA 2D2FA 2E87A 2Q3HA 4NZYA 3VHXA 5IT5A 1CXZA 3NTUA 4DT1B 4EPXA 1KK3A 1S9DA 2R8RA 2QEQA 2BJWA 1XXHE 2R6CA 1P72A 3QXJA 3QPUA 4OQFA 2OXCA 3A6PC 2N46A 2V1AA 1Q57A 5FBWB 2YWEA 2NIPA 2OUKA 4C2UA 2ODNA 1Z47A 1OT6A 4DLRA 1NBME 3I61A 1W49A 4OHVA 3S1AB 4IDHA 4XVQA 3PUYA 3T1VA 4JLAA 2JJ2D 2I9VA 1NSTA 2ZEJA 3K1JA 1UWNX 5FOXA 2BOVA 5EE0A 1XEXB 3CRRA 5ELXA 4D0LB 2B8WA 4R6LA 2H8KA 3OEED 3A1TA 1DVRA 1QHHA 2FN4A 3A36A 1L8QA 3CLVA 4EPRA 4EKDA 3UKDA 1TTTA 2IT1A 3AF4A 4TL8A 1XDBA 3BC1A 4AG6A 5JECA 3BERA 3SE0A 1NLFA 2PL3A 3V00A 3AVPA 4JLOA 2UVQA 4BQSA 4DLSA 4YMWA 3MSXA 3ULFA 3AV0B 1Q44A 2YWHA 3RS4A 3SI7A 2OXRA 2JLXA 4G5GA 1FZQA 4Y0VA 4EQ6A 3UANA 1NIJA 2GCOB 4D81A 3MWLA 3I62A 1FW6A 4NHOA 4H1VA 4JSYA 1US8B 1N5LA 1U94A 4Q1EA 4Q18A 4V0OA 2X77A 2ECKA 2EWVA 1TPZA 4EETB 1OJLA 3MFYA 4TYNA 2CNWD 1AA9A 1OXTA 2O8CA 2VA8A 3B1YA 5EXPA 3O8BA 5HDDA 1KI8A 3T5GA 1D2EA 1YZGA 1WB9A 1LVGA 2HT6A 3B85A 3QG1A 5IK2D 5J4HA 4GHIB 1Z2CA 1OSNA 5KDDA 3TJZA 1XPUA 1NIPA 1UEJA 2P6UA 3M4YA 1E2DA 5H1YA 4UXIA 5CK4A 1GL6A 2Z6VA 4HJ6A 1L4YA 4NYJR 2PBRA 1DARA 5KNBA 1EK0A 1OHHD 2DFTA 3LAWA 4PC6A 2ZRPA 2B92A 5KTYA 4V0MA 4BE7B 3CZPA 3I8XA 1H8HD 1T3LA 5TVKA 5HD3A 4HJ3A 4WW0A 5AJXA 4KITB 1UBEA 1VHLA 2FSFA 2WWWA 1Z0DA 4Q19A 4QBIA 2FZLA 1KAGA 3UATA 4ZI2A 1UKVY 5JI2E 2PR6A 4KJZA 4RCZA 1KJYA 3X1XA 3A0RA 2RB4A 2KB0A 3A0VA 1Z3IX 3OZXA 3RSOA 4C7OB 4B73A 2PT5A 3TRFA 4AKIA 1XZPA 1Z07A 4EQ6B 4IDOA 4WBSA 4XD7A 1IJEA 2ZRHA 4MYTA 3THWA 3Q72A 3Q8XB 2VV6A 2PEYA 5AWFC 1AIPA 1SGWA 1IXZA 4C0AC 4C9BA 2FPLA 2QJ5A 3RWOA 4QBGB 1Q1QA 2REOA 1SVLA 3MLEA 4KCGA 3SJZA 4JYBA 2CCGA 3L8ZA 2QM7A 4HZUB 2V1BA 1YZTA 3B1VA 4JGOA 4WL9A 1AQYA 1CLUA 1TQ2A 2WJVA 1N6NA 3MG9A 4JYCA 2ONJA 3ZS9A 4DWJA 3ZQ6A 4QGAA 4QHYA 1XEFA 2EA9A 2ZRMA 4B33A 4BFZA 4ZI3A 3T1OA 2VEAA 4LRWA 4TT3A 4Q1AA 2PX3A 3RYTC 4AKEA 2X19A 3BAFA 4MYUA 3CAXA 4UNPA 3RNLA 4CIDA 1NY5A 2VSFA 3BD9A 1RKBA 3B78A 2A5JA 4BPBA 1BYIA 1KDPA 1KJWA 3B8HA 4FW9A 5FR2A 4DDTA 2HCBA 4I81A 1N3BA 2NG1A 1P9WA 4DLTA 3TIFA 3E1SA 1E96A 3ZIAA 2H16A 3LXXA 4PHTA 1GL9B 3B6EA 4OHXA 1CR1A 3MQQA 3UMRA 3UE6A 4BFWA 3SR0A 4A8JB 3AQ4A 3QXXA 3B9PA 4Q48A 3OEHD 2QBYA 1G17A 1CRPA 4RFSA 1XJ2A 3FOZA 5HDCA 1IOZA 1ZCBA 1J99A 4MGIR 3CX7A 2ZRIA 4P4UA 5EE5B 4B75A 1G8YA 5DISB 5KNDA 4M21A 5FPYA 4PC7A 3ZZ0A 4JMPA 4HB3A 1KO8A 1CR4A 1GKYA 2QRNA 4FI3C 4D4LA 2VO1A 3HU3A 4B43A 1N9LA 4M4XA 3FYHA 1XTRA 4JVSB 5J40A 2ZRAA 1TF2A 2GK6A 4QJ4A 3LW8A 5EUQB 5G53C 2OG2A 1A2KC 2O0KA 5IDVA 4ZDIA 2GXUA 1SVKA 4L9EA 2ZIAA 1NP6A 1JECA 2FZ4A 2ZJ8A 4N0DA 4DSNA 5GJVC 2O8DA 1W47A 2C04A 3M1IA 5J47A 1FFHA 3ZQ5A 3DM9B 1NG9A 2KI5A 1QDEA 4KI0A 2RHMA 2ZJ2A 4EEUA 4HY8A 1AK2A 1WF3A 4LI0A 4PX9A 4DCVA 1XD9A 1BIFA 1UJ2A 3KKNA 3B60A 3IIJA 1AKYA 5FL3A 3EX7C 4HB4A 5EFWA 4LYAA 2CLDX 2QE7A 3H4MA 5HKKA 3FWYA 4NCNA 2KBFA 4LPKA 3NOPC 2RGEA 3MUFA 1OHHA 4WXPA 4HLDA 4DBLC 2OBLA 2OCPA 5AK0A 5J5CA 2D3WA 1ZNZA 1GSVA 4B48A 2FF7A 1RFLA 1TS7A 2WMOB 4Q7MB 1R8SA 3AKCA 3OIUA 2NZJA 2PMKA 3VR6A 1RYFA 4H6JB 4MRPA 1G7RA 1JAIA 2CE2X 4JS0A 3O8RA 2CHVA 2JASA 4AK9A 1GRNA 2ZR7A 4X8OA 4PSKA 1W46A 1LB1B 2PMDA 5FL7A 1N6OA 1CR2A 3ECCA 4IRUB 1OFHA 4W5JA 2FX3A 1YR6A 1NVVR 3RABA 1U2RA 2QJ7A 3NKVA 1Q20A 3UK6A 4CW7A 5FUVA 5FUXA 4UNNA 1NL3A 4NMMA 1FNNA 1KSHA 4E07A 3LQQA 3W5JA 2JATA 2PD8A 2WICA 4JBWA 4KODA 5GJCA 3RDPA 3WHKA 2RKOA 1P2TA 5FUWA 2ZXUA 1NVWQ 3K9NA 2AHOA 1S1ZA 1XFNA 1UPTA 5DNYB 1J8YF 4JJZA 4LJ8A 1OJ5A 2YV5A 3W6NA 1DG3A 2J9RA 1TF5A 3FFAA 1VYVA 4CEIA 1VG1A 1G8GA 2D7DA 1FP6A 4QOSA 1M6NA 2R6AA 2WHXA 3BORA 4Q7KA 1WCV1 3FE2A 1DAKA 4PKYG 1JR3E 3AGQA 1J70A 4HATA 4QGHA 1X0OA 3CLOA 4ZIRA 1OB2A 1XEWY 4L9FA 1AS2A 2XNSA 4EPTA 4BASA 2AWOA 3GP8A 1GAJA 1R0WA 4OQLA 1OV4A 5DGXA 5HSQA 1JNYA 1W4BA 1RPZA 2WMNB 2XZLA 2QBYB 4Y0AA 4RZ2A 1E0KA 3THYA 4HAZA 1YRAA 3VX3A 5GADl 4MGYR 3UB8A 3KB2A 4XSGA 5IHPA 1IN6A 3K53A 4L4UA 4JLBA 4IXMA 4MRVA 4E09A 2GNOA 3QKTA 1OXXK 3CO5A 2J5XA 2QMUA 1KY2A 1ZUNB 2XSZA 3QPWA 3VR2A 3FC7A 1ZNWA 1GITA 5AR1A 4BFVA 1RC8A 1EX7A 1WA9A 1YJ5A 2VEDA 4Q66C 2ZI3A 2AK3A 3WP1B 1U0HC 3K8YA 3MCAA 2C2HA 3U7FB 4OKSA 1WMSA 2X2FA 3A37A 3RS0A 2W83A 1U8AA 3K70C 2JLUA 3F1PB 1E1QD 2OFXA 2W00A 4GBMA 1UF9A 3SZRA 1NKTA 1NNEA 1T3HA 4HSEA 4YXWD 2WKPA 3GEEA 4UNSA 4BRUA 1AZSC 3UMFA 1XD2A 1S2MA 1T18A 3MD0A 3KZ1E 4URXR 4OJQA 3KQLA 1SZPA 1E94E 3PFIA 4GT1A 2XTZA 3PQCA 1GM5A 1HE1C 4GSYA 1CU1A 4L9SA 4NCHA 5HR5A 4Q1BA 3KKMA 3UMSA 4F92B 1GL7A 3FMOB 1ZM9A 2CMKA 2PCLA 2YKHA 4RZUA 5AUNB 3KB1A 2W0NA 2GHIA 3AB3A 4RZ3A 3DMDA 4DLYA 1Q22A 4IVQA 4DJ3A 1K6MA 4A4DA 3KQNA 2BBTA 4YQFA 2P6RA 2B21A 4DLXA 4IDNA 3I92A 4CDGA 1JAHA 1PV4A 3ZYCA 1OE0A 2QP3A 4RZXA 4C0KA 2W6JA 5JEEA 1KI1A 3GLFE 2V7QD 4F3LA 2GAAA 2X2EA 1B0UA 3RRMA 2EYQA 2IYUA 4HAWA 1S1MA 1EFUA 3K9GA 2XNDD 3NH6A 4DRZA 2L4RA 4F4IA 2Z5FA 4LHZA 1GKIA 1M2OB 1SXJA 2P7JA 2QENA 1XFQA 4DSUA 4IJMA 2ASEA 5SZKB 1VG0B 5JJIA 1FP7A 2ZRBA 4TL9A 2QNRA 2NO6A 3CNOA 1OLOA 1XU4A 4DEYA 3U5ZB 5E95A 2GCPA 1Y3AA 3U44B 2WAYA 4QNRA 1E0AA 1TX4B 3IIMA 4GZMA 1XFAA 2E9SA 2ZU6A 2OBNA 3WHLA 1YVDA 1TEVA 3PEWA 4A2PA 1U0JA 1L2TA 4ITRC 4OYHA 1OXVA 2AK2A 2KSQA 4OHZA 1NVXQ 3CPJB 1BMFA 1PLJA 2BM1A 4U7DA 1FOEB 2OE2A 2X1VA 1LS1A 4H9GA 1OTIA 4EDHA 3KKQA 4Q9HA 1G7SA 2QROA 5G41A 1E2NA 1LNZA 4D0GA 2DY1A 5CIWA 3REGA 5FPSA 1GFIA 1RRGA 3WXMA 3CRVA 3FVQA 5J4KA 2IUUA 2AWNA 2ZYVX 1T8TA 1Y63A 4F3LB 1DADA 3EPJA 4FMDB 3CF6R 4MRSA 4US0R 2QTVB 1G5TA 4JL8A 4YLGA 4OI1A 4O3MA 2XGJA 4HZIA 3B33A 3UMDA 2ODEA 1ESNA 4JLNA 1XMVA 4M1OA 3WRXC 1F3OA 3VNVA 4LRZE 2REBA 2H92A 1KI4A 4S35A 2M1CA 1OIXA 4RD0A 5FTMA 2Q6TA 3B2EA 1E98A 3E5HA 1A4RA 2W6JD 2I4IA 1SKYB 3LA6A 2A24B 4CT5A 5JLJA 2GCNA 3TGPA 1KI2A 5JFGA 1FX0B 4XT2A 2D7CA 2V1XA 2ZRLA 4AYTA 4Q4HB 4B3CA 3VE3A 5BYKA 2VHQA 4EJSB 3LIAA 4G0NA 4BFYA 1ANKA 2XX3A 4FMBB 2VP0A 4MUBA 2P0EA 2ZE8A 1T91A 2BC9A 4HOIA 3BB3A 1VDZA 1DO0A 2IW3A 1G19A 3PUXA 4LYHA 1C1YA 4A0GA 1Z6GA 3PV0A 1LF5A 1TL7C 2OSBA 5G3YA 2YZ2A 3BJIC 3TSZA 2CHGA 5CLQA 5FI0B 1OIVA 1EG7A 1QHIA 4FN5A 2V8OA 2P5TB 1W7AA 3AVVA 1F2UB 2YJTD 2BMFA 1S1CA 1NLZA 1Z6AA 1B23P 2F43A 1HYQA 5CDFA 2KDKA 4GP7A 1UFQA 2BEKA 4F7WA 1MABB 4CF7A 1Z22A 2XTNA 3LXRA 4ON9A 4C0BA 3D6TB 1KKMA 4CEJB 2NPIA 1HQCA 4YMVA 4MN6A 1NJFA 2WAXA 1Z0JA 3CH5A 4DIEA 3KQUA 1WXQA 2BBWA 2OCBA 2PJZA 4QJ3A 3U4QA 4HAYA 1DP6A 2RGGA 2J59A 1RJ9A 3ZJYA 2NO7A 3V4FA 3WYGA 1N5JA 3C4JA 1UEIA 221PA 2QTFA 3AEZA 3BS4A 4IKEA 1LTQA 4CEHA 1FQKA 1N6KA 2I1QA 4LUCA 2CNWA 4A2WA 3VR4A 4F4JA 5J4YA 3I5YA 4AKGA 2IEZA 1XXHA 3EIEA 3SJBA 2R6DA 2VP6A 3A58B 3VOLA 1VHTA 1PVOA 4EFMA 3FG8A 1R6BX 2Z6DA 3K0EA 3WYAA 1JBKA 1AKEA 4EJSC 4HLUA 3LBNA 1GKUB 3WRYC 1N9OA 3C8CA 4UNQA 3WNCA 4JJKA 1N6RA 5DLQC 4TTQA 3TE6A 1TUEA 3FKSA 1A7JA 4NKRA 5JSZB 1OIWA 4KVGA 1DAMA 3QVVA 3KKPA 3PG5A 1P62B 1XRJA 5DJTA 3NOTC 2ZU0C 1NMYA 3WY9A 1LFDB 2UZ3A 4HI0E 2TMKA 4G3XA 1RZ3A 5AJZA 1VECA 4HP9A 1R2QA 1F60A 2FEOA 2UKDA 2W2TA 2VHJA 3TAUA 2YKGA 5HZKA 1YZQA 2VHUA 3BWDD 4D4MA 4DT1A 1NBMD 1H8ED 2O8BA 1KIMA 2WTUA 3CIOA 3NXSA 4QC2A 4E03A 2RGNA 4Z8YA 2BWJA 5AUOB 2IX3A 2J0UB 3L82B 3BFKA 3NC0C 2IF0A 2A7QA 4EIWA 2BDTA 3AF3A 4QG7A 4GS9A 5GVRA 3NBZC 3MFXA 4NCIA 4D4JA 4LCBA 4GFDA 2A5DA 5IU1A 2IS2A 4K08A 4JT4A 2W2XA 1CKEA 2ZI5A 1E99A 2IEYA 2R65A 3C5HA 4Q1DA 1TADA 4NTZA 2XEXA 5HWVA 5FOVA 2GJ3A 4UXJA 4Q9IA 2C03A 3VTKA 5IK2A 3MR0A 1E2JA 3SYNA 3E4OA 2RH5A 1A5TA 3LBIA 3X1YA 4GCZA 1X3SA 4C0LA 4D6PA 3R7WB 4H6JA 1OYYA 3OESA 3ASYA 2CLSA 3FMPB 1MRSA 4NPHA 4DEXA 4HH3A 4HLQB 1ZUIA 5HE8A 2ZYTX 4LSGA 2JJ1D 1T5IA 2EW1A 721PA 1DAGA 3FPAA 4ZV4A 3AH8A 1GSWA 4FWTA 3B1XA 2FNAA 1OTBA 2GAOA 3AGPA 3B82A 4PAOA 4ACBA 5KSOA 2RCNA 3IUYA 3EIHA 4OQMA 2C96A 1X1SA 4DJTA 2MMCA 3RC8A 3NJAA 2FFAA 2ZE6A 4XH9B 4B2PA 3MWJA 4OI2A 2K5UA 3BOSA 3LFUA 4QHTA 1Z6XA 5E4FA 3VMFA 1FX0A 1UAAA 2P3SA 2J0QA 2WJGA 4PC3A 1U9IC 2CMNA 3BH6A 3K09C 3R9IA 5HPYB 2FFBA 1ZD1A 1JALA 1QHSA 3A1UA 4UJ5A 4FD2A 4CEIB 3QBTA 1WBDA 5FTNA 3RRZA 3L2OB 3QKRA 1G4UR 3UWOA 4KBFA 1T0HB 5G3ZA 1II0A 4HH2A 1T8UA 1TU4A 5KSPA 3PR1A 4NYMQ 4LZZA 2NPFA 2ZS9A 1Z29A 3F1NB 3HPRA 3R8FA 2I3BA 3K9LA 1X8JA 3LV8A 1XNJA 2CL7X 4TZ0A 3GLGB 3EASA 3NH9A 1XZQA 2QORA 3DHWC 4LJ4A 4PR0A 4M9XA 2ZJ5A 4US1R 4A9AA 1DS6A 2JA1A 3K0CC 2BASA 1R5NA 3A4NA 5JWRA 1GVNB 2N42A 1EW0A 4LRXC 4TYPA 2PYRA 2FPKA 4HI4A 1KKLA 1XB2A 5F5YA 1BO6A 2NOAA 3H2YA 5EZ5A 2QE7D 2J7PA 2MSCB 1DRMA 2ZOHA 3GLGE 4NYIR 1RJ9B 4S2EA 2W0SA 4KU4A 3RSLA 5HDSA 1KK1A 4I5SA 1IN4A 4JGRA 1S3SA 5IS1A 1D9ZA 1P3JA 2BCGY 2ZSAA 2G3YA 4FWIB 1Z2AA 3PXGA 4QM6A 1COWD 3U60B 3LDAA 2KJQA 2OCAA 1KZ7B 3M6AA 5C1BA 4TMZA 1SQ5A 3RTYA 1BOFA 3T06B 4LJ9A 1ZMXA 2OBMA 1RRCA 4D82A 3FHTA 3L0OA 2XXAB 3U3RA 3CWZA 3LWNA 1HURA 1UADA 3MJRA 1W2GA 4IVRA 4A0HA 1E9FA 3PIRA 1SVOA 1OKKD 2WOJA 3RS3A 4Z54A 4XSHA 5EUMA 5H8WA 5F9FA 2CHQA 3GJ3A 3NVAA 3C15C 1ZRHA 4G5RA 4KFTA 1T1CA 3MQOA 2ZRKA 5HD5A 2GF9A 2VPPA 5BN5A 2C8VA 2IYYA 4KBGA 5FH9A 3LICA 3A4LA 3OFND 3H7WB 4XD7D 1IN5A 1VMAA 2WVJA 2ZSDA 3F8TA 3IEUA 1E32A 5CYOA 5K8TA 2RAPA 3IHLA 2VYFA 3P32A 1CULC 2PT7A 3AKDA 3M0EA 1UBFA 4ILEA 1G21E 2XOKD 4U5XA 4BFUA 4K81B 1IXRC 1XD8A 4PZZA 1SKYE 1DTSA 4LWZA 4PZYA 3DEFA 4LHWA 2H5EA 4AIIA 2WM9B 3U3KA 2FGJA 1E2GA 4K46A 4US2R 2ZRNA 4G5SA 4JSTA 5DYIA 1TEXA 1XTIA 2GVDC 3QUSA 4JZKA 3ZIAD 4HB2A 2D01A 3H7WA 3IBYA 5DYGA 3BH7A 2R62A 2D62A 2F1IA 1XXHB 1E0JA 2OZEA 2ZQ5A 2WKQA 3THXA 1T0JB 3B1WA 4QGGA 4L8GA 3VU9A 2LCFA 1II8A 2ZVQX 4RKEA 1UGUA 1T19A 1W1WA 1WA5A 2ZYWX 3KX0X 4M9ZA 4EPWA 4A36A 4P3YA 4B76A 4PC1A 2EFGA 4EPYA 1EFCA 2FSIA 4A15A 2WJYA 3KTAB 1F6BA 4C4PA 4EFLA 4YMTA 4ZKDA 1G5RA 1YZNA 4DB2A 5F69A 1RW4A 3QVUA 1W2HA 2V0WA 2VV7A 2GEUA 2NTYC 4HEJA 1E9EA 2KX6A 2XOKA 4ZCIA 4W7SA 1OTDA 3BY8A 1P4SA 4C2TA 2EWWA 2QG6A 2V6IA 3U7GA 4DDUA 5EE9A 2A78A 2PCJA 3ZDQA 4L5BA 1UKYA 3KXLA 5DO9A 4WLAA 2IXGA 5TXGA 1Q1EA 2OFWA 3GJ8A 4IOMA 2FV8A 2VP5A 3CZQA 1KO7A 1IONA 4Q02A 4DZZA 2VL7A 4A8JC 4R3AA 2V3CC 4TYYA 1TNDA 2ZS8A 2GTPA 3HJNA 3CPHA 1I2DA 1P61B 3DVLA 4I4LA 4LDJA 3F1PA 4M9SA 1OT9A 2EYUA 1E2EA 1ZINA 2GJ9A 3VKWA 2ERYA 3QXCA 4EUNA 2O8EB 4D80A 3DL0A 4V0ME 1R0XA 1VPLA 5KOYA 3SOPA 5HCIA 2JJ8A 1XJ6A 2DB3A 1NJGA 2ZI4A 4XTRA 4BRWA 2Q9BA 4PSAA 4OI0A 3EPHA 3W8RA 3GLHA 4A82A 1TS0A 2Z6CA 2ZANA 1OJGA 2C9YA 4Q00A 3MGCA 1BS1A 3E4QA 5GVSA 4WZBE 2WWYA 1N5IA 2DWOA 3THYB 1FUKA 1OTAA 3GJ7A 3TH5A 4LLOB 2ZR0A 5GJWC 3PENA 5LB4A 4GI7A 4BUJA 2HF9A 4MRNA 1GZSA 2WWXA 2J0SA 2FSHA 3FTQA 3AM1A 2WV9A 1EWRA 2V54A 3MWKA 3ND8A 5CJPA 3CF0A 5BN3A 1WBBA 2XZPA 1SKQA 3QQ5A 3MJHA 3U2QA 4B3DA 5IF9A 2IS1A 3BRWD 1NWZA 2Y8EA 4PPFA 4D26A 4EQ1A 2PLFA 3ETLA 2HJGA 3BXZA 3K0FA 4P4SA 4Z1MA 1W0JD 2CK3D 2JIZA 2ZUDA 3AP1A 3GFTA 1JEDA 3GJ5A 3FMIA 5FBRB 3O8CA 2HXSA 5HKKD 3IIKA 2VIIA 4NCJA 3IEVA 4D25A 2VHCA 3C8UA 3EZ2A 2HT1A 1JQJC 3K3CA 4DIDA 1LY1A 2QKPA 3A8TA 4YMSA 1XCGB 3K0AB 1N6PA 3IQXA 3ZZTA 2F7SA 3WNBA 3K3DA 1XJ4A 3OHMA 1KI6B 1O3YA 1H65A 1MH1A 1XF9A 2ZUBA 4DLVA 1T6NA 1AN0A 1RRPA 3PUZA 4TMVA 4HP4A 2QPTA 1KDRA 3VR3A 3NBFA 3IHWA 2D4HA 1U8ZA 1TS6A 3KQKA 2FDCA 2HUPA 1IBRA 2O0JA 1AS3A 4X8HA 1CR0A 3UG7A 5TMPA 4CEHB 5LD2B 1IAQA 4LC1A 3W34A 1LSVA 2HYIC 1HV8A 3CNLA 2VHTA 2GXQA 3IGFA 2FSGA 3LW7A 1I4TD 2CXXA 3T1QA 5EE3A 1XP8A 1DE0A 2P5SA 3OIWA 4NH0A 1SHZA 3SNHA 3GLFA 3H82B 3RWMB 1X6VA 3UWKA 5L3QA 1J8MF 3BBPA 5G4YA 1GDDA 1IN7A 1ZM2A 2L1MA 5KIZA 3IBGA 2WPDA 3F5FA 3AUXA 4PAQA 2FEMA 1I2MA 2R2AA 3T35A 4HDOB 4AI6A 2ZVPX 3EZ7A 3SFZA 2H7VA 3CRQA 3TW4A 1SXJE 1IQPA 3NG1A 2XTMA 2ZJBA 2D74A 4W5WA 4LJ5A 4OQNA 4URUR 2R6FA 4LHVA 1E2IA 4LHYA 1T1BA 2AFIE 2ANCA 2AN9A 2P2LA 1DEKA 4KV9A 3UPUA 1UBCA 4TMXA 2XAUA 2QQ0A 2ZI7A 5E7JA 2XJ9A 1FNMA 3D31A 2J87A 1U8YA 1FL9A 4UNRA 621PA 4TL6A 1UBGA 4RD1A 2JLYA 5HTKA 3SFVA 3D7MA 1Z6YA 2FA9A 3Q7QA 4AD8A 1GG2A 2PDRA 4KUKA 3AKEA 1AGPA 4LK2A 5A5GA 2OCYC 1NLYA 1VCNA 1D06A 5B58C 1AJEA 4C0SA 5CITA 3LRPA 1IM2A 2C9CA 3X1WA 1XJCA 4MYCA 3GLIE 3SU8A 2IYXA 4HAUA 1E1RA 3WBJA 1N6HA 2VTKA 4MKIA 3WNDA 4AURA 2BKEA 4IVPA 1T1AA 5JWOA 3FHOA 3FFBA 2VRWA 4E22A 1U98A 3GLFB 4JLJA 3EPKA 4FCWA 4K8OA 3HR7A 4MKHA 1G3QA 2B7CA 2V4ZA 5JEDA 1KYIA 2YNMA 2B6HA 3HP1A 1TF7A 1NN5A 2ZITA 4TLAA 2LKCA 3P20A 1XD2B 3LX5A 4CEJA 1H8HA 1MO3A 5M04A 3TSOA 4M1YA 4FIDA 1XTQA 4P31A 1X8LA 4M1SA 3THWB 3SC3A 2GCOA 3GMTA 2IC5A 521PA 3Q9LA 4WXRA 1COWA 2DPXA 4IDPA 4R7ZA 3VAAA 2QZ4A 3LBHA 4PHHA 1L7VC 1KZGB 1VYUA 2WOOA 4LV5B 2PR5A 4LPZA 2Q0HA 2YOHA 4EAQA 1J2JA 3N5CA 4PPQA 3TNFA 1G3IA 4KO8A 1JXMA 2W6IA 2JHEA 3F0TA 4EJSA 1D6JA 4ZO4A 3CWQA 1MV5A 4HIAA 2CCJA 4B3GA 1L4UA 3FHCB 3IQWA 1NY6A 1R4AA 4JGQA 2IS4A 1G8PA 4URVR 5B64A 3K0FB 2GWHA 4GOJA 4TN1A 4V0NA 4LRYC 5EP4A 3OF5A 4LV8B 4ABYA 2NO9A 2QAGC 3NHAA 1JR6A 4ASUD 3P4YA 3PITA 2QA5A 3FB4A 1TQDA 3DDCA 5EQTA 3U7EB 2BVNA 1P97A 2VLGA 1S3GA 2ZAMA 3ONWA 1EFRD 3OE7A 3NBYC 2RGXA 4TMTA 1VKJA 1Z0KA 3IO3A 3QEJA 3DZ8A 2OT3B 2JLQA 2YINC 5A0FA 1CJVC 3QXHA 4Z51A 5B30A 3P26A 2JLWA 2GKSA 3T5DA 1G8FA 2NGRA 5C46F 4OJKA 2J0UA 5TB5A 5CB6A 4EXOA 1C9KA 1SXJD 2BKUA 3LX8A 4PANA 4ARZA 1UM8A 1E1QA 2W6ID 4MGZR 4BZPA 2EFHB 4BFTA 2V6JA 2ZOIA 3D3QA 2BM0A 3PJRA 5DI3A 2G83A 4D2IA 2V9AA 4PKYA 5F98A 1HTWA 2OO7A 1YZKA 3SYLA 4HYYA 5D3QA 3GLHB 2FJUA 3D72A 2WSSD 2G0TA 5KSYA 5C18A 5LDDC 3U4QB 2QHKA 4B71A 4KUOA 1SVIA 5AJVB 2B02A 1P5ZB 3K9HA 3SBEA 1MRNA 2WWIA 4A1FA 1GP2A 2GDJA 2CL0X 2J7PD 1R5OA 2HJVA 1JJ7A 1QHNA 2V7QA 2O8EA 4GMXA 3CR7A 3FDIA 5EP3A 2RHDA 2JDID 4QFMA 1W5TA 1R8QA 4RSGA 4MKFA 1KGDA 2IL1A 2IA5A 5D3MB 1K8RA 1XCPA 3TQFA 4KHZA 4BFXA 1IJFA 2ZRCA 4Q03A 1QZXA 2ZE7A 4YC7A 5SZHB 1HY3A 3OAAD 1CJMA 2ERXA 4ESHA 3E4PA 5FTLA 5FOWA 3H9WA 2G0NA 2JLZA 2BMDA 3BIFA 2R44A 3ZVMA 2QAGA 3KXIA 5HWTA 2WBLC 1FMLA 2JCSA 5H70A 4NCKA 2D02A 1Z08A 3U3OA 1N0WA 2BV3A 3KKOA 4RVCA 1ONBA 4GL2A 5I5LA 1RIFA 4NYJQ 3OLOA 1W48A 4XVRA 1KI6A 5FPHA 3AF0A 3EXAA 3QE0A 1LF0A 4Q5IA 1XTKA 4KLZA 3PUWA 5FBLB 4N1AA 3HWSA 3EA0A 3PVSA 4HLCA 3KJGA 2ODWA 3UMEA 4B2IA 5EP2A 4GNKA 1FQJA 4XWAA 2Z0MA 3SDZA 2NMVA 3UXMA 3SHWA 3V9PA 1XJ3A 1KNXA 1D2NA 1SHKA 3MAAC 4M2LA 1YZLA 2GA8A 2VQSA 2XSZD 4FMCB 3RC3A 5C4MA 1F9IA 3HJIA 4TQUS 5FOTA 3Q7PA 3F1OA 1NSFA 3EZ6A 3GEHA 2C99A 5DH9A 2ZRJA 1E2KA 5L8VA 1KMHA 1Z28A 4MYHA 4Q01A 5KYKA 1FUUA 3BGWA 4DDVA 3GDIA 1KDOA 2PLRA 2XJ4A 1S8FA 2QMEA 2J0VA 5J7EA 1YU9A 2ZTSA 4WVFA 1W44A 1VCMA 3GEIA 2J46A 5DJUA 1OFUX 4R9UC 3R9WA 4NXBA 5KNCA 3K0SA 4BLSA 2WWFA 3H86A 3UB9A 2GBLA 3QI2A 2WJJA 5DHAA 2QTHA 3DMNA 4MUAA 2F43B 2ZRFA 1ZVQA 3GJXC 4OHYA 3R7WA 1SULA 4MN5A 4IDQA 2CJWA 4Q4LA 3TUIC 5L3SA 3T12A 3I4LA 3C14C 2HLDD 4WN5A 4ZDKA 1GNPA 4RJLA 3L0PA 3VQTA 3TW8B 1Q1ZA 2L0XA 4QNMA 3U44A 4OK3A 2ANBA 3ADKA 3IILA 3IS2B 1R0ZA 2BMEA 2CEAA 1Z0IA 1LSWA 1J90A 2ZI9A 1U99A 5UKDA 2G1KA 3W6OA 1ZD8A 1GOTA 1XEWX 4TYWA 2HYDA 2HDNB 8OHMA 1T3SA 1LSXA 1NG1A 2CK3A 1P9NA 1N0UA 5AJWA 5BN4A 2R9VA 4M53A 3GJ4A 1CF4A 1JJVA 3RLFA 1ZU5A 1F98A 3SQXA 4FMCF 1DOAA 4BZXA 4E04A 1Y28A 3QKRB 2BBOA 4OI4A 2DWQA 4B47A 2ATVA 2A24A 2WJHA 1QHXA 2XITA 1W0JA 2JIZD 2Z43A 3R20A 4GPTA 4ESVA 1OXUA 1TUIA 4JL6A 1X8KA 1MZUA 3P4XA 4R71A 2DFNA 4DCSA 1Q3HA 1P2SA 4A0FA 1R0YA 4B3XA 4OHWA 4OQXA 4GS9B 2INWA 3U3JA 4ACAA 4RD4A 3NEYA 4WZAE 1DELA 2OAQ1 4Q9KA 1OXSC 2BBSA 5TY0A 4Q4JB 2YYZA 4TLCA 4TT3D 5TV2A 2FGKA 2HXYA 4ZDWA 1JI0A 1G41A 1KK2A 1XTSA 4HHDA 1NKSA 1P9RA 3ZQJA 2G88A 3TQCA 4NXEA 4LC0A 2DHRA 5KPDA 3K70B 3L43A 1IY0A 3TR5A 4TLEA 3QF4A 1JQLB 2VBCA 2FU5C 4Q9LA 1JNUA 3CWFA 3DO6A 3QKSB 2CL6X 4B44A 2OLKA 2F6RA 4PQFA 4RY2A 3KUDA 2C78A 3Q85A 1VG9B 4C0HA 4MDFA 4QRHA 2PZEA 3U6BA 1W4CA 2JLSA 3ASZA 2Q3FA 3GFOA 5HCNA 1XEXA 1P75A 3D8BA 3RAPR 4HDCA 2GJSA 5FI1B 3OFNA 1ELOA 2P67A 5J3WA 4AWXA 1E2LA 4AYWA 5A8BA 4HUQA 2ZUCA 3QOFA 4GOXA 1KDTA 2HEIA 1YR7A 4PFSA 3NEJA 3QSYA 2WIBA 1JR3D 1S96A 3KX2A 2B7BA 5E3HA 3GPLA 4EERA 2H28A 4Z8XA 2FFQA 2E1RA 3EZ9A 4KSBA 4LBVA 4OL0A 4B6FA 4FMDF 4ZCMA 3LVRE 1A82A 2GILA 1MO5A 1UKEA 4HJ4A 4Q4AA 3SBDA 4U00A 1G28A 1CJKC 1II8B 1PJRA 4TTRA 1G16A 4YONB 4HZUA 3H0KA 1OH5A 1J7KA 3HJKA 3EEHA 2RGCA 3QNUA 4JGPA 2IYLD 4R2HA 4TYQA 2D2EA 1F2TA 1NF3A 2C5LA 1TS8A 3T34A 4XWOA 3C16C 2Z4SA 3ZZUA 2J41A 2GRJA 4NU0A 1DAEA 2FOLA 5KDLA 2N1BA 4BBUA 2G77B 3A1SA 2ZREA 3K0AA 5L3VA 2WZQA 3H84A 1Z6TA 1GWNA 4WUJA 3N2IA 1E79D 1W0KA 2PYPA 2IYWA 2FWRA 2WPDD 2YC2C 4IOJA 1ZIPA 2ZJZA 2XZOA 3AVWA 1NMZA 2GJKA 4L16A 5EZ6B 4ZDJA 4A2QA 3BFVA 2JLVA 2OM2A 5K8IA 4GHIA 1BMFD 3TBKA 1DAIA 1QF9A 4A8JA 4POAA 3CNNA 4C30A 2GVZC 1S66L 3W8NA 4TLBA 1XMJA 4DXAA 4PXAA 3EPLA 2QI9C 1RYHA 3NIBA 5HZHA 2GBLC 4IHQA 1CJUC 2J1LA 3NHBA 4IOLA 3LYXA 3LI9A 5CIQA 1P0ZA 3PHYA 3GCGA 4EPVA 3EC1A 3I5XA 2IHYA 2O8FA 3QG5A 3X2SA 1N9NA 1IN8A 2ATXA 1S1YA 4DVGA 1P7CA 5E7IA 3LIBA 1V5WA 3HDTA 2D06A 1M7GA 2ZRGA 1XWIA 3BFXA 4G5QA 4N3NA 4NP6A 4RCYA 1S9HA 1FTNA 1X86B 2ORWA 3EC2A 3LVQE 3ZD6A 2A30A 3OEEA 2DR3A 5AUQA 1IHUA 2QWSA 1OH6A 1N2CE 4BLQA 1OYWA 1ZUHA 3KJHA 1G6HA 1GNQA 3WMGA 2J45A 1KSGA 1Z5ZA 4C7OA 1DP9A 3LLMA 3W6PA 4PTLA 1E9SA 3QJYA 5JHHB 2DYKA 4FCVA 4KFRA 3ZVRA 1Z63A 4G1UC 5EJEA 4PO8A 3ZGXA 4GMDA 4HUTA 3E2IA 5LB2A 2WIAA 2EFDB 4JLMA 3AVUA 3GQBA 3V4RA 3VE4A 2DFKB 4KYIB 1PUJA 4YDHB 1OH7A 1ZCAA 3KJEA 1XJQA 2H57A 1W36D 1OB5A 4B9OA 1KY3A 3DOEA 3CRMA 5DI3B 4DHEA 2QPOA 5F6AA 1NI3A 2IYSA 2GESA 4JKYA 4TTPA 5G4ZA 2DWPA 3B1ZA 4IEEA 821PA 5L3SB 3KFXA 1E0SA 4BLTA 4PPGA 2I1VB 3DKVA 1WP9A 1LW7A 3B7GA 4AKHA 3DOFA 1UDXA 1NN0A 4CZ2A 1AZTA 1MT0A 2OFOA 2WSMA 3GLGA 1M7HA 3MJQA 2G1JA 1RE0A 2OEPA 3EARA 2R6GA 1CTQA 4V02A 5JS8A 5HWWA 2O52A 5EXXA 1G7TA 4DC9A 4ZCLA 2PZFA 4BLOA 2O8CB 3LLUA 2DFLA 4EW7A 1D7EA 3N70A 4RD2A 2DCUA 1QBKC 3N2EA 4H1UA 4XWKA 1OF1A 1MOZA 1TQ6A 5B57C 2A5GA 4YXWA 3G0HA 1G8HA 3AUYA 4V0LA 4DLWA 1A2BA 1CJTC 4LBZA 3IPXA 121PA 4MQBA 4W9MC 5FFMA 2ZROA 2A5YB 4LBWA 3BH0A 5BXQC 5DN6D 4DUGA 1NN1A 3ZVLA 1SVMA 4ZPXA 3C41J 1QG4A 3OAAA 2ZJAA 5FPTA 2IYZA 1OFIA 3BY9A 1ZM3A 4WA7A 5JRJA 1GTVA 4MDEA 4P0TA 2F1HA 4PQRA 4Q1CA 5FL7D 3RH8B 2GJAA 4I1OA 2RGDA 1IY1A 1GRQA 3CBQA 4CGZA 5G40A 1Z06A 2A2ZA 2BJVA 3UG6A 3IKJA 3NC1C 3AVXA 1E9DA 1WDTA 3FKQA 2JJ1A 3OIVA 1E6CA 1XCMA 4BLRA 4BEBA 2MSDB 5JMTA 1JPJA 1S4RA 2GXSA 1P2UA 4A92A 2KBEA 2ZETA 3A4MA 3SEAA 2C95A 421PA 2H18A 2ODBA 1G9XA 4LX0A 4CRWB 5IRCD 2V1UA 5DN6A 1C4OA 1U90A 1VCOA 2OWHA 3BWLA 1E2QA 3NWJA 4IFBA 1E2FA 4UXHA 3SYKA 4QBFA 2CE7A 2BHRA 4LV6A 1JXOA 1BH2A 2WSSA 4TMWA 5EP1A 3LIDA 4IEIA 5JCPA 5JCZA 1U81A 5CDFE 3MRSA 1QHGA 5TBMA 4JLDA 2QAJA 3J81k 2RGAA 2QGNA 5EXTA 5LBIA 3TUJC 2ZSEA 3THXB 2QT1A 2P65A 3RS5A 4M0LA 4QBHA 3K09A 1U9IA 1IXSB 1NBMA 3JVUA 3MMPA 4WF0A 3GJ0A 2O8FB 4PQYA 4W5HA 2DBYA 4BEJA 2OLJA 3H1TA 3LO5A 3CPEA 5KUTA 3CB4A 2LWIA 3W9YA 2CDNA 1VCIA 2Z4RA 3I72A 3DKPA 2F9LA 3MXQA 3KJIA 4QGFA 3VKGA 4I3JA 1JEEA 2HCJB 1NVVQ 4AG5A 1CIPA 2O8BB 3FKSD 2YVUA 2J7KA 4HB0A 1AQUA 1KO4A 1ESMA 4I3IA 3CX6A 4R70A 4DJ2A 1N25A 1Q3TA 4HAVA 4GZLA 5JBQA 1HE8B 2F1JA 1XTJA 2IWHA 4C3ZA 5GJBA 4Q21A 3AVQA 3TSWA 2GZHA 4MGKR 2QGZA 1R10A 4XT2B 3NDBB 1N5KA 2OOLA 5FOUA 5JWHA 2VP4A 3CF2A 5P21A 3LUQA 2QRZA 5ANRB 1JPNA 1P6XA 1SXJC 2ZI6A 3TVDA 4M22A 4A0RA 2XB4A 4HNBA 3A1VA 4EEPA 4NDZA 4OK6A 3VFDA 2EFCB 2YOFA 1SVWA 2AXPA 3E70C 4URWR 2YWGA 4B6EA 2GJ8A 3KL4A 1VB6A 4JIMA 2AD5A 2ORIA 4M1KA 4MH0R 3GFPA 2GF0A 5KDOA 5AVEA 4FINA 4QJ5A 5EE1A 5DHFA 4DCUA 3IS2A 1S4QA 2ZR9A 1VYTA 3CH4B 4LGMA 4DLUA 2GK7A 4Q4AB 4F38A 3CM0A 2KWIA 3TUZC 2W58A 2IHBA 1Q21A 5JZVA 5FTKA 2IYVA 2UZIR 2VP9A 2R78A 1QHHB 1M1YE 3EWKA 1E2MA 1F2UA 2AXNA 2AX4A 1JR3A 4XOIA 3X1ZA 2ZM5A 1EFTA 1ETUA 1MO4A 3AVOA 1P2VA 3F3YA 1KOUA 3W3AA 3S1AA 4MRRA 3G6OA 1EXMA 4GP6A 2HV1A 1DO2A 1M8PA 3QXSA 2IWRA 5J4LA 4LJAA 3RHFA 2H17A 4CT4B 1DAHA 3VX4A 1ZW6A 5EXSA 3WP0A 4JLVA 4G01B 4P4SB 4WZ6A 3TR0A 3PEYA 2AKAB 2ZAOA 3LI8A 1WE2A 4GW9A 1LS6A 1NN3A 3CUEF 4HLUC 1E4VA 2JEOA 3HPQA 4E5UA 3EZFA 1D9XA 1XX6A 5C4GB 4RD6A 1M7BA 1CBUA 3QY0A 2FMXA 5BW8A 1AS0A 2WKRA 1KOFA 1II9A 1V9YA 2B8TA 3QKSA 4FCTA 2GETA 4DB4A 3BE4A 4LOAA 3CW2A 4ARZB 3AKYA 3Q5DA 4LJ6A 3PEUA 2QT0A 1TMKA 1S0UA 2Q9CA 4XTCS 4JLPA 1RVDA 4BBVA 4Q4JA 3RS7A 1ZYUA 5DKKA 2P6NA 1Z0FA 3GD7A 4L9GA 4PSVA 3UB7A 3RRYA 1US8A 1XMSA 2QM8A 3EWAA 1QRAA 3CRW1 3KTAA 3PCRB 3L0SA 1YR8A 5KSZA 2OILA 3CX8A 1OW3B 3U61B 5JSZA 1DPFA 4PC2A 4KSCA 2IF2A 3A1WA 1S67L 2WWGA 4J0QA 1M74A 5FPKA 1GUAA 5JI3E 4M4SA 3VHLB 2KE5A 4A6PA 5FOSA 4KQDA 1CEEA 3B5JA 3LD9A 4I3AA 1E9AA 2VSXA 4B34A 3BB1A 1ZBDA 2FG5A 3QIAA 2OAP1 2PD7A 1WRBA 2CBZA 3VR1A 4LPSA 3G5UA 4L15A 4DUGD 5JHGB 4OK5A 4P32A 5H68A 4JVNA 3HU2A 1DAFA 1VIAA 1QG2A 4NYMR 1VG8A 4JBXA 3O47A 1UKZA 5CM8B 4NBSA 5L3QB 2Q21A 1SXJB 2AL7A 1XMIA 1Q1BA 4KFUA 4TWZA 2BIFA 2GEDA 4DDWA 4I38A 1GILA 3TVTA 2VF7A 4JVMA 3PUVA 3QF7A 1ZD9A 5K8UA 1N6IA 3ND9A 1KSJA 1H8EA 1KAOA 1ODFA 3LIEA 3U7HB 3Q5EA 4DSTA 3L0IB 1VTKA 2MSEB 2C9OA 1T5LA 4MKGA 4CVNA 2ZJOA 3QPVA 2HF8A 2O8DB 2IBMA 4ERNA 3TAHA 1G1MA 3UIEA 5KHOC 2NZ8A 3VKHA 4P4TA 1EGAA 2QPAA 4XIGS 5DIFA 1KMQA 1V43A 4KAXA 2PEZA 5F9HA 2F3TA 3MWYW 4YDSA 3EW9A 4D4KA 3GLIA 4XJXA 3I32A 3W5IA 4Z1MD 3QENA 4M1WA 5FBQB 2V0UA 2YKFA 5DI9A 2Q9AA 1DP8A 1G3MA 4LYJA 4XVUA 5J4EA 4GRAA 1P73A 1RRFA 1YKSA 3T61A 1FTSA 1Z0AA 3F1OB 2LKDA 1EFHA 2QP9X 3U3MA 3T1TA 1Z8FA 2OV2A 4I39A 1G291 1W4RA 4RFSB 5JJKA 4TLDA 1YRBA 3I8SA 1UDWA 4URYR 3B9QA 4LY6A 5LD2C 1D2MA 2BEJA 2VLIA 2QSZA 1GSIA 2YWFA 2EFEB 4FXPA 1BYUA 1M34E 2ZS7A 5AVFA 2CVHA 3EWSA 3WMEA 4O0MA 2V55B 4TQ9A 2QL6A 4DSOA 5TBMB 3ADDA 4TQAA 5LPNA 1G5PA 4RD3A 4GDFA 2VH5R 3F1NA 2REXB 4PHFA 5JRZA 3BB4A 4II7A 3LIFA 2IYTA 3KFVA 3GECA 2BCJQ 1W4AA 4M1MA 4IW3B 5TDHA 3VR5A 3LY5A 4LYFA 4B3FX 1CS4C 4KFSA 1ZJ6A 2JGNA 1A1VA 4QKQA 2O0HA 5CK5A 5FBVB 4LHXA 4LBYA 1UWPX 4DCTA 5A4JA 3EAQA 4B32A 2F55A 2XXAA 3EA5A 4U02A 3ICQB 2IUSA 3O8DA 1YZUA 2Q3MA 3U6KA 4MA4A 1E2PA 1G6OA 2FFHA 2QAGB 3VNUA 1FPMA 3KDSE 1KK0A 2RMKA 5D3MA 3RRNA 2GEVA 2GZAA 1Q0UA 1E69A 4ZIRB 1EX6A 3I1FA 4Q9JA 2ONKA 2ORVA 2QY9A 3IDQA 1OTEA 4TL7A 1OH8A 1I4LD 4BGDA 2W2VA 4WOPA 2A9KA 1BYWA 5K8LA 4D0NA 2QMHA 1HA3A 2WJIA 3AP3A 1GSXA 1G20E 1R5BA 5KPJA 1X1RA 2OESA 2OHFA 3RANA 3AP2A 3JZMA 3P27A 1YR9A 4KLNA 5AUPB 1TQ4A 3FGNA 3G82C 1KNQA 1K5DA 3ZS8A 4V03A 3FMFA 3ZD7A 1V9ZA 3QBVA 5FUYA 3SS8A 2YHSA 1G7CA 1CP2A 4C0JA 1QVAA 2IYQA 3PEVA 5B2ZA 1YE8A 3RS2A 1KJZA 1GNRA 1ZU4A 4O25A 4QM7A 4PPNA 1ZIOA 3REFA 3UB6A 2IUTA 1HH4A 3GLHE 2ZYUX 4RKFA 2Z83A 1TU3A 3I73A 3VU9B 3KXKA 1O87A 1QHYA 3EIQA 3NDPA 2K7SA 2SHKA 1E3MA 5DKLA 2C98A 2FH5B 2V9PA 2G9NA 1KI3A 1ZNXA 4F93B 4M1TA 3ADBA 1KSFX 1BKDR 4JKIA 1T9HA 1CRQA 1JB1A 3DPUA 4IFEA 4BFSA 2CVFA 3ZH9B 1ZP6A 5BWMA 2F9MA 3LH5A 2EU8A 3SHFA 1U0LA 2MMGA 4M9QA 1W5SA 4X8LA 3AVYA 2A3RA 2XB2A 1D8TA 4UKDA 1F48A 4I1UA 4DCNA 1E4YA 2JAQA 4UQOA 2JDIA 3C7KA 4BWYA 4JT2A 2PZGA 1HT1E 4DKXA 5CM9C 4WAUA 3ZLJA 4AY2A 2VP2A 3HR8A 3NOUC 4GOKA 3HYRA 4M8NE 1E9RA 2QSYA 3K0CA 5DE3A 4TZ6A 1F2TB 4AC9A 1G3UA 3CR8A 2IK8A 2YOGA 3DZDA 3AVTA 1KI9A 2CJWB 5CYPA 3SQWA 3TKLA 1IY2A 1I4DD 4LJ7A 4BLPA 1OFTA 4PAMA 4QL3A 4B3BA 4IOKA 2IXFA 2ZSBA 4JLKA 3P7NA 2NO1A 4TMKA 2PHYA 1KO5A
chains in the Genus database with same CATH superfamily
4QXAA 2YWXA 3TLKA 1V37A 3H8WA 1RPNA 4NXFA 1QCCA 1H66A 4IMJB 3GBPA 4PGAA 1FXWF 2W0MA 4LRTB 3SJCA 4R3JA 2X8BA 3AI7A 1MKIA 1Z26A 4C0QC 1LL8A 1VHJA 4L5CA 3H82A 4G0UA 2PJRA 3WE7A 3FSRA 4RC9A 4EG7A 1J3WA 1ZO8A 1CB0A 3CKKA 1U5CA 1WO8A 4AJKA 1MO6A 4QU8A 1X7ZB 1ZITA 4MHOA 2OV1A 1GYPA 3IB3A 2ZJYA 3A0SA 4BVLA 4YJ3A 5JAOA 4C4XA 2F1RA 3OOYA 1Y8CA 5F2EA 3IKMB 1HQYE 4KVAA 4FFRA 2Y2NA 1RXVA 3VR5H 1Y3HA 3W5BA 4GR9A 2FEXA 3CY6A 2GD0A 3TL6A 3CONA 3BQAA 4QDJA 4K6CA 4P4NA 2IEIA 2XV1A 2ZB8A 3BMCB 1OBHA 1MABA 3MWEA 4NONA 3IBRA 5DGCA 4C1NA 4NMLA 3LKBA 1Y6QA 1JHZA 2EJWA 2YVLA 3MCWA 1U0OC 2WYIA 1OWPA 2HIGA 2OV3A 3JZAA 1YSCA 4K9DA 3TZHA 2QJTA 5JXIA 5F68A 3N2ZB 5JMOA 3K7EA 2ZJ0A 3A32A 1MG5A 2D1SA 1RLTA 2FWPA 3I0ZA 2W22A 2YRXA 3WIUA 2WK1A 3F71A 4HQLA 2FMTA 1NHGA 4X1IB 4ZVKA 4DR5B 3NWPA 4JJIA 5CECA 3PHIA 3FAZA 2WJWA 3R8CA 4GWKA 5G4LA 3U3XA 4EO7A 4DLZA 1XXMA 3QP4A 5TFQA 4HQAA 3DBVO 1XPRA 5CB8A 1E9BA 4OLBA 1OT3A 4H31A 4QY6A 1E79A 3CPTA 4OBEA 5DM2A 1WNTA 2ZPTX 3NRCA 1ABFA 3KCQA 2I6GA 3OPYI 3I53A 1EWQA 2ACWA 2BDEA 2AYXA 4MVYA 5LBRA 1H2ZA 3CF4A 2P6MA 5CBPA 1RRKA 4QUGA 3RVQA 3IVCA 3C5CA 1F1JA 4E2WA 5A5FA 2AD1A 4Z4IA 2D7JA 4REQB 3W3ZB 3QHAA 2EBUA 3N86A 5FT9A 2O7QA 1A9TA 3ZE9A 2O2ZA 1JU3A 3QMVA 4PLHA 1PX0A 1PW5A 1T9AA 2PT6A 4O2BF 3NHQA 2OQIA 4MITA 1TAGA 3UB4A 4NYIQ 1U6KA 2O1XA 3IPYA 2L0WA 1GAWA 3F47A 1SUAA 1Z62A 2VT3A 3H3FA 4YB8A 3W77A 5K5EA 3CWCA 1KHHA 1SXHA 3PNQA 1YQGA 4BECA 2QVLA 1X39A 5CTJA 4OX9B 4XLLA 3HXPA 4FGUA 5AIAA 1YIOA 1CY6A 2CHEA 3UDXA 2O2JA 4PM9A 4JF4A 2G1PA 2NQTA 1RQRA 1PLKA 3HJHA 2XDYA 3H6GA 1ETHA 5JS7A 2IHUA 4L28A 3DWFA 1XPBA 1SC3A 2C2OA 2Y2UA 4HWPA 4AYXA 1L0EA 4G5OA 1KKUA 4NEQA 5B3JA 1A98A 5EMLA 3K70D 4OATA 4B6JA 1S4MA 4FYXA 4OH1A 3WRYA 3ICEA 1ZWLA 4A7PA 2AFIA 4DIFA 5JVDF 4JXXA 2MJLA 2I6SA 1P6QA 1XQ6A 4FXOA 5JJ5A 2XCRB 4DA4A 1WZ2A 5HF9A 4O7DA 3JD4A 3JTEA 1WQ1R 1QAMA 4NBVA 1I4WA 4TTSA 5ADVA 1KHTA 4EG3A 5CBPB 1VLMA 4Q7JB 4MBFA 4KPUB 4EW2A 3CFYA 5F77A 1SZCA 1Z2DA 2P2ZA 3FNRA 3ICYA 1OLXB 1T4GA 1ZC4A 1VIYA 1P1KA 2JJ2A 2X4DA 4IXNA 2M6KA 4DQ0A 4OF4A 4R38A 1BU5A 1I80A 2ZIZA 1M0EA 1UWCA 2Z6UA 4FE3A 3V3TA 4L1KA 4EFNA 3PNYA 3W79A 1ZM7A 2DKOA 3LUAA 4F91B 5FAKA 1EESA 4UREA 2FK8A 4B35A 1ZWKA 2BJHA 2HFKA 3P0RA 4NOLA 5A4AA 2AFHE 4PTZA 1ODVA 2OWJA 3BDIA 2WU8A 4KQCA 4ZAFA 3OIYA 4BCDA 3VOYA 5TEWA 1UH5A 1I30A 1QTNA 1N2CB 1W76A 4K6GA 4Y6QA 4DMMA 2WZXA 2GD2A 4GEKA 3DLTA 2PFSA 3F5DA 2UU9B 2QTGA 2PX0A 2HJ9C 4BMVA 1CXZA 2BI4A 4M9RA 4DRXA 1S9DA 3FPGA 3QE2A 4U2GA 3O92A 3SKXA 2QEQA 3TRIA 1XEAA 2R6CA 4EWFA 2JD2A 5KYNA 2C42A 4KTVE 5MHTA 4DRYA 3G85A 3L7CA 5M2QA 1VB3A 2XCIA 3M6VA 4B4KA 3STHA 4R1SA 2O3SA 4X25A 1ISSA 3JWGA 5BNFA 1KEZA 3R3HA 1OT6A 2BFCA 5DHTA 3E8SA 1JKJB 3NKLA 2Z5GA 1C0KA 1GPYA 1D04A 4RLSA 1Y3DE 4XVQA 1WUYA 2DUWA 3DE0X 3PUYA 4HLNA 2JJ2D 2I9VA 2QD5A 4JLAA 3SH9A 1WCXA 5EE0A 1XEXB 4D0LB 3EFHA 3AJ9A 2RJ3A 1BZYA 4EPRA 3PNSA 4OH7A 4EKDA 2ZK7A 5DFXA 1V5GA 3QVTA 2ZQ9A 4GKBA 3KS9A 4ZT4A 3UKDA 4TL8A 4RHTA 1XDBA 4G2NA 2JK0A 4D2OA 4IV5A 1Y4UA 4AG6A 3BERA 3SE0A 3AEUA 4X3OA 3KKKA 3TQTA 2EIHA 3V00A 4JLOA 2UVQA 4DLSA 5LQAA 3GRZA 5KSCA 4HMQA 3ULFA 3AV0B 4UBJA 4QUHA 4W8HA 2UXDB 1IYZA 2NZYA 2WT9A 4WINA 5BWOA 3RS4A 3T0IA 1ZN8A 2KPOA 3AUTA 4Y0VA 4EQ6A 2LNDA 4JI4B 3TJZC 2DLCX 2QQFA 3MWLA 4J4BA 4XARA 4BMNA 4Q3OA 2RH4A 1P74A 1JRLA 3B48A 4NHOA 1RHJA 3UJ8A 3L7NA 3NULA 5DT9A 5AQEA 3M5DA 4Q1EA 3R3JA 4Q18A 2Q7DA 4KZ7A 2QXUA 3QELA 2EWVA 1TPZA 4EETB 1GTMA 5LLSA 1GCEA 2YS6A 1MUUA 1BTLA 1S6RA 2VA8A 3B1YA 5EXPA 1L7NA 4BNGA 3DQZA 4V2UA 2GN9A 5BQFA 1LVGA 2VHEA 3BJRA 3FCAA 3M6LA 2ASVA 3AR7A 4D60A 3BTSA 1JQBA 2IWBA 1NIPA 2G5TA 5F1YA 2VDRB 3M4YA 3RAFC 5H1YA 4G07A 4RSMA 1GUDA 3RGWS 1AA6A 1M2FA 2R5NA 5CA0F 3NZEA 1SKMA 1WQ4A 2C1XA 2WAOA 3PHHA 3P2IA 1JFLA 2J6IA 5A02A 4KOAA 1H9BA 1V9SA 4HNQA 3ZPXA 3GIDA 1JXAA 3MWGA 3A06A 4EA9A 4F2GA 2VBFA 4N18A 1NRWA 3ND6A 1J6UA 3QV2A 4TS9A 1T1RA 4BGUA 1SK9A 4CTOA 1EUZA 2PSHA 3O4VA 1KQNA 3UY6A 5TQJA 3OM8A 1XQ9A 2FFRA 2W93A 3FPWA 4OP5A 1JWBB 2IP1A 3WGYA 1HDYA 3T3NA 4MEBA 2HRBA 2G9ZA 1KJYA 3HCPA 1OFVA 1ERQA 3KD2A 4M7RA 3DLAA 4PM5A 1QLHA 2HJEA 1T2FA 3BRQA 2NXNA 4MUNA 4BNWA 3RSOA 4C7OB 2GN4A 1CJBA 1LQUA 1YBMA 3Q9UA 1JVBA 1Z07A 2BT4A 3UAGA 2AVNA 1WB5A 1LL9A 3OF2A 3HJUA 5KMGA 3Q72A 3F8SA 2BFDB 1IFXA 3BGSA 3Q8XB 1SGWA 1IULA 1WMDA 1UUFA 4MUKA 1IXZA 1H2XA 1M66A 2QRGA 4C0AC 2CW5A 2FPLA 3R3UA 4PIVA 2OCGA 4KXXA 2QJ5A 2O2SA 3VUFA 2JLCA 1J8FA 2REOA 4F96A 2CZCA 3SJZA 1EUDA 3JQ8A 3GH1A 5GM1A 4Z1OA 1E3QA 3SZOA 3KHUA 2HMUA 4FIZA 3TKYA 1YZTA 4G1BA 3UMBA 3ZHSA 4CXMA 4H18A 4QU3A 3MG9A 1TQ2A 2R00A 3GT0A 3ZNTA 1N6NA 1YB2A 5CT9A 5DXFA 4BNJA 1DG9A 4QGAA 5JFOA 4RTJA 2NZVG 4RTQA 1KZ9A 1IMJA 5MC7A 2C7OA 3CEPB 1MKMA 4N3CA 3LQYA 2VEAA 1VCHA 3WWCA 2WUQA 2PGOA 3EGXC 4FFMA 2X19A 4Q1AA 4REOA 4BO7A 2C2YA 1K0UA 4JUAA 3JAMA 1NYRA 2CUTA 1XZIA 3BD9A 3FFTA 5HUHA 1RKBA 1TDLA 5GLBA 4NSNA 4BPBA 1BYIA 1KDPA 2IWDA 3SS5A 3KU1A 4I81A 4GXNA 2C4MA 3NWBA 1N3BA 2XIQA 1GQYA 1P9WA 1U1CA 2NG1A 2P3QA 4KG2A 4L0LA 1E96A 4PHTA 2H16A 2GWRA 3E1SA 3IAHA 3LXXA 4LOJA 4REMA 4AF7A 2XUJA 4EYSA 4Z0TA 5LQSA 4CIYA 3IC5A 4YCJA 3AQ4A 4EI2A 5FQQA 3OPNA 2AOWA 3OEHD 4Q48A 4DNQA 1G17A 4FFBB 3ZE1B 2WQ7A 4P4GA 2EFXA 1TM4E 3OE4A 4RZQA 1DB3A 1G55A 4B79A 2XCTB 3NVDA 4AFIA 5M19A 3BTVA 3WLEA 1BC5A 1U8XX 5BOVA 2MJ6A 4M21A 1YS6A 2VSNA 3MJDA 3ZZ0A 2UVPA 2DBZA 2ECPA 3AJAA 4KAAA 2OGTA 2WLSA 3SY8A 2OENG 2OHGA 3HLBA 1AQ6A 2I78A 2CXSA 3E9RA 4V3CA 1LK0A 4WCVA 3MUNA 4P9NA 3G7SA 5LBUA 4CV3A 4NMWA 3FYHA 2FPWA 1DAPA 1N8KA 1U6IA 1XTRA 4JI0B 3JAKA 1TF2A 1GGFA 5AM0A 2QR5A 4ROTA 4O3MA 4N48A 1EYZA 1FOFA 1A2KC 1TKRA 5IDVA 1SVKA 4L9EA 1K3FA 1PJBA 1SC6A 2I8AA 2ZJ8A 3OZSA 5GJVC 2C04A 1U7HA 3AUKA 3ISJA 2WTBA 3KCNA 3Q2KA 3DBLB 2KI5A 1IHOA 5I9MA 4R5MA 1JHYA 3ZU2A 2D3TA 4HY8A 1PG2A 1WF3A 4FCFA 2R4QA 3IPRA 4LI0A 5TPWB 5JJBA 3NB0A 5KJ1A 1YR3A 3KKNA 2E48A 3KTOA 1QJCA 1AKYA 3WGQA 4DA7A 5T3UA 1ALQA 2R6R1 4CTNA 2PRIA 4BMWA 1SDNA 3NTQA 4HH1A 4RLHA 4LPKA 2W6NA 2ZT6A 3TG8A 3MUFA 1OHHA 3QOYA 4HLDA 4WXPA 4XR4A 4C3OB 2OBLA 1PFYA 3HSYA 3VSLA 2OCPA 4JU9A 4KLCA 2AJ8A 2D3WA 4RJ2A 1WBJB 4RMIA 5DRTA 5J5CA 4JI8B 2FF7A 1RFLA 1TS7A 2COEA 4JXKA 2WMOB 3M2TA 4LAFA 4WPGA 1WX1A 3LRXA 1WSBA 2YASA 4M1ZA 3QNCA 2PMKA 2BFPA 1DQRA 3EUAA 2GAFA 1UM9B 4RM2A 2PQMA 4LKOA 1QZTA 1ZBQA 1UBMS 2CHVA 1GRNA 2ZR7A 5DPMA 4PSKA 1GCGA 5HG0A 3SLRA 2ZZNA 3KLMX 2AVDA 4QREA 2XE6A 5FL7A 5FOQA 2QM0A 2O23A 1KH3A 1PL8A 2FPGA 3C3XA 2C5EA 2CSUA 1PWEA 1RCTE 4I4CA 1SVNA 4N3GA 1YR6A 4WUTA 1DT3A 5KX5A 5FDHA 5J1SB 2WQ6A 4H4DA 3BLMA 1H9AA 4OB6A 5B6PA 5IJXA 4CW7A 3DEAA 5CFLA 5JMWA 3PKZA 1NL3A 4NMMA 2J3WA 3VKUA 1UK7A 4Q3EA 5TPWA 4KN5A 2PUAA 3HWRA 5J58A 1CUUA 4NAUA 5EG5A 3ZCTA 1Q1GA 3W5JA 2Q2NA 2PD8A 1M1NA 1PBNA 1B42A 2WICA 4JBWA 1EJ6A 4KODA 4TQGA 1P2TA 5FUWA 3WHKA 4QYMA 3M2PA 4DXCA 2AHOA 4HF7A 1F17A 4LJ8A 2K4MA 4L9AA 1OJ5A 1SH7A 4IJQA 5D1HA 1GQFA 3ZGZA 3LS2A 3DAPA 3G2HA 3N6VA 3LC1O 3FFAA 2P08A 3P4UA 1PN3A 3NYQA 1RYNA 4BNFA 4B6RA 4HFRA 1SQ6A 1K57C 1FP6A 2AC7A 1M6NA 2R6AA 1KDSA 1XLUA 2DQSA 3PT9A 4JX9A 2Z2KA 2TYSB 9ABPA 3IVGA 3R09A 5J2TF 1USVA 3N1UA 3MF0A 2WG2A 1JR3E 3HO6A 4QGHA 4HATA 4ZVUA 1OASA 3CUUA 4WXYB 3RKUA 1AS2A 3GP8A 1J1IA 2AWOA 4FOLA 3R0VA 4GMKA 3RXWA 2WP8J 5FQ9A 2XMZA 3V8PA 3SC2A 4CTKA 1PIOA 5JQGF 1W4BA 1DLJA 1Y9ZA 3I6YA 2RH8A 2X5OA 3IV9A 4B93A 4Y0AA 2XZLA 4BAUA 5A4IS 2GBPA 3R24A 3D54D 2ZIVB 2B36A 4OGKA 2WU0A 3T1HB 3LPCA 4XM1A 2FPIA 2A3NA 4OQPA 5CDYA 5GADl 4Q3LA 3KB2A 5FUQA 3T5AA 2A59A 2WJPA 3GRYA 4X84A 2UUOA 4XZ3A 2VJMA 4MB6A 3F96A 4IFTA 5AW1A 3C2QA 1IWPB 2YJGA 4YRPA 5KVVA 1QVVA 3FC7A 2P79A 5K0GA 3WRTA 2OC4A 3HKCA 5ALEA 4K9QA 3OFJA 2OTCA 1UQTA 2ODPA 2AK3A 4Y0NA 2J67A 1F5SA 1ZJ4A 3HJGA 4B31A 1H4SA 2VUSA 3WICA 2IEDA 4UPEA 3U7FB 1WMSA 2X2FA 5TIIA 1MWSA 3QA3E 2C2GA 4HEFA 2PXCA 5EMKA 1SM4A 2W83A 2ZQAA 1NE7A 5WRFA 2JLUA 4HRAA 3K70C 2I2XB 4KHPB 2FQQA 1NKTA 2X14A 4YXWD 3AL0C 1PR2A 3NATA 1GZ6A 3KSUA 3OD1A 3FNBA 1XD2A 4L08A 4U7GA 2D59A 3UMFA 1DIGA 1S2MA 1XMPA 1T18A 2JAWA 4HDKB 2ZQZA 1QRSA 3IHAA 2C5AA 2VJMB 3E2MA 4URXR 3DDHA 2ZC7A 1T10A 3IAXA 1G5IA 2QN8A 3PFIA 5I7EA 2XTZA 3SSAA 1GM5A 4IWNA 1JEJA 1HE1C 1QC5A 1CU1A 4KNVA 2BFBA 5BY2A 4MV6A 4F92B 3WS1A 2AJCA 2JGAA 2KW5A 1TVKB 4MR7A 1GQQA 3PIDA 4Y2HA 1A1SA 5EIEA 1B6TA 1Y9DA 2CMKA 2PCLA 2YKHA 2XQVA 3X1KA 2XKAA 6YASA 1THMA 3UMYA 2J07A 1J9MA 4LV1A 1QPGA 1EI9A 3KB1A 3VP2A 1PX2A 1XMXA 5HMMA 3WADA 1G20B 1HSOA 1VE6A 3MZ0A 1WSWA 1Z6QA 3AB3A 4R41A 4RZ3A 4UPVA 3DMDA 3VR4H 4LXHA 4C7XA 5AJGA 3S2IA 3WXBA 5IVIA 4LE2A 2LZ0A 1AGXA 3KQNA 1W8YA 1WR8A 5CP8A 4YQFA 4OJTA 1OI2A 3LHIA 2R6ZA 5E6UB 1OE0A 4RZXA 4W5TA 2W6JA 2OC9A 5JEEA 3CEJA 4IUYA 2JH3A 2RHLA 3MTIA 3BMOA 4MMXB 4F3LA 3P8ZA 3RYHB 3T7DA 4CLDA 1VSTA 3RRMA 4DA9A 2FG6C 4KQ9A 5IG2A 1CI9A 1HLUP 2IYUA 5BYKA 5T8KA 4FHDA 1HYGA 3HADA 2WUDA 1RM4A 3AY3A 5K3FB 2C2WA 2L4RA 4JR2A 1B26A 4MQEB 1GKIA 5EM0A 1M2OB 2B82A 3RVDA 4DDHA 1OA0A 1Q6YA 1SXJA 3P0JA 4L4SA 2Y66A 4NCXA 4DV0B 4YV7A 4IHKA 3AFOA 1XFQA 2GF2A 2R4UA 4J3JA 4DSUA 1A77A 2ASEA 4YAOA 3JCZA 3PR6A 3V2UA 5JTUA 1BE0A 2JPDA 1KWGA 3BLSA 2B8EA 3P2OA 2VN8A 5E95A 4G8DA 4N6GA 4BNKA 4KDCA 1XFAA 1M2JA 1PI5A 3LCMA 4G1FA 2OBNA 3H6HA 1XQXA 4ZT5A 3PEWA 2A9JA 2EZ9A 5A90A 4UUMA 4R8MA 2IELA 4ITRC 4OYHA 1JKIA 3RH0A 3V55A 1R9MA 4NJEA 2IYEA 4U7DA 4XUXA 1BMFA 2YUTA 4FQ7A 4P86A 4U3JB 1PR4A 4WLVA 1PJLA 2DT8A 3W3AH 3UE3A 1VE1A 4MB2A 2ZWVA 3BUSA 3A3EA 5CLIA 2AFIB 4Q9HA 3RSGA 2YVQA 3WC4A 5JQWA 1AKUA 1G7SA 1DDGA 1E2NA 3M8KA 2DJ5A 1YVEI 3G2MA 5FI7A 4FKMA 4OHBA 3MS2A 2EQ5A 4S0XA 5CIWA 5DX0A 1M6YA 3RCBA 1GFIA 1RRGA 3H1AA 1KPGA 4IZ6A 3WXMA 3LX4A 3QLVA 4J3NA 3VI4B 4A1OA 2XUZA 2NVBA 2IUUA 3F7NA 3OD5A 2REQA 2AJBA 2LPMA 1EP2B 1DJCA 2H1HA 3DPIA 3OLZA 2QR2A 4FMDB 3ZJ4A 3Q82A 3UFXA 5JCOC 5EINA 5LYJF 4QASA 2VPXA 5JNTA 1SNYA 2WWRA 2PWBA 2A0FA 1HQDA 1N92A 4EK9A 3EMDA 4IIDA 3ZWNA 1QRTA 1BLSA 3IODA 1X19A 4S12A 4Q0HA 5K0LA 1WMAA 4Z9XA 1U3UA 5GGYA 5L6LB 5HF5A 4JLNA 1GPNA 2PH7A 1PGQA 4M1OA 5SYNA 5JYCA 2Q41A 2EKDA 5DGHA 3LYHA 2ON6A 1QIJA 1NF2A 3WZLA 4RF3A 2M1CA 2EZTA 1KERA 2J3JA 2AR0A 4BV2A 4Y0TA 1E98A 5BUQA 1F6WA 4TUYA 1A4UA 2PMWB 2HWUA 4R51A 4JITA 4CT5A 3BXPA 1KI2A 3D8UA 3N2KB 3HLEA 2V1XA 5JFGA 4Q37A 4AYTA 3HUOA 3LP8A 4G65A 1Y82A 4IIJF 2XR0A 4G3VA 2ZIFA 3SNKA 3ZHBA 3R0JA 2ZR8A 5AW6A 3UMMA 4G9BA 2L18A 2QVCA 2BEUA 1GPWB 3MSCA 5EVIB 2H2IA 2V7UA 2W6QA 4Q7EA 4B8WA 3L84A 3G02A 4EEZA 3ANSA 3N8DA 3NXKA 3PUXA 4FX2A 2DBVO 4LYHA 4OP1A 4PEVA 5DKFA 3LF2A 3CTMA 4INAA 4Z9FA 1NXSA 1XX2A 4F5EA 1XNGA 4E6EA 2YWRA 1K2VN 5IHVA 3BJIC 4LF4B 4FBLA 3TSZA 4I4TA 3O4IA 1OIVA 4RX3A 2B1RA 1D2GA 5E6SA 4LXGA 3EGOA 4ZJZA 1XKTA 2BMFA 2EEPA 3OQIB 4O1MA 3EOZA 2YW2A 3UB2A 4P6BA 1P9OA 2J0EA 3KQPA 1EGHA 3NHMA 1XPJA 5EI5A 5C5DA 3KKEA 2YN0A 3RSSA 4CF7A 4L5JA 4NU8X 1FTGA 5DNEA 1S01A 3GUVA 4JMLA 3EVBA 4XXRA 1HBJA 4C0BA 1GR1A 1VOTA 1Y0BA 2Z1NA 1KKMA 1EB8A 3D6TB 3X0DA 3HY3A 3L7DA 2H0RA 4S1VA 1N2OA 2J4CA 2CB0A 3W3AD 2A1TR 1AHIA 1Z0JA 2WAXA 3HCOA 1V3TA 3O87A 2PJZA 4K0XA 3MPOA 5D84A 3UMJA 4QJ3A 4HAYA 3HN6A 3QUQA 2B83A 2FEWB 1N33B 2J59A 1RJ9A 3JSAA 1CVRA 1Q84A 4HJXA 4JP1A 4WUVA 3S4XA 1AY0A 2GZ3A 1N5JA 3C4JA 3WYGA 5ENVA 2YV3A 2QTFA 4RE5A 3UFBA 3HVKA 3HEAA 1ACMA 4CEHA 1DGQA 1N6KA 2I1QA 3MLBA 3A1FA 4HQNA 4EYQA 5J4YA 4QX6A 1SCUA 3KVYA 3LPAA 3FMVA 1TE2A 3SJBA 2IXBA 2JCVA 3DCJA 5FJIA 5L53A 3F90A 2XNHA 1PWXA 2ZM8A 5M29A 3FG8A 2OCDA 3DAYA 5A0VA 2X9GA 1YUNA 3K0EA 1N1DA 3WYAA 4DJAA 1GPUA 2COKA 1Z5NA 4GI3A 4HLUA 2VRNA 3WRYC 1N9OA 1XTUA 2B9EA 3A9RA 1M6VB 1N6RA 1RJFA 4KQRA 1BN6A 4J16A 3TE6A 3WNCA 4NKRA 2H07A 4K9SA 3TFQA 4BJHB 5JSZB 4OV6B 2JCBA 1WMEA 2JIOA 3NOTC 2FPXA 3MTGA 3RT7A 1LFDB 2UZ3A 4U9IS 4MPPA 1YIDA 4G3XA 2VF5X 4QO7A 1R2QA 5AJZA 1LLCA 1F60A 2HM7A 2W2TA 2YV2A 2ZYGA 4I1YA 2YKGA 5HZKA 1XQVA 1YZQA 2G9VA 3BWDD 4D4MA 1Z4OA 3CISA 4DRXB 5EVEA 2PKQO 1KIMA 4MI1A 5G02A 2O8BA 1FDOA 3CIOA 3OCZA 1EM8B 4YX9A 1AWIA 2RGNA 3PU6A 5DHQA 1NYMA 4UULA 2W3DA 2OMEA 4YAKA 1XLTA 5GOZA 1FX1A 2Y6UA 1HTBA 1YGYA 3NC0C 1EUQA 4WKNA 2YQ4A 1P3Y1 3AF3A 5IABA 2A92A 3SXJA 1KOLA 3D2LA 2R25B 2X8LA 2O07A 1KC3A 4GFDA 4K08A 2ZWAA 1Z5OA 1CKEA 3QUAA 4WNCA 4L4RA 4HQOA 1YDGA 2DG2A 1ZGBA 1S2DA 3N0RA 2VXBA 2YZKA 5FOVA 1E1LA 3RG8A 5EE8A 3BRCA 1JQAA 1VQQA 2XXJA 3PS9A 3B53X 3U1VA 5JS2A 2H3HA 2ISCA 5EVIC 2FUG6 2W6CX 3EJWA 1EHIA 5ESDA 3VR2D 2RH5A 4MX8A 3LBIA 1MNQA 3X1YA 4TWRA 4BX0A 5DLYA 4UTRA 3HO8A 5AW7A 4D6PA 1Z0ZA 3K31A 1K4KA 1WY5A 4C0LA 4H6JA 1OYYA 2DTXA 3MD9A 3OESA 3DP7A 4D79A 5PNTA 1UBKS 2D8AA 4U7PB 3C30A 3HBRA 3GQBB 1FE8A 3MRTA 3ELDA 4MR9B 5FHQA 3T0FA 5EECA 1JMKC 1K0FA 2IIPA 2ZP1A 4FYWA 3RSHA 2JJ1D 2HZ5A 1T5IA 5D86A 4X65B 3EWIA 4O2BB 3M70A 4Y1RA 3T1YB 5FNVA 3L6BA 4ZV4A 1GSWA 5IBQA 5C80A 3M1YA 3R6GA 2VCYA 3J7AC 3H18A 2HK8A 3AFHA 2R1TA 3AGPA 3ESDA 3UMCA 2RCNA 4EBLA 1BD3A 4MVJE 3W5CA 3OP4A 3EIHA 4XM0A 5CAEB 2B2NA 3TSCA 3RC8A 2G0AA 4MVCA 3ECSA 3MMHA 1HTTA 2DHEA 4OI2A 3VHXB 3LFUA 3HCNA 5B7PA 2P2SA 2Q6IA 1KDYA 3VMFA 2PXAA 1HOXA 3U4AA 4C08A 1Q0LA 3PHGA 1AK9A 4BAGA 2CMNA 1DEAA 2XA1A 3R9IA 5G1OA 1GY8A 4UOEA 5HPYB 2QTWB 1QHSA 2C4TA 3A1UA 4RELA 4ZWNA 3TQOA 4TM8A 3QBTA 4JQZA 4WY5A 1ZGJA 1Q2XA 2Q46A 3DOCA 4YAWA 1KAEA 1NVGA 1W6RA 3Q40A 2CZGA 3S2SA 4B3JA 1PZMA 3O8LA 3GGPA 4NYMQ 5HUJA 1J2RA 2FQYA 4BP9A 1MGOA 3JD1A 1DV2A 3MTBA 2JZCA 4V39A 4YRKA 2ZS9A 3O8QA 2WUGA 3E1GA 3A2LA 1E8NA 1YK0A 4N5DA 1G98A 3HPRA 3MT0A 5FDSA 3LV8A 3E35A 3CLHA 4TZ0A 1FRNA 4TT8A 3GLGB 1WSAA 3EASA 3NH9A 3OKAA 1HF3A 3F46A 3DHWC 4LJ4A 4MO2A 2PZ8A 2QLLA 2WSBA 1YVUA 3MRVA 3OF3A 5CW2A 4ENRA 2IUYA 2BASA 1R5NA 2FW8A 4NG4A 3SQOA 1TZMA 1YUBA 2IH4A 2HHJA 1PG5A 2Q5JA 1EW0A 4P2BA 4LRXC 2W9XA 3MJTA 4TYPA 5KYTA 3EIUA 3PYXA 3LT4A 4JN6B 1O97C 4HI4A 2EOAA 4BO3A 2RCXA 1BO6A 2NOAA 2VXOA 3PWSA 2WAAA 5CNJA 4P5DA 1G5QA 1RMTA 1RLIA 2MSCB 3QVLA 2C2KA 2W0SA 3KLOA 5HZGA 3V8MA 3RHTA 3PRJA 5G2OA 1IN4A 4DL9A 5IS1A 5E9JA 4IKOA 2WU3A 4MUEA 1QFSA 5LQJA 2RGUA 5A7FA 1OUMA 5JC8A 3DEIA 1Z2AA 3H5WA 5B6JA 1COWD 2RHGB 3B6JA 2BONA 5KWIA 2KJQA 1MQ8B 1KZ7B 3M6AA 1Z5PA 1C0IA 2N3ZA 3PEFA 1JTFA 1L3CA 2GHTA 2K6GA 1BOFA 2XVXA 1C0LA 4IQ0A 4JP5A 1P7YA 5DNUA 4LJ9A 3J80A 2GQ0A 1VRWA 2X0JA 1RRCA 3RUPA 4D82A 3DL7A 3BQ8A 3L0OA 1EFVB 2PBZA 4PVCA 4Y2SA 4IVRA 1W2GA 2VDLB 2Y2KA 1E9FA 1K25A 1PW1A 1VEUB 5FEGA 1OKKD 2PX6A 2WOJA 3A6HA 3HBLA 1I3KA 5EUMA 5F1OA 3S1AB 3ZU6A 5CVTA 1G63A 2PAAA 1E1NA 1OBCA 4IIBA 4UDOA 3WR5A 2C1EA 3NVAA 3KYBA 1UJNA 3FPBA 5KAMA 4G5RA 2R7MA 1T1CA 1HYEA 2HLHA 4IIHA 5EFOA 3LPNA 2C8VA 4KBGA 2VNSA 2ADOA 4RPIA 4M9UA 3RF6A 3H7WB 4DMGA 4OHPA 2BN4A 3IOCA 4I08A 3IEUA 4XEHA 1DCTA 1E32A 2XMGA 3AR6A 4FJ2A 1JA9A 5CYOA 2DLNA 3IHLA 1YBAA 1CULC 1LPSA 1M3SA 3GA0A 3QE4A 2D1QA 3QU4A 1G21E 4R23A 4ILEA 5JDIC 3KM0A 1CY1A 5HX9A 5IAEA 2X1MA 3ELYA 4PZZA 4J0JA 1FCMA 1DTSA 5CDUA 1C3LA 2DPGA 4B4UA 3S4YA 1AUPA 5K6TA 3AM5A 2WM9B 2WTAA 2FGJA 1UAGA 3IWIA 2A1UA 4XGQA 4K46A 3V1TC 3W9BA 4OX9Y 2BF7A 1NNUA 4EA8A 4JSTA 2YX1A 4AMYA 2P5YA 3OLYA 1DQYA 2OZLA 3QUSA 2JZNA 3NT4A 2FFJA 1RI2A 1EK6A 3FG9A 4K3VA 4CMGA 1CY0A 3OQ6A 1KE2A 4ZI7F 2D62A 3VM6A 4Y9UA 1P1FA 1ADCA 1GGHA 1JV2B 1K38A 2O2CA 2XUIA 1D6MA 2SECE 2ZQ5A 3B1WA 4GRDA 1G5HA 3EIWA 4RA7A 4L8GA 3THXA 1D4AA 3KR2A 3CW9A 5JV5A 2VA0A 5IP5A 1DT5A 2ZYWX 4QLBA 3C7UA 4M9ZA 2VSQA 3L8CA 1N2JA 2NXWA 2V5UA 4PC1A 1NBIA 4LDAA 1D4OA 2EFGA 4QDZA 5K8JB 4XWTA 1EFCA 1XMOB 5BN5B 3KTAB 2AFVA 3KVOA 1MVNA 4EFLA 5CDSA 4OOLA 5EKXA 1G5RA 4WHMA 5F69A 3VSKA 1LVHA 3BWXA 1JFVA 3L9WA 1QYIA 1DRUA 3QVUA 4JJ7A 4KO3S 4M8LA 4DPKA 1T6BY 4ZCIA 1E7MA 1OTDA 3BY8A 2XUFA 4HDMB 5HDBB 2V6IA 3AHCA 1N75A 4O5OA 3ZDQA 4D9KA 4JLWA 1UKYA 1EAYA 1QYVA 4WLAA 1XA4A 4JQYA 2OFWA 4L5BA 5J5VA 5TXGA 4CKEA 3LPDA 2BLNA 4CMJA 4ZJ3A 4WZ5A 3BWMA 3DFMA 3CZQA 5K45A 4LDZA 4PO3X 1J0XO 2O7RA 4Q02A 2EKQA 1Y3IA 2CJXA 3O8OA 2VL7A 4LFBB 4DDYA 3F9IA 3OMLA 3TLEA 3HJNA 3CPHA 4BKPA 1P61B 2LXNA 1Y1RA 2ZYSA 1OT9A 4AS3A 2EYUA 1J42A 1E2EA 2Q9UA 2GJ9A 5BRNA 3R74A 3SYMA 1OVGA 3VKWA 3VYRB 3ZXSA 4B2YA 2O8EB 2B0JA 1YO6A 3PQ7A 4TTIA 3DL0A 1NRJA 1ULAA