2WWGA

Plasmodium falciparum thymidylate kinase in complex with dgmp and adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
209
structure length
209
Chain Sequence
TDDKKKGKFIVFEGLDRSGKSTQSKLLVEYLKNNNVEVKHLYFPNRETGIGQIISKYLKMENSMSNETIHLLFSANRWEHMNEIKSLLLKGIWVVCDRYAYSGVAYSSGALNLNKTWCMNPDQGLIKPDVVFYLNVPPNYAQNRSDYGEEIYEKVETQKKIYETYKHFAHEDYWINIDATRKIEDIHNDIVKEVTKIKVEPEEFNFLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDILATE KINASE, PUTATIVE
publication title Structural Basis for the Efficient Phosphorylation of Aztmp and Dgmp by Plasmodium Falciparum Type I Thymidylate Kinase.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 78
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wwgA00
2GAOA 5KSYA 1IHUA 1NJGA 3E1SA 1UF9A 4EJSB 2ZJ2A 1F48A 2HXYA 3QEJA 2WOOA 3QSYA 4MKIA 2MSDB 3R9XA 2YYZA 2OEPA 2FG5A 2QBYB 2GTPA 2P5TB 4BZQA 3OIUA 2OLKA 1Z5ZA 3FWYA 3L0SA 3E70C 4P3YA 5DI3B 4JVLA 3ICQB 4B3FX 1ZU4A 2PH1A 5DISB 3I8XA 1XXHE 2A30A 4YLGA 1DAMA 3KZ1E 5EE9A 4TT3D 4LHVA 3U44A 3GMTA 2ZRNA 2VHTA 3NDPA 3KQNA 1N6IA 5GJVC 1MH1A 2GZDA 1E9CA 2IYQA 3T06B 3L8ZA 3ZH9B 3KJEA 1FNMA 4F7WA 1JJVA 4CDGA 4Z8XA 3AKYA 3U3RA 3L82B 5CLLA 3FE2A 3NHAA 3SEAA 3RABA 2C78A 3BFXA 3L2OB 1CU1A 2F9LA 2NO1A 2UVQA 1MR3F 4JKIA 4DUGD 3B78A 4A82A 3CF0A 4RZ3A 2EYUA 2GJKA 2CL7X 3OEEA 1TF5A 2O8CA 4UXJA 3W6OA 4Q1BA 2V7QD 3E5HA 3HP1A 2Z4RA 2GEDA 1LV7A 1PJRA 3AVVA 3DKVA 3NHBA 3IGFA 2WTUA 4Q1EA 4W7SA 2WSSA 1TPZA 4OBEA 5H68A 3PUVA 2GBLA 2ZRBA 3U61B 4EQ6B 2Q6TA 3HU2A 3AKCA 4URYR 2ORVA 2HUPA 3LWNA 4TL8A 3EWSA 2BJWA 4KCGA 2WPDA 5J4YA 3CNOA 1Z06A 3BH7A 2R6CA 1GILA 1H8HD 3EXAA 2GXQA 4GP7A 4PPNA 4RZ2A 4HAZA 2CJWA 1KSFX 5G40A 4QBIA 3RS7A 2QU8A 2WIBA 4M1WA 4XWKA 1T5LA 2CNWD 2RH5A 4LBYA 3ZYCA 1TUEA 1G8PA 3AF0A 4JL6A 4HUTA 1QVAA 1Z28A 2FSIA 3O47A 3RWMB 4CW7A 1ZBDA 4MGZR 1NG1A 1FL9A 4KO8A 2J41A 1VIYA 1VCOA 2WBLC 2V1UA 2R6AA 4Q66C 2Z5FA 1J99A 4TMWA 4EAQA 1E4YA 1UKYA 2EFHB 2ERXA 5JHGB 1E0AA 3NXSA 3AVOA 2AFHE 2WWWA 3QKTA 5FUVA 1Z08A 3SJCA 1KKLA 4MKHA 4PC6A 1JR3E 2Z83A 3VTKA 4CYMA 4MDFA 1CR0A 3AUXA 4URUR 4TTQA 2XZLA 1KTVA 4TSFA 1FMJA 1G19A 2JLRA 2PL3A 4JBYA 5L3SA 1E2LA 2F7SA 2VL7A 4L9WA 2ZI3A 4TLCA 2C03A 4GRAA 3AF2A 1JXMA 4X8HA 3QVVA 4M1YA 1KHTA 2VIIA 3VKWA 3M4YA 3K53A 4AY2A 4US2R 2D2EA 4HAWA 2BKUA 3VAAA 4XVUA 1MKYA 1V43A 1W48A 3RS4A 4A8JA 3HYTA 5KDDA 3GP8A 4JYCA 1XPUA 4KVGA 5SZKB 4LBWA 4FI3C 3WXMA 3BBPA 4V0LA 1UJ2A 5IRCD 3Q5DA 5LPNA 2V8OA 5JEDA 4C0KA 1F60A 4MUBA 3AP3A 5JFGA 1BMFD 2QSZA 4MUAA 2X19A 2JJ2D 3LD9A 5FPYA 3QXXA 4DDWA 2ORWA 4KXFB 4P4UA 2EYQA 3NIBA 4B2IA 3W3ZB 3L43A 5A4JA 3RAPR 1T91A 4RD6A 1P4SA 2IWHA 3L0OA 2X1VA 5EXTA 4B6FA 1ZW6A 5HKKA 2J5XA 4YXWD 4IHQA 2ATVA 1M8PA 1RYFA 3A1WA 1VECA 3UG6A 1Z63A 2ASEA 3BS4A 4Q19A 4MH0R 2CBZA 1EFRA 3TMKA 2GDJA 1NKTA 3FHTA 4E03A 4TLBA 1TQ6A 2CJWB 2CL6X 3LO5A 2DCUA 3GJ8A 4UNPA 3KXLA 3OEHD 4LGMA 1NMYA 1OKKA 4HB4A 4IOMA 4Q1AA 3GEHA 2W6JD 4HSEA 3KX2A 4V0MA 1MO4A 3SR0A 1T8TA 4OQXA 2IYLD 3QPVA 3AV0B 2WJIA 3SHWA 3Q7PA 4AWXA 3IBGA 4XD7A 1ANKA 2EW1A 3FKSD 1EFHA 2ODEA 3LLUA 2OBLA 4DB4A 3TGPA 4GFDA 2BHRA 3DM9B 2EVWX 4WZAE 4DJTA 4GZMA 1DADA 2GJAA 3CWZA 5FBRB 2ZE6A 3WP0A 1FW6A 1E69A 4EPVA 5EP4A 4AG5A 1OFTA 1TF2A 3X1YA 2QPAA 1BIFA 4OQLA 4CEJA 4I1VA 3GJ0A 2W58A 3RHFA 2VP6A 4W5WA 4ERNA 2YV5A 2XNDA 4N3NA 5BWMA 3AH8A 3FOZA 4R9UC 4JVMA 2YWEA 1AZSC 2FN4A 4BLQA 4ABYA 4HLCA 4ZV4A 1J90A 3RRNA 2CEAA 1UKVY 5AJWA 1JEEA 3IIKA 4IDQA 1BH2A 1Q1ZA 2W6ID 3MWLA 3U6BA 1WA5A 1CBUA 1CJVC 2CHVA 1ZRHA 3I3SR 2H92A 4OHXA 3SN6A 3EAQA 1PLKA 1TQ2A 3L8YA 3LNCA 3EA0A 4JYBA 2UKDA 2C9OA 3DL0A 2FU5C 2ZUCA 1GWNA 4BE7B 4ZIRB 4WZ6A 1A5TA 5BN4A 4PC7A 1E79D 4DCSA 1G18A 2CLDX 2Q9AA 1W5TA 5H8WA 4C0QC 4EPTA 1YR9A 4Q5IA 1E2GA 3UKDA 1NLFA 5GVSA 1IONA 4NYJQ 5EXPA 3RSOA 2V6IA 5JSZA 2F1IA 3TUJC 5F3WB 4F92B 2JAQA 4AC9A 4Q4JA 4LUCA 5FUYA 1KI7A 2QUZA 621PA 4UJ3A 2J59A 5FI1B 1IJEA 2QT0A 3T5DA 1XTIA 3KB2A 1MO3A 4I1SA 3ZVLA 1ZC4A 5DGXA 2PLFA 2ZSAA 2OXRA 5DN6D 2FGKA 4B71A 2BDTA 5B64A 1N6HA 1Z6TA 1V5WA 2XSZD 3SFVA 4IEIA 5L3QA 3MSXA 2ODWA 4H1VA 1O87A 3TRFA 5KOYA 3K9HA 1XNJA 4Q7KA 2PZGA 1XZPA 2ZRFA 4B48A 4TQ9A 5JEEA 3K70D 2QSYA 4DLVA 1IAQA 2RMKA 1G4UR 3BFKA 2G6BA 3LXXA 2QL6A 2OCYC 1R0ZA 4U5XA 4ZCIA 1DAKA 4V0NA 1Z0KA 2CVFA 1P7CA 1Q3HA 4A4DA 5TVKA 1GNRA 1N5KA 1ZUNB 2ZROA 4IDOA 2R44A 1HE1C 2ZYTX 5AUNB 3SHFA 2FSHA 1YZKA 4RD2A 3REFA 1J7KA 1Y3AA 5DE3A 4U00A 2WOJA 5HE8A 2BM1A 4I1UA 2V3CC 3MGCA 4BZPA 2WHXA 3U44B 1E0JA 1II9A 3Q7QA 2FA9A 4QJ4A 3T34A 4TYYA 2HCJB 2VHCA 2XITA 4Z1MD 2W2TA 3CH4B 2XEXA 3PXGA 1A1VA 2ZRMA 3OAAD 1K8RA 4PSAA 1EFRD 2PMDA 3HDTA 2FDCA 4ZCLA 3M6AA 4MRRA 5SZHB 1IN6A 1DAIA 1UBCA 2G9NA 1NRJB 1QHGA 3LAWA 1AQUA 3QKRA 4PHGA 4PZZA 3RS3A 3IIJA 4TMXA 3HJNA 2P67A 2GAAA 2VSXA 2ANBA 1F5NA 3ZIAA 1XBTA 4PZLA 2ORIA 2IYYA 4D82A 1CULC 4URZR 1NIJA 3A37A 3T61A 3THXB 2IS4A 2HYIC 2OG2A 2KE5A 1KI4A 2GNOA 4PQFA 5HZHA 4FWTA 3OIYA 4LBVA 3A1SA 4TL7A 5CK4A 3X1WA 1YHNA 1ESMA 1HYQA 4URVR 5C4MA 4P33A 1T6NA 1BS1A 4MYUA 3IBYA 2GCOA 4NCHA 3W9YA 4RZXA 1TUIA 2J0SA 4MYCA 4E5UA 5L3QB 2HJVA 4M4SA 4HLDA 1R10A 4J0QA 5EE1A 5JWOA 4N0EA 2JJ2A 1A2BA 3GLGE 2F1JA 4PC1A 1YR7A 1RFLA 5GJBA 1VG8A 1XPRA 3FPAA 3B1XA 3M1IA 1VG1A 3W3AA 521PA 3WRXC 3SBEA 1EGAA 3DMNA 4IVQA 3SJZA 1DE0A 3MWKA 1KZGB 3P26A 3BC1A 3BGWA 2JJ8A 2A5DA 5K8LA 3O8BA 4HAXA 1DVRA 4EFLA 2XTNA 5KDOA 3R9WA 2ZUBA 2IXFA 3QQ5A 1E2EA 2QPTA 4GSYA 2A7QA 2X2FA 1N6OA 3AVQA 3ZVNA 3FHOA 1OH6A 2A2ZA 3B7GA 2GA8A 3MJHA 3CWQA 4QHTA 1KGDA 2QENA 1GUAA 1A2KC 3GCGA 5L8VA 1WBDA 1AM4D 4Q4HB 2AFIE 4ZPXA 2YJTD 3ZD6A 4O3MA 2BWJA 1R6BX 3FHCB 4MRSA 2IS2A 1XCGB 2ZSEA 4CGZA 3PV0A 1WP9A 1G7CA 1NG9A 5LB2A 2HLDD 1W0KD 1GRRA 1NN5A 1G17A 1M7HA 2PBRA 3OIWA 3I5XA 2O8EB 1WE2A 4KFSA 5HTKA 4RD0A 4HZUB 2GEUA 4FINA 4DXAA 1RYHA 4US0R 3WYFA 2GXUA 2ZRGA 3LW7A 3A4NA 3MD0A 3RSLA 2J7PD 1HT1E 5LDDC 2ZAMA 2QI9C 4FMDF 2GESA 2OZEA 4FCTA 3LX8A 5JJKA 2PMKA 1IY1A 4NDZA 5AJYA 1G21E 5EUQB 1Z0DA 1U2RA 2ZJOA 3B5JA 3E2IA 1YQTA 5CK5A 5KPJA 1OB2A 3I62A 5M04A 5FPTA 5GVRA 1Z29A 4NONA 2XB4A 2RHMA 3LDAA 3Q72A 2PJRA 3KKOA 4LCBA 1RRGA 2G88A 5SZIA 3KJGA 2PZEA 2IHBA 3AP2A 3OHMA 2RGXA 1L2TA 3OESA 4W9MC 3CH5A 2ZE8A 3R7WB 3T35A 2B21A 1WRBA 1GG2A 1XDBA 1SVOA 2OV2A 3BORA 5LBIA 5DO9A 1YZLA 4C4PA 5TMPA 5BYKA 2PT7A 2O0HA 4NHOA 3N2IA 3ZS8A 1SHZA 1GRNA 1NBMA 2EFGA 2VLIA 1ZNZA 2A5GA 2OESA 1AGPA 3SYNA 5E3HA 1U99A 3X1ZA 4EIWA 3GLGB 5LB4A 4KLNA 4IVPA 4TT3A 4BFVA 2XAUA 4LC1A 1E2QA 3LA6A 1OW3B 1G5RA 5FPSA 2BVNA 5B57C 1Q44A 1IJFA 4EKDA 2AWOA 3QXSA 4CEHB 1YE8A 2CMKA 3EPLA 2W0MA 2D3WA 1X8JA 4JLBA 4LYFA 3HYRA 4TTRA 1WF3A 2VP0A 5AR1A 5AWFC 2J87A 5EZ6B 1OT3A 3QENA 5IT5A 4JLVA 4BLTA 2QP9X 1QHHA 2WM9B 1TU3A 3Q5EA 4I99A 1C1YA 3NEYA 1R5NA 1WQ1R 1WBBA 2P65A 2OSBA 1Z0JA 2PCJA 5EJEA 1NLZA 1S3GA 3EX7C 5DN6A 4OJQA 1SULA 2Q0HA 1N25A 1W2GA 3AVYA 3VHXA 4D0GA 3M0EA 5AJZA 4IW3B 2PCLA 5L3RA 3K9GA 3SJAA 1XEFA 2B8WA 5FOXA 4FMDB 4BASA 1CEEA 5CJ2A 1JXOA 3ADCA 1NN1A 5CM8B 4LRWA 3SS8A 1F2TB 4Q00A 1EFTA 1MABB 1SGWA 3CPEA 4TZ6A 2FPKA 4HB3A 1EX6A 4Z51A 2V54A 1ZU5A 2RB4A 3AVTA 1FMLA 1GIAA 3LBNA 1Q21A 1QZXA 4HYYA 3A4LA 5SZJA 4DLTA 3CRMA 4OKSA 1KI2A 2HF9A 2ZR9A 3GLHE 4ASUD 3RRMA 2Q3FA 4ZDWA 2EWWA 4D80A 1OH7A 2AXNA 1N0VC 1KI9A 4LSGA 4ARZA 3H4MA 1SXJD 1J2JA 1AIPA 2GWHA 4NYJR 3GJXC 3GLIB 4KFTA 1ODFA 4C9BA 4EPRA 1XB2A 3A1TA 2GJSA 5JCZA 2JLXA 2PT5A 2QZ4A 3CZQA 2LKCA 4LHZA 1FTNA 1R8QA 1W44A 4IDNA 4LWZA 4HB0A 1OFUX 3RWOA 2ZI6A 5JBQA 3VX3A 2QY9A 1OIVA 2OAQ1 1L4YA 3KXKA 4JZKA 4YMSA 5G3YA 5UKDA 3A6PC 1E2DA 3SOPA 3WMFA 1R4AA 3I4LA 5GJWC 2FWRA 1XU4A 2AK2A 4A92A 1UKEA 1ZUHA 3KQHA 4LHYA 4XOIA 2H5EA 3VHLB 4A2QA 3EPKA 1UDWA 4AKIA 4B33A 4US1R 1U90A 1KI6B 2Z0MA 3NWJA 1CJTC 4BGDA 4B44A 1XJ0A 3VMFA 2FNAA 4BFTA 3MAAC 2DWOA 4ON9A 3THWB 3KUCA 4BFZA 5L3VA 1D5CA 3GEIA 1NLYA 3SU8A 3R8CA 1GL7A 1U9IA 4TZ0A 2NPIA 2NIPA 4DB2A 2J0QA 4MGYR 3R8FA 4NU0A 4DCTA 4EJSA 3UANA 4A15A 1P73A 3NG1A 2FX3A 1TEVA 3H1TA 1KIMA 1T8UA 4JSTA 1VG9B 4IDHA 4N0DA 1DAGA 2W83A 1P5ZB 2LWIA 1NP6A 4D4JA 1TADA 2FSFA 5DI3A 3ADBA 3ZQJA 3U7FB 3ZD7A 3UPUA 1KOFA 3Q8XB 2R65A 4M0LA 1UM8A 1G7TA 4YMWA 1ZM3A 2ZE5A 1NY6A 1AN0A 2ZANA 4OK6A 2WWFA 2HYDA 1IN7A 4DKXA 1HQCA 5P21A 3OIVA 1DAEA 1M74A 2ZJBA 1SHKA 4RSGA 5KSZA 3DEFA 4M1KA 1KY2A 3PFIA 4XSGA 121PA 4HUQB 1R2QA 1OXTA 1UEJA 4DDVA 4KBFA 4Q48A 2BKEA 1ONBA 3B1VA 5IK2A 1DAFA 1G5PA 5EZ5A 3WMGA 3AGPA 1XJQA 2O8BA 1VYUA 2KWIA 4HDCA 4MKFA 3LH5A 3GFOA 2O8DB 1GL6A 5CIWA 4ZKDA 5HCNA 3IEUA 3PJRA 3KJIA 4RVCA 3B8HA 4B3DA 1IXZA 2JLVA 1Q1EA 2P6NA 3GPLA 4XIGS 4QM7A 2E87A 1JB1A 5JCPA 4HB2A 1P9RA 1SXJC 2KB0A 1II8A 2RKOA 3O8DA 3I72A 3ZJYA 2OLJA 2NO9A 1UDXA 2PX3A 2E1RA 5KNBA 1LS1A 1OXXK 3BB1A 4QRHA 2QM7A 4MQBA 4IKEA 4NCNA 4X8LA 2BMDA 3ND9A 2J9RA 1UPTA 1SVLA 4A0FA 2DB3A 1IY2A 4OHYA 2ZJ8A 3FKQA 4AKHA 5JS7A 3PUWA 4R7ZA 3LBIA 3T1QA 1W47A 3QY0A 3T1OA 2A3RA 2ZYUX 3CB4A 2OUKA 4IFEA 1B23P 1XTQA 2AXPA 2VRWA 4FMCF 1OH5A 4TMZA 2JLYA 1KI8A 4LHXA 1E2IA 2RGNC 2RGNA 3TLXA 2FEMA 2GCPA 1TAGA 1CP2A 4GOXA 3FFBA 4JMPA 2CE2X 5E4FA 4GL2A 1GKUB 3A36A 4QL3A 3SYKA 2F1HA 3U6KA 2JGNA 2WSMA 5FBLB 4WZBE 1D9XA 3I73A 1AA9A 5JWRA 1Z8FA 1BOFA 3JVVA 5L3SB 1CR2A 5JWHA 1M2OB 4TTPA 2J0UA 4F4JA 1SXJB 4B43A 3AF1A 5KTYA 2YWFA 3TAHA 4JLMA 2OE2A 4C2UA 1KK0A 1X1SA 2VP2A 1KAOA 2DBYA 5FL7D 2VP4A 4AG6A 5JHHB 1TQDA 2FH5B 2CDNA 3C8UA 4NYIR 1FUKA 1XEXA 4PTLA 2YWHA 4I4LA 1UEIA 1G7RA 2RGDA 4OQFA 3EWAA 2CE7A 4LZZA 4PFSA 1N5IA 4IJMA 2ZJZA 3GLGA 1YR8A 3TW8B 1XWIA 1XD2A 2C98A 1P9NA 1G7SA 3C41J 4CT4B 1N0UA 4DZZA 1BKDR 3EZ6A 1R7RA 4TQUS 2AX4A 1G3MA 1GKYA 1P72A 1SVIA 1U8ZA 2DY1A 4MYTA 1FNNA 2FE4A 3CKLA 5K8IA 2WWIA 2R2AA 3NH6A 3QF4B 1U0LA 2BMFA 5HPYB 4ZI3A 1JEDA 1N6LA 4TLAA 3NKVA 2D7CA 1HUQA 2BM0A 4TLEA 1GDDA 1NKSA 3THYB 2AK3A 2P0EA 5D3QA 1OYWA 4URXR 4ZDKA 1ZIPA 2Y8EA 4PHTA 2VQSA 1I2MA 3PUZA 4JVSB 2JIZD 1MRNA 2K5UA 4NL4H 3ADKA 4PAMA 2J46A 2I1VB 2WJHA 6Q21A 1M7GA 2IHYA 1DG1G 2HXSA 2Q3MA 4TSFD 4UNRA 4PPQA 2F9MA 4DIEA 4TMTA 3IHWA 3VU9B 2VHJA 1DAHA 1G64A 3NVAA 1QHYA 1TTTA 1PV4A 2D7DA 3I1FA 3SYLA 4QJ3A 3UIEA 1US8B 2QQEA 4OYHA 1EXMA 3TQCA 2QAGB 4XSHA 3RRZA 3FYHA 1BYUA 3IQXA 2GVZC 1OHHA 1XTKA 2QE7A 3K70B 1Q1BA 3F5FA 3QBTA 3WBKA 5JI3E 1JPJA 1UBFA 3BB3A 3IQWA 3TSWA 1TQ4A 4QNRA 1NSFA 2GJ9A 2HT6A 1U94A 4RFVA 2I1QA 3CRW1 5JSZB 2F3TA 5J4KA 3AF3A 1ZM4A 4MYHA 1JR3D 4JT2A 2NO6A 4DSTA 5JLJA 1KJZA 2IS6A 5FOUA 2ZTSA 3EZFA 1ZM9A 4WXPA 4ZI2A 5JJIA 4LYJA 4LJ9A 3CUEF 1P2VA 4DLZA 1KYIA 2VBCA 4YMTA 2D4HA 5F2EA 3GJ6A 2NO0A 1W4AA 1E94E 1Z0IA 5B2ZA 2QP3A 2ZUDA 2WV9A 4BEJA 4W5HA 3BXZA 3CBQA 3ECCA 2GCNA 2XTMA 1YZUA 4UXIA 1GZSA 4QXAA 3B9QA 2Q9CA 4II7A 4IEEA 1WDTA 2IYTA 2XX3A 4DWJA 2O0KA 5BW8A 3FGNA 4Y0AA 3W8RA 4G01B 5TDHA 1S8FA 1XJCA 3MRSA 4JBWA 4YMVA 4KITB 3V00A 1I4DD 3OFNA 1T3HA 2IK8A 2VHUA 3P27A 4D26A 4KLZA 1NJFA 1Z22A 3MWYW 1RW4A 3UG7A 1ZC3A 1Q57A 3S1AA 1D2EA 1O3YA 1XMSA 3GJ3A 4RFSA 1VTKA 2NO7A 4YDHB 4XD7D 2WSSD 4AK9A 5KO2A 3OF5A 3W6NA 3NDBB 1NBMD 4OQNA 1HQYE 4WBSA 2ZI4A 1ZMXA 4UNNA 1ZYUA 5FL7A 4D0NA 4DIDA 2GK6A 3I8SA 1W4BA 2IYXA 1RJ9B 5IK2D 4AYWA 3VU9A 4DUGA 2QMUA 4JL5A 1E99A 1LVGA 2R8RA 5KHOC 1EESA 4XH9B 2GETA 2ANCA 1X3SA 1N6KA 4HDOB 2C2HA 2CK3A 2WMOB 1E2FA 3ZVMA 4QNMA 2QPOA 1CLUA 4MGKR 3QXJA 1LFDB 5EE5B 1XRJA 4XVRA 1JALA 3GLHA 1DS6A 1FP6A 1UBGA 5FTNA 2NQ2C 1W49A 4C0JA 2WAYA 1YRAA 1VPLA 2UZIR 2QTFA 2J7PA 1YZNA 1DO2A 5CYOA 1KK3A 2MSEB 2F55A 4NZYA 2IYUA 3CLVA 3K70C 1U0HC 3AVPA 1NVVQ 2WIAA 4G0NA 2DHRA 3K8YA 4G5OA 1ZD9A 4WOPA 1IN4A 1ZAKA 8OHMA 2YOHA 3F8TA 4HEJA 1IQPA 3U3OA 4U7DA 3AQ4A 4JKYA 4N1AA 3UATA 1S3SA 1KO5A 1NSTA 4CEIB 1ZCBA 4TYQA 3AF4A 1VCIA 4DSNA 4F93B 2QRNA 1ZUIA 3UMRA 3LFUA 5EQTA 4RKFA 2AWNA 3OAAA 1NVUQ 1ZVQA 2OCBA 1Z0AA 1SZPA 1ZIOA 3B6EA 4QM6A 1DBSA 3VNUA 1E9BA 2ZR0A 1OIWA 3F0TA 2OT3B 4LPKA 1NF3A 3SBDA 4PAQA 1PZNA 4FCWA 4HATA 3REGA 3WHKA 1G4AE 4LYHA 1H8HA 3K0CC 1QHNA 1OYYA 3THWA 4Q7JB 4E22A 3CX8A 2IL1A 4LJ6A 2W0SA 1CJKC 2YINC 1S4QA 2P3SA 4P4TA 3CX7A 4B74A 4MRPA 4D4LA 1G9XA 4PZYA 1WMSA 4C30A 5DHFA 1E2PA 1ZJ6A 2GHIA 4Q47A 1KAGA 1COWD 3I5YA 4B3GA 1QHSA 1N6NA 5HCIA 4QJ5A 4NE2A 5JRZA 1E2NA 3N70A 1DTSA 3W8NA 4KV9A 3O8CA 3CF6R 1N3BA 1NVXQ 3CW2A 1RIFA 2IWRA 4GPTA 4FCVA 3B1ZA 3NTUA 4JVNA 3X1DA 2L0XA 2CCJA 2DWPA 2VEDA 5J5CA 4CZ2A 4HAYA 4F91B 3K0FB 4OHVA 4UNQA 5FTKA 2ZREA 3RS0A 2C9YA 1VDZA 1P9WA 3ZIAD 3PG5A 1OV4A 1EWQA 3NC1C 1ZD8A 1KMHB 1XEWX 4JLOA 2ZI7A 4Y0VA 5DSZA 1VG0B 3SDZA 3ICEA 4Q4AB 3OE7A 2WWHA 4EUNA 2JIZA 2YC4C 5EE0A 3QG1A 3THOA 1L7VC 2IUTA 3NBZC 2FZ4A 1Z6YA 3KKQA 4HUQA 1XD8A 3RVBA 4A6PA 3PEUA 2QEQA 4DT1A 4A1FA 3JZAA 1T3LA 2QM8A 4P0TA 1XTSA 3DMDA 1AKYA 5E95A 1W4CA 4BFXA 2ZU6A 4IXNA 2RGAA 3UWKA 5JS8A 2JLWA 4OK3A 1FQJA 1XMVA 3SI7A 2FFAA 1GOTA 2ZSDA 1KNXA 1Z6GA 3KTAB 2W2XA 2FGJA 2PEYA 1UFQA 4DC9A 2LKDA 3IUYA 4PANA 1TMKA 3AVXA 4DSUA 2RHDA 1TU4A 4P32A 5KSOA 2RGEA 1XD2B 3GJ4A 3NC0C 1NBME 2IYWA 3B13B 2ZITA 2QQ0A 5J4LA 4M1SA 5IF9A 4BUJA 4ESVA 4DEYA 1DELA 2JLSA 1U8AA 3QEOA 1XMIA 3BD9A 2F43B 1W46A 3EARA 4O25A 1OXVA 2H57A 4IXMA 3THYA 1W0JD 1OKKD 2ZJYA 4M9QA 5C4GB 5J47A 1WB9A 2BOVA 5A0FA 2BMJA 2G77B 2ONKA 2IUUA 2H7VA 1P2TA 3QUSA 1P3JA 2E9SA 2WVJA 5FTJA 1Q12A 3EW9A 3UMFA 1GAJA 2ZE7A 3CRQA 1FX0B 3P4XA 2DFKB 2C5LA 3K09C 2G0TA 4DLYA 2XXAB 2Q21A 1CF4A 2IT1A 4KI0A 1US8A 1UADA 1VCNA 4QGAA 5E7JA 5EP3A 1H65A 4GMXA 4CIDA 3GJ7A 5FUWA 2QROA 2BCGY 1OE0A 1KMHA 1M7BA 2WJVA 2RAPA 4PPFA 2FEOA 4NBSA 2WJGA 3U7EB 2ZRHA 3AVWA 3NBFA 2XSZA 1HY3A 2JJ1D 4CEHA 3C15C 4B3BA 2NPFA 1OPXA 4H1UA 3AVUA 3QPWA 2W6IA 2XTZA 1G16A 2OO7A 3MFYA 4W5JA 1RRCA 5D3MA 4PQYA 2O52A 4M21A 3BFVA 4Q9HA 4M1OA 4PR0A 5BN3A 2JATA 4QBGB 4XJXA 1KSJA 5AJXA 2QA5A 1N6RA 2NTYC 221PA 1X8KA 1JR6A 1SVKA 1KO1A 1E79A 4Q1DA 2QT1A 4LOAA 3QKUA 5FBVB 2GILA 1D8TA 1YRBA 2OXCA 4KBGA 1W1WA 3P20A 4B73A 2NOAA 4PHFA 1OXUA 3FMPB 1CXZA 4Q9KA 3BK7A 3T12A 3EZ2A 5LD2B 5EP1A 2VH5R 3RYTC 2VF8A 1KJWA 4QG7A 3TW4A 2GK7A 4L9SA 5C46F 1ELOA 3IPYA 5CB6A 5KNCA 1KO7A 2JJ1A 1EX7A 3BH6A 2OBNA 3U3KA 3KXIA 2QRZA 1K5DA 2FFBA 3S1AB 3GLFE 3V4RA 4R71A 2H1LA 5LD2C 3BE4A 3BH0A 5H1YA 3TBKA 2DFTA 3NEJA 2ZRPA 2CXXA 1JAIA 2VTKA 5FOVA 4G5GA 4ZCMA 3NH9A 2CCGA 2YNMA 3IO5A 4KFRA 1BO6A 4PSKA 5ANRB 4DCUA 3EPJA 2C9CA 3LLMA 4TN1A 1RJ9A 3THXA 5J4HA 3Q85A 2P6UA 1R5OA 1HURA 3T1TA 4OI2A 3B82A 1JNYA 2A78A 3H84A 1PLLA 4RJLA 4OJKA 2H18A 4M9ZA 1VIAA 2XZOA 4BECA 1Q0UA 1IM2A 1WXQA 2WZQA 3C5HA 4UJ5A 4A0GA 4AYXA 5DNYB 4HAVA 3HPQA 2QP4A 4AURA 1VMAA 1KNQA 3RRYA 2BV3A 3VR4A 2WPDD 3EZ9A 3IDQA 4BLSA 2ECKA 4D0LB 1G41A 4LJ8A 3C5CA 3GLHB 2ZRIA 3TJZA 3QXHA 4G1UC 1LTQA 4DCVA 2ZRDA 3TVTA 3ASZA 3KQKA 4B2LA 2Q9BA 5TARA 4DLWA 4P4SB 5FPHA 1DEKA 4ITRC 1XZQA 4RZUA 1X1RA 2O8BB 2IEZA 1XF9A 4M1MA 1CRQA 4WA7A 1I4TD 4Q1CA 3ADDA 3C4JA 4KYIB 4IVRA 1ESNA 2IEYA 4CVNA 3OEHA 4EPWA 5FUXA 3H2YA 2XZPA 4K46A 3VR1A 3SQXA 2IYVA 1U8YA 3LQQA 3PEVA 1N0WA 4KVAA 3SQWA 4X8MA 1U9IC 1CIPA 4E07A 1GM5A 1IY0A 1FP7A 4DRZA 2DYKA 3DHWC 4Q18A 4B34A 2OILA 2VF7A 3I32A 1L4UA 4QGHA 1HT2E 2UZ3A 3CRRA 2V6JA 2CK3D 1N6PA 4DDUA 2VSFA 3V9PA 1OSNA 2NMVA 1GP2A 1T0JB 3IEVA 1NIPA 4UXHA 1C4OA 4PC3A 2ZRKA 1G5TA 2CHGA 3VQTA 4DLSA 2I3BA 4AKEA 2IC5A 1IXRC 2REOA 3FVQA 5AUQA 1H8EA 4GOKA 3W5IA 1GVNB 5FOSA 1CR1A 1S0UA 4FWIB 4RKEA 3V4FA 4C0SA 4URWR 5KYKA 5TY0A 1RZ3A 4A0RA 1E9SA 2KI5A 4GMDA 5FBWB 1CTQA 2F43A 3MG9A 1II8B 3AKEA 4FMBB 3K09A 2OAP1 4ESHA 1OIXA 1Q1QA 2EFEB 4ZKEA 3SNHA 4I81A 5F9HA 4Q4JB 2JLQA 4KJZA 4EFNA 5FTLA 3GLIE 1S9DA 5KUTA 3B1WA 2DFNA 2PEZA 4M53A 3PUXA 2ZPTX 4TLDA 1YKSA 4FIDA 4G5RA 2P2LA 1HH4A 1E1RD 2P5SA 1RC8A 1L8QA 4GNKA 2ZETA 2IYRA 4K8OA 1E2MA 3GLFA 1WCV1 3KJHA 4NP6A 4A2PA 4QC2A 4CRWB 3BERA 4OHZA 2AN9A 4TQAA 2OCAA 1SQ5A 4HDQB 4D81A 3SFZA 1HEIA 1AZTA 3IPXA 1E1QD 2GRJA 4GZLA 4LDJA 4B3CA 2G0NA 2JDID 1UKZA 4PXAA 4BFUA 3Q3JB 5HZKA 3CRVA 4B76A 3U7HB 2VYFA 2ERYA 2J45A 3CR7A 2CVHA 3KTAA 3JZMA 2D06A 3HPRA 4PQRA 2J0UB 2Z6VA 4FMCB 4POAA 2O8FB 3HU3A 4ARZB 3D8BA 1KDOA 1W36C 1PUIA 2CLCX 1B0UA 3TIFA 3QKSA 4LYAA 4Z1MA 1QG4A 2CLSA 3R20A 1Q20A 4E09A 3CNLA 4BFSA 5DHAA 2H16A 5FI0B 2ZYVX 1GL9B 4HLUC 3QF7A 2QNRA 2WICA 4NYIQ 1AK2A 5AUPB 3WHLA 4KYUA 421PA 1LS6A 3O8RA 1VCMA 2ODNA 1P61B 2B6HA 3FTQA 2HV8A 1AS0A 3EG5A 1YR6A 3G5UA 5CDFA 4IRUB 2KSQA 2FV8A 4V0ME 4DCNA 1QHIA 4B47A 3B9PA 3KUDA 2NG1A 2PLRA 5G53C 1T4GA 1GKIA 4O2LA 4V0KA 1F2UB 1E98A 3K0FA 3TUZC 3LBHA 2NZ8A 5BN5A 4Q01A 1SVMA 2EQBA 5FOWA 3U5ZB 3TNFA 2ONJA 3U60B 1KI1A 1VKJA 1RE0A 3CO5A 4U02A 2FFHA 2F3RA 5E7IA 3DM5A 3FFAA 2KJQA 4JJKA 3RC8A 4LY6A 1CS4C 1JBKA 2G1KA 3AKDA 1MO5A 4GDFA 3WNBA 1S1CA 2IF0A 2HCBA 4KSCA 3KL4A 3DOEA 4JLJA 2R6GA 1OF1A 4Q4LA 1AJEA 2QTHA 3EA5A 3CF2A 1E32A 2FFQA 3GFPA 5DYIA 3ZVRA 4AYTA 3G0HA 2ZSFA 4QGFA 4ACAA 1S9HA 1AQYA 5CYPA 2IXEA 2A5FA 3RDPA 2GBLC 1BMFA 4MA4A 3U4QB 2J3EA 5FPKA 3GLIA 4Z8YA 1S96A 4DBLC 5CIQA 1DO0A 4NYMR 3T15A 1FFHA 4L15A 4AD8A 2B92A 3KKMA 4WIAA 1XP8A 1S1MA 2R6DA 2YC2C 3WYGA 2FPMA 3IHLA 2ZI9A 1G3IA 5CM9C 3UMSA 4TYWA 3QNUA 5BYJA 2FPLA 1VYTA 5AK0A 3KFVA 3NBXX 3QVUA 1ZD1A 3BIFA 1XXHB 3PEYA 4XWAA 3U4QA 4KFUA 4YONB 3ETLA 1JECA 2IYSA 4NH0A 2BJVA 2JLUA 2WWXA 1Z0FA 5AUOB 2YOGA 4DLRA 1R8SA 3ND8A 4OK5A 1GNQA 1TNDA 1KDPA 4Q21A 3QJYA 3BAFA 3DZDA 2IYZA 1U98A 5TXGA 1IOZA 1COWA 2J7KA 4JS0A 2JLZA 5F98A 5DLQC 4JSYA 5C2JB 1RVDA 1RRFA 4PO9A 1G8FA 2OM2A 3TSZA 1KI6A 1S2MA 2AD1A 2GZAA 1E1QA 1U81A 3BOSA 3T1VA 3PENA 2VHQA 3K0AB 1GITA 2AKAB 2O0JA 1EWRA 1F2UA 2GJ8A 4KHZA 3ZQ6A 4LJ5A 4AKGA 3VR3A 2N1BA 5BXQC 5C1BA 3B2EA 4O0MA 1YVDA 1DG3A 4LK2A 5J4VA 2X77A 2ZS7A 3ASYA 3FB4A 2ZAOA 1KSGA 2YZ2A 1G8YA 5FR2A 4XTRA 2QGZA 3DDCA 3IIMA 2WAXA 4TMKA 1E0SA 2QG6A 2VP5A 4HI0E 5JJLA 1JI0A 5IHPA 3B85A 1XMJA 2AL7A 2ZJ5A 1LW7A 4PX9A 1W7AA 2GZHA 4C7OA 1IN8A 2DWQA 1M1YE 2YOFA 5DI9A 3RS2A 1G6HA 2ZRCA 1OXSC 1Y63A 3C14C 2ZIAA 3K0EA 1SXJE 4LV5B 3X1XA 1YZQA 1DOAA 4BFWA 3EC1A 1GRQA 1ZNYA 2XNDD 2DFLA 1W36B 2A5JA 4BLRA 1QBKC 1AKEA 4A6XA 2IW3A 3CONA 4P4SA 2PZFA 2B7CA 2QORA 2WWGA 3LVRE 4C3ZA 2QBYA 4LV6A 2V55B 3KDSE 4C7OB 4C0HA 1LY1A 5FFMA 721PA 2FSGA 2AHOA 2FJUA 1DPFA 1G8HA 3UXMA 4PAOA 5G41A 3H86A 1CJMA 4IFBA 4AI6A 4BFYA 4MRVA 2F6RA 1II0A 3SE0A 4LJ4A 4FN5A 4DLUA 2ATXA 1LB1B 2QMHA 2B7BA 1XPOA 4V02A 3Q9LA 5DIFA 1Z2AA 1SKYE 1T5IA 1XTJA 1NL3A 1PLJA 2D62A 3DOFA 1E96A 3LY5A 4ZIRA 2EFDB 5EP2A 5TV2A 1KK1A 2REBA 1U0JA 4UQOA 5JECA 1EFUA 1QHHB 3GQBA 4OHWA 5FBQB 3LVQE 5E7MA 4JLPA 2HJGA 3QIAA 5DH9A 1E6CA 4P31A 1QDEA 3ZLJA 4JT4A 2ZXUA 1SVWA 2H8KA 5KDLA 5KSPA 4CT5A 4C0BA 2IBMA 4B35A 3SC3A 3TQFA 2HEIA 1Z2CA 4DSOA 4NCJA 4PSVA 1E9RA 1KO4A 2KBFA 1JJ7A 3DVLA 3LQRA 2FMXA 4Q4AA 1P6XA 4LJYA 1J8MF 1X6VA 4PC2A 2XXAA 4RY2A 4B32A 4MKGA 1NVWQ 3U7GA 1Z47A 5H70A 3TUIC 1K5GA 3WYAA 3W90A 3TH5A 5B30A 2XNSA 1OFIA 4G5QA 1D2MA 3SZRA 2XGJA 4ASUA 1TL7C 3R7WA 1EG7A 1XCMA 3D6TB 4S2EA 1JQLB 2N46A 3K9LA 1Z07A 3TSOA 2OHFA 2OBMA 4HLQB 3CIOA 1VYVA 4TL6A 4OI0A 5FR1A 4YQFA 4RD4A 1QVRA 2C95A 3VKHA 2N42A 3BJIC 3PVSA 1KJYA 1GNPA 2OFXA 3EIQA 1JPNA 4F4IA 4OI4A 4Q4HA 3B60A 2ZR7A 4TYNA 4TMVA 1VHLA 3BWDD 1OFHA 4LI0A 1E9AA 1T9HA 1E2KA 4Q03A 4NCIA 4CF7A 2O8DA 1FQKA 1DARA 2CL0X 2BCJQ 4G5SA 3CPJB 5EE3A 4GP6A 4IOKA 2FZLA 3QE0A 1KZ7B 3EIHA 3PUYA 4F4CA 2QAJA 4S35A 1MRSA 2XOKD 4DT1B 4A8JB 5KPDA 2O8EA 4BLOA 3FKSA 3GD7A 5JI2E 3MUFA 3A4MA 1G3UA 3K0SA 3GFTA 1W5SA 4KODA 2RGBA 2CNWA 5CITA 1RKBA 1R5BA 4Q9IA 2WJJA 4QFMA 4D6PA 3TR0A 3W6PA 3QG5A 2BBOA 1AGRA 4A2WA 2IS1A 3VFDA 1ZM2A 1FZQA 2ZS8A 3QPUA 3R9IA 3TVDA 2OFOA 2C8VA 4MRNA 2MSCB 2CHQA 1LNZA 4YMUA 2WWYA 2W6JA 1W0JA 2GEVA 2X2EA 4GI7A 4HZIA 2HDNB 4Q7LA 4QBHA 1KK2A 3QXCA 3KQLA 3FMOB 2G3YA 3WNDA 1UAAA 2FF7A 1FOEB 4GT1A 2XB2A 3AUYA 3KFXA 4BQSA 4R2IA 2J1LA 1A82A 2AR7A 2X8AA 3TE6A 4Q1FA 2VPPA 3U2QA 1F2TA 4YXWA 2Z4SA 3LXRA 4LJ7A 1KDTA 3QKRB 1CJUC 4R98A 4R2HA 3VX4A 3AGQA 2Q3HA 3P4YA 2R9VA 1MO6A 2BIFA 2VSOA 2ZVPX 5KNDA 3PEWA 3GLFB 1YJ5A 1AS2A 1HV8A 4KU4A 4TL9A 1M34E 3C7KA 1IBRA 4D4MA 5TB5A 3I61A 3KKPA 4G3XA 4KSBA 2HLDA 4D2IA 4NCKA 5CDFE 3L0IB 3AEZA 4I1OA 2GXAA 1F3OA 4FXPA 4JJZA 2FOLA 3B1YA 4Q9LA 3EZ7A 1SKYB 2QAGC 3VR6A 2AD5A 1W4RA 4Q7MB 4CEJB 2GCOB 3IKJA 3KKNA 3N2EA 1MV5A 4OL0A 3X2SA 5KU1A 3IO3A 1HE8B 1KY3A 3QKSB 3TAUA 1CRPA 3WNCA 2ZYWX 2JASA 4JIMA 4YC7A 5FH9A 5AJVB 2R62A 4QGGA 5HE9A 1SVSA 4BRUA 3VNVA 2JCSA 5HKKD 4FD2A 3FDIA 3D3QA 4RD1A 1A7JA 4MITA 3F3YA 2CCKA 1ZP6A 1D6JA 3MWJA 2SHKA 4DVGA 1OJLA 1N5LA 2ZI5A 4JL8A 4L16A 4HLUA 1W0KA 2GF0A 5D3MB 1E1RA 2RGCA 1NMZA 3L0PA 5GADl 3OFND 1CKEA 4IDPA 1TEXA 4XVQA 4RCZA 3K1JA 4WVFA 2XOKA 5IDVA 3VR5A 3LX5A 5JMTA 1G3QA 3VKGA 1E9DA 2G83A 3HR7A 4QBFA 4V0OA 2DR3A 4NPHA 5EUMA 2WKQA 5G3ZA 3AM1A 3RC3A 1QRAA 1YZTA 2QGNA 1XTRA 4LX0A 4WXRA 5JRJA 4RFSB 5F9FA 3D31A 3TK1A 4PO8A 2ZEJA 4C0AC 4A36A 1F6BA 3OE7D 4PO1A 4D4KA 3ZDQA 5FTMA 3PITA 2GKSA 2ZS9A 1NN3A 4DLXA 4EJSC 3A1UA 2BC9A 1P62B 3K0AA 3KB1A 5C18A 1PVOA 5EXSA 3W34A 2DPXA 4QKQA 3AB3A 3OEED 1FX0A 1Z3IX 3ZGXA 2BBTA 3DKPA 1G3RA 1RPZA 4BRWA 5FL3A 2QTVB 3QI2A 1FUUA 1ZNWA 2RCNA 4HAUA 2KBEA 1OB5A 3RS5A 1ZM7A 3MMPA 1KSHA 2C96A 1LF0A 1Z83A 1OH8A 3A58B 3QBVA 2WKPA 4RCYA 3T5GA 3TR5A 1Z6AA 1EK0A 1E3MA 1E9FA 2V1XA 1P60A 3K0CA 4Z54A 1T3SA 3IILA 4LHWA 1FPMA 1T0HB 2ZVQX 1R0WA 1SKQA 1KO8A 1XCPA 3ONWA 2IF2A 2QMEA 4DDTA 3K9NA 4Q02A 5JZVA 4BZXA 2JA1A 3AP1A 2BBWA 4A0HA 3J81k 4LJAA 3WP1B 4MDEA 3HR8A 2QMOA 2WJYA 4Q9JA 1NI3A 1XXHA 1N5JA 3LRPA 1MT0A 2BMEA 2PX0A 3EASA 2VA8A 3CZPA 3CR8A 2O5VA 3ZS9A 4BEBA 4B3XA 3LV8A 4M2LA 3RANA 4LC0A 4QHSA 1G8GA 3PR1A 2O8FA 3EIEA 1JQJC 2YWGA 4JBXA 4JLAA 4JLKA 4QOSA 2XJ9A 2IA5A 1NY5A 1E4VA 1GSIA 3I92A 4WW0A 2V9PA 4XTCS 3WY9A 4XWOA 2IXGA 1W36D 3BB4A 1E2JA 2A9KA 3C16C 4NTZA 1I4LD 4NKRA 1QG2A 4TWZA 4YDSA 1ETUA 3PIRA 1D2NA 4LV8B 3RLFA 1KMQA 1G291 1XD9A 1NNEA 1UBEA 4OI1A 1E0KA 2BBSA 2LCFA 1K6MA 2A5YB 1ZINA 4D25A 3U3JA 4ZDIA 5K8TA 1QHXA 1G6OA 3MLEA 5ELXA 2JEOA 1D9ZA 4M8NE 1RRPA 3HU1A 1QF9A 4A9AA 5A5GA 1I2DA 2W2VA 3CNNA 5CB8A 2GF9A 1N2CE 1J8YF 2R6FA 4EFMA 2EWVA 2G1JA 2C04A 2I4IA 4BWYA 4JLNA 3N5CA 821PA 1CR4A 1C9KA 1NVVR 3H0KA 3WBJA 1Q3TA 4L4UA 2NGRA 2ZRJA 3UK6A 2Z43A 3CM0A 2ZSBA 3TKLA 4DEXA 3EPHA 3WMEA 2HT1A 4HZUA 5J40A 1XFAA 1KKMA 3CPHA 3EC2A 2HF8A 4PHHA 1KI3A 3ZZTA 4BLPA 4FW9A 5CJPA 3SJBA 1SXJA 4KAXA 3ZZ0A 1P2UA 2VP9A 3A1VA 5BQ5A 4OQMA 2ZJAA 1G20E 1A4RA 3PQCA 4GOJA 4LPSA 2YHSA 3D7MA 2C77A 1VHTA 5B58C 1R0XA 1J70A 3PCRB 1E9EA 1XX6A 3FMIA 1AS3A 3P32A 2YVUA 2F1RA 5K8UA 4CEIA 4LBZA 3WRYC 1Q22A 2ZRLA 3ZZUA 2RGGA 2GVDC 2IX3A 2MMGA 2MMCA 2PJZA 5GJCA 4TYPA 4MGIR 4DHEA 5HR5A 1OHHD 2QE7D 4IOLA 4NMMA 1XEWY 1Z6XA 2ZQ5A 4M9XA 3UWOA 4M22A 2JDIA 2ZM5A 3A8TA 1M6NA 2V7QA 4B2PA 4NYMQ 2EU8A 2H17A 2WMNB 4AIIA 1X8LA 2D74A 2GXSA 4O2RA 2EFCB 4B75A 2OCPA 3NBYC 1JAHA 3OZXA 2P6RA 4RD3A 4M9SA 3G82C 4EDHA 2QN6A 4V03A 4H9GA 4A8JC 1IXSB 4JLDA 2VO1A 3DZ8A 1KDRA 1GTVA 1HA3A 5EXXA 1R0YA 3RNLA 3MCAA 1XEXB 2REXB 4ILEA 3JVUA 1NN0A 3GJ5A 4EPYA 4ACBA 3BRWD 4IOJA 1YU9A 1EFCA 1LF5A 2BEKA 2O8CB 2V4ZA 4C2TA 3FMFA 1E2HA 1MABA 1BYIA 2C99A 2W00A 1P75A 1JR3A 3U3MA 3HWSA 3KQUA 1FTSA 1X86B 2WKRA 4K81B 1ZNXA 1ZCAA 2TMKA 3GEEA 4EQ6A 1IN5A 2ODBA 3QOFA 3CX6A 2XJ4A 4WAUA 2AKYA 2ZRAA 2BEJA 2J0VA 2QAGA 1TX4B 1W2HA 1HTWA 3DPUA 3QF4A 4ZDJA 1YZGA 1MOZA 1H8ED 4L8GA 2IUSA 1GFIA 3P1JA 4X8OA 2D2FA 3LW8A 4GBMA 3DO6A 1PUJA 2ZU0C 4PPGA 4QHYA 2OFWA 1NMXA 3MJRA 4C0LA 4ZO4A 1P2SA 4M1TA 5FOTA 3W5JA 4BPBA 4F38A 4UNSA 4UKDA 4B6EA 3VR2A 1TF7A 2YKGA 2NZJA 1G1MA 4L5BA 2B8TA 1OLOA 5CLQA 4EPXA 5DYGA
chains in the Genus database with same CATH superfamily
1YUNA 2BZSA 4OLFA 1IHUA 2BDEA 4AMVA 4RNDB 1V8DA 4PE5B 3RKRA 4EJSB 1JKIA 2H52A 4X94A 7MDHA 3QSYA 4GPEA 2MSDB 2GZRA 2PN1A 1R8XA 4N41A 2OEPA 4X44A 2FG5A 2NQ8A 4EAAA 5JAPA 4O4JB 3RUFA 2G8NA 3FPJA 1XWWA 3T3MB 5BPHA 4S1NA 1WDLA 3FHJA 4P3YA 5DI3B 3RG2A 3HLYA 2BL4A 5IEJA 3Q15C 1AXGA 3W7VA 4FFSA 3WLOA 3ZBPA 3I28A 3IV9A 3ELWA 3I8XA 1XXHE 3EZLA 5B3AA 2A30A 2BDUA 4YDRA 5GZ6A 2D5LA 3GMTA 4G4IA 1B2RA 4R1NA 2PQMA 2YV3A 1HETA 1VP9A 3L6BA 1QG6A 4F7WA 4X93A 3PXCX 4MVXA 1V8FA 5KVCA 3WDMA 2PD3A 3NHAA 3SEAA 1HNNA 4F21A 1E6EA 4RANA 4ZZ2A 2F9LA 5K9ZA 2UVQA 1P5HA 3ZU3A 1MR3F 1C14A 2B9EA 3I2YX 3B78A 4D44A 4F5EA 2ZAGA 4LZJA 5B1IA 2AXEA 4A82A 4RZ3A 4JLWA 1M2FA 4UZFA 2CL7X 3MRTA 4C4SA 1YMUA 1AHIA 4MVJP 2MYTA 1GUYA 3W6OA 1MZPA 2HNKA 4F4HA 3E5HA 1IHOA 3DHEA 4JXJA 3FROA 2H63A 3IGFA 4XQ9A 5HMMA 3VYTB 4W7SA 1A72A 2FZCA 5CVUA 2HW8A 1HDRA 1O03A 5JROA 3PUVA 2ZRBA 5K5EA 4F3TA 3AXTA 2NZYA 4GPZA 1MFPA 3AILA 3AKCA 3HDVA 1Q5PA 4FYIA 5TNXA 4IIUA 3OO1A 1KEPA 2BJWA 3EWSA 2ZSJA 4KCGA 1B42A 3IR5A 4OGGA 1Z06A 4PLWA 1CUHA 1H8HD 3EXAA 3IVMA 2GXQA 4NPAA 4PPNA 2R751 4UDXX 2CJWA 3RJ9A 4F5YA 3U56A 4QBIA 4DLKA 5JXJA 3B6ZA 1SZDA 3HJFA 2YVKA 4M1WA 3SLGA 2CNWD 2RH5A 1ZHFA 1TRKA 1TUEA 1Z62A 3NFYA 1A7KA 3QFRA 3OMXA 1UXHA 3NAQA 4R84A 1TJ4A 3IJRA 3ZU6A 1P19A 3IRVA 1FL9A 3JVDA 4IAOA 4O2AF 5FNVF 3SP1A 2OYCA 4CCYA 5I4CA 3NETA 2R6AA 4HDSB 5AK6A 4ZV7A 4EAQA 5FPQA 3DCJA 4QQ8A 4EF5A 2R4TA 2FDRA 2EFHB 5KEIA 3NXSA 1GR1A 1P80A 3AVOA 1KZYC 2AFHE 2BFPA 3S28A 3O90A 1VDMA 1JIUA 1WKVA 3ZU4A 3QKTA 3M70A 4TWRA 4AZWA 3H16A 5AHKA 1F1BA 3DZCA 4HDRB 1GR0A 3SJCA 3GUCA 3ZUGA 5K6TA 2CLKB 4ISCA 4YRLA 1LLCA 3OUTA 3EXIA 3MAJA 4M8SA 1LK5A 2CLOB 3IQGX 1KR2A 2BFMA 2PL3A 4JBYA 2F7SA 2VL7A 4OMDA 2Q2OA 3WGNA 2VAPA 4UNIA 4ARVA 2R84A 1K3TA 3G59A 3PUKA 1DKOA 3NDJA 2VDUE 3QVVA 4JT8A 4X8HA 1ZX1A 2CC2A 3ESRA 5H59A 4ETMA 3VKWA 4HDNA 4MI6A 4U2EA 5JE8A 4DQLA 3AKZA 2NUBA 3U4CA 3DJFA 4D96A 2QRVA 4WMLA 2E37A 6GPBA 1RLUA 1JIQA 1GPYA 1MX9A 1PJ4A 1MKYA 1V43A 2R2GA 4HAWA 4NS4A 3HYTA 5KDDA 1XPUA 3W9SA 2EC5A 1XC7A 3MT0A 3AEKA 3F4BA 2OBYA 4FI3C 4LBWA 4O1IA 2PUDA 3Q5DA 2E4WA 3D1JA 5JNSA 3OHPA 2BELA 3QKIA 2HTEA 1ZONA 3D5EA 1BMFD 3BTSA 2QRGA 2QSZA 4X45A 5KCMA 4MUAA 4WBNB 1VSQA 3LD9A 3RFTA 1PR3A 2H4HA 3S8MA 1ZRSA 3E3AA 4CIVA 3MB8A 1PEYA 4OHFA 4P4UA 2EYQA 3NIBA 3RM3A 2YHIA 1M1NA 4BY9E 5BVGA 5GONB 1NRWA 3WJ1A 3DMTC 1CDDA 5JARA 1C4XA 2CN1A 5K0CA 1IATA 4L57A 1X70A 3FLAA 4YAOA 2WP0A 5TSDA 2OZPA 3CLRD 3ONFA 3H5VA 1Y9JA 4YROA 4IHQA 2FSVC 2ZJ4A 3UG6A 1NDQA 1S3IA 2DB3A 3UAGA 1BA2A 2GDJA 1QC5A 5AVUA 2ZSUA 4RF5A 3PSAA 1EQ2A 1NPDA 5KNDD 1KFEB 2YWBA 1R4MB 1TQ6A 4TLBA 4BNVA 1DRJA 4ROTA 3NCHA 3GJ8A 1U6KA 3OEHD 1PJTA 1ISSA 2R25B 4IOMA 1QP0A 3SR0A 3WK7A 4X6YA 2C4HA 2PS1A 2XWBF 5D7NA 2AYYA 1N9GB 2WJIA 3Q7PA 2WM3A 4CQMB 2G80A 5FBKA 2I55A 3C6MA 2HO4A 3F6CA 3FKSD 5EJ4A 3TOCA 3DOUA 2WYVA 3HZRA 3LLUA 1JIVA 5ERGB 3UMBA 3SY8A 4DB4A 2XB9A 1EBUA 2AXQA 2YWDA 3RF7A 1IEWA 1Y9ZA 3CE9A 4DJTA 4YAGA 1HEUA 3HA2A 1FDVA 4JK3A 1E69A 3CS3A 1TYBE 2CLHB 1U0RA 5DZSA 5IPFA 4A10A 4NI5A 1KC1A 4NICA 3WJ7A 4BZWA 4I1VA 5AI4A 4CL8A 3GJ0A 2W58A 2J9GA 3ONEA 4PU0A 2AV6A 4OSEA 2YV5A 4ERNA 1TIKA 5ALVA 2SECE 1RJEA 2FMKA 4OREX 2P9ZA 3DE3X 3UXHA 2YV2A 4F96A 5BWMA 3FOZA 2WD9A 2OCLA 4D9CA 4YV0A 2JCBA 1AZSC 4BLQA 4Z1OA 3MM4A 4LYDA 3KCNA 1J90A 1QQBA 2CEAA 4AECA 1A2OA 4H7IA 3GZTB 4WECA 1JEEA 3O73A 2QRVB 5GY7A 1Q1ZA 1LNQA 3BIXA 4ZC1A 3D4PA 3A6JA 4MS4A 2BKXA 1CBUA 3UAZA 2WNHA 5JOQA 2CHVA 4YRAA 5JANA 1Y34E 2LDXA 1FX1A 2H92A 4OHXA 4TVKA 3AJAA 3C3CA 1AY0A 1U80A 1SVUA 1WW2A 3CRNA 2CHUA 3EA0A 3E9QA 3ZTWA 5I4BA 2C9OA 5FLXA 3CB2A 3QVTA 3O8NA 4H0FA 5J43A 1A5TA 5BN4A 4UM8B 3ZQKA 5KNBD 4D3SA 2ASVA 2PU5A 1RJWA 4MR8B 3S4YA 4AUKA 1SUCA 2Q9AA 2H85A 1W5TA 5B3KA 2ILTA 1GGVA 3C24A 4Q5IA 4EPTA 5H8WA 2HHLA 4I50F 4NAHA 4NYJQ 3UAXA 2JAOA 3RSOA 3W0LB 5JSZA 3TUJC 3T3NA 2DBZA 1SUEA 3FZYA 3BWEA 2YMMA 2P27A 4IH4A 4MIOA 4OOFA 4PRKA 2FPSA 2G9QA 2J59A 5T41A 1IJEA 5IXYA 1XTIA 3K35A 3KB2A 4TOIA 3H2BA 3B3AA 4I1SA 4ZQBA 4YV7A 1NV9A 3D6FA 4LZOA 2PLFA 4DNFA 3NTLA 2BDTA 3RAEC 1JE1A 1N6HA 2WTNA 3HJBA 2V8BA 2XSZD 3C3KA 4EYSA 4B3TB 1OR8A 2DF8A 3SFVA 1FYFA 5EJAA 3ZC3A 2JFOA 3MJSA 3KBOA 4OHMA 5L3QA 3RUHA 3MSXA 2ODWA 3E0QA 3LZ6A 3PS9A 4H1VA 1O87A 3TRFA 1M2OA 5KOYA 2JHFA 1K98A 2FMFA 2OGZA 4Q7KA 1GPUA 2SCUB 3SR4A 4GYJA 3OTGA 1J25A 2J9FA 1HKUA 3K70D 4GR4A 5ECYA 3VDMA 1NC3A 2JLAA 3LXXA 4TM7A 1R0ZA 4U5XA 4F0JA 4ZCIA 2QLTA 1Z0KA 2RGWA 1P7CA 3AL2A 3GK3A 5DMXA 1K7FB 1Q3HA 3NP7A 1GT91 4OXNA 3QYJA 2VNJA 4NZOA 2ZTVA 4B09A 5DHUA 2ZROA 3KQTA 5TGTA 2R44A 3WA6A 4QSHA 1HZZA 3SHFA 3FWKA 3H5NA 4RD2A 3EH1A 1MJFA 1OBCA 1LU9A 4U00A 3KUUA 2CDAA 3HR4A 2N75A 4WKCA 4Y2TA 2BM1A 2IOFA 2V3CC 2RC6A 1FFXB 2XMPA 3NV9A 5LBTA 2VHWA 2WHXA 3ZHOA 1UJ4A 3USCS 4GZ5A 3LUAA 2R5FA 2Y2UA 3T34A 4BO2A 2VTBA 4NCBA 4JDUA 1TK2A 2CDCA 3GFGA 3UVEA 1NFFA 2O8VA 2ZRMA 4PXYA 3OM9A 4HX2A 1K8RA 4ND6A 5INTA 1U5BA 2FDCA 1ORTA 2NU9B 3DAYA 4RPHA 1XZKA 1JQ3A 4DYVA 3JQAA 2Q49A 1RPTA 4GL4A 4MRRA 4OMUA 2R1ZA 3RTEA 2QRPA 1IN6A 1DAIA 4Q6WA 2OVFA 2XQIA 4JB8A 4AW9A 3Q5GA 4YJ3A 1O0CA 1QRTA 1NRJB 3HFSA 1QHGA 3LAWA 2A9VA 2AEEA 2QN8A 4CBVA 1U5CA 1MP0A 2NPOA 3PPIA 3ZI0A 4JOQA 3HJNA 2P67A 4M8KA 1C7RA 1QFSA 5DVZA 2ANBA 3JQFA 1CUFA 1XBTA 3G9UA 1DJQA 3KAPA 1CY7A 2IYYA 2ORIA 2BZ1A 1CULC 2HDOA 4J7XA 5AHXA 3QFHA 1LBTA 4UM7A 3T61A 2M98A 4H0CA 4N40A 4AFNA 1Z35A 1ODLA 2IS4A 2KE5A 2WFLB 2ZZMA 5K03A 1O2DA 2GNOA 1A7AA 1KFCB 4OXXA 4IMJB 1TIPA 1KR5A 2LGJA 2X4DA 1P1IA 4G0MA 4J90A 4TL7A 4H77A 5BNTA 5BSEA 2ADFA 3CSSA 3AJ9A 1DLJA 1T6NA 2GLXA 3LFHA 4KWIA 3KEGA 4KQ2A 4X6LA 3TG8A 2Q8QA 3WYCA 3TVYA 2XT9A 1U3GA 5DM0A 5DLPA 2J0SA 2EP8A 4MYCA 1PJAA 1USIA 5L3QB 4FYVA 4J4HA 5EAIA 1G1AA 3W8FA 3WLJA 4ZGWA 1ACMA 3JR3A 3SF8B 3K1YA 4NY1A 1JR2A 2F1JA 3GLGE 3I6BA 4ZOLB 1B76A 1E3TA 1XPRA 1J09A 3FFXA 5TRTA 3WQHA 4I1RA 4DANA 1ZOIA 3M1IA 2FHSA 2HBQA 3W3AA 3QYFA 5A4MS 1FVXA 3TNLA 3ZGLA 1BJTA 1U2GA 2AT1A 1KOGA 4XSVA 3W4JA 3LKVA 4UARA 1ISMA 1BCRB 1T10A 1UINA 3E7WA 4QRDA 4EMSA 1UAGA 3PC4A 2PZKA 2GO7A 2VDOB 2QM0A 3BGWA 4MIKA 1EDZA 3JR7A 4CKWB 3INNA 4JNCA 2UZ4A 2A5DA 5K8LA 2P91A 3ID6C 1SWVA 3ECSA 4FE4A 3U0BA 2X7JA 2XTNA 4E2FA 1LDNA 3R9WA 2ZUBA 1CY1A 1PS8A 3QQ5A 4CTMA 2QPTA 4B31A 1XKLA 3MINB 4MVYA 3U48A 4QXRA 2A9RA 4L50A 4UAJA 1N6OA 4RTRA 1XAIA 3FHOA 1T2CA 3ZXYA 4UOEA 2GA8A 3VPSA 4JYMA 3NATA 4I7EA 1RDFA 1Z33A 3CURA 4EY6A 3OP1A 1UBKS 1GUAA 2NWQA 2FP4A 5FD8A 2AFIE 1OAOC 3FSJX 1NQ5A 1ZSVA 3C39A 1K27A 1JFTA 2YJTD 5KYGA 3PZBA 3QKWA 2JVKA 3BXHA 3T9BA 3C3XA 4YI5A 4MRSA 1XCGB 4AL4A 4G9GA 1WP9A 3MMZA 7AT1A 5DYYA 5T4BA 3MELA 5ICEA 4TTJA 1Z73A 1AX9A 2VDKB 1UPCA 4TKUB 1BDMA 1Q7CA 1HE2A 1ZPDA 1Q1GA 2RB5A 1GRRA 1NN5A 3B6JA 3CGWA 3KG2A 4ARIA 1G17A 4DA9A 3AW8A 3R0XA 1Y3BE 1PNQA 2EJUA 3KKKA 5IVIA 3RKUA 4I8DA 5HTKA 3JWEA 4LF9B 4ZTUB 4RD0A 1FC0A 4HZUB 4JJAA 4FINA 3UGQA 4NJOA 3HBMA 3WSWA 4U9UA 2O2XA 1WEKA 2ZRGA 3LL4A 2OQ2A 3A4NA 4Z9AA 1E7MA 3MD0A 4FGJA 4ZAWA 1V8ZA 2J7PD 3ELUA 1Z7EA 3OF2A 4K9SA 1C8KA 2D1YA 2OZEA 3LX8A 2AFIB 3H11A 3RYHB 4JI6B 5JV5A 5AJYA 3EMKA 3I0ZA 5JJKA 2AG0A 3E27A 3U7RA 1H6CA 1Z0DA 2CY0A 2ZJOA 1PFWA 1YQTA 5KPJA 2WSIA 4UCWA 1OB2A 1KVUA 1KH3A 3REOA 3RUCA 2AHRA 1PU2A 3RUAA 4JB0A 3OZGA 1Y9DA 3A05A 2RARA 4HX5A 4TKVB 1M72A 4KMOA 5ALHA 4PBSA 2V0CA 1HBJA 1QCCA 3SC2A 3P94A 1A69A 3TECE 2NQTA 3AP2A 3OHMA 4WBNF 2JFHA 1L2TA 1I51A 1NF9A 3EVDA 3CH5A 4Y9DA 1KMNA 1CZNA 5DTQA 3R7WB 3SJ7A 3T35A 3ZGYA 4EHAA 5IBCA 1E62A 5MGNA 1QP7A 3GEMA 2QVLA 2OV2A 1RBYA 1HX7A 2D13A 3G89A 3BFPA 2MYPA 2YVLA 2M6KA 3LC7O 1DKRA 4NHOA 1DDGA 1XVLA 3ZS8A 5LKAA 2YN2A 1SCKA 1VIVA 2E6KA 1RKQA 1TZBA 2CNOA 2VLIA 3GRRA 3LQ1A 1AGPA 2NZWA 4EM6A 1C80A 2AMFA 1KJQA 2V5UA 3X1ZA 4DTIA 1DCKA 2G6TA 3PD1A 2LBPA 4ENUA 3AOEA 1R66A 5K0EA 1ND5A 1QIMA 1UPFA 1CW2B 3OF3A 3LA6A 1OW3B 1KH2A 1G5RA 1K92A 1RZVA 3P9QA 5FPSA 2IH5A 1F5SA 1HZZC 5JG7A 7REQA 1IJFA 3JQBC 2GM3A 1RYDA 3LPMA 1GPH1 1JF8A 3MTBA 4LY3A 1SRRA 1E61A 4GI1A 3QXSA 4ZOCA 3EPLA 1RJFA 2W0MA 1NPTO 3VUFA 3HVKA 1WXIA 1O57A 5IH7A 5EESA 3E22B 5J1SB 2B5VA 3AM5A 2VP0A 4BQPA 2IYEA 2J87A 5EZ6B 3QENA 5IT5A 3W78A 1IY8A 2QP9X 2WM9B 4INJA 1TU3A 3GXOA 2NT3A 1D6SA 4I99A 4CR7A 4EECA 5NLLA 1T15A 3SJUA 5I3CA 5JT1A 3NEYA 5C4IA 1BNCA 2CMFA 2XQFA 3UY4A 1WBBA 4H4CA 1C4KA 1Z0ZA 2QRLA 2X15A 3BMOB 1LEHA 3MJVA 3NORA 3M6XA 2VT6A 3UMJA 5EJEA 5TPZD 1Y81A 2HU5A 3TB6A 3BXEA 1TMOA 4JHLA 3GGDA 4H31A 4MTLA 4TVOA 4M83A 4EATA 2Q0HA 3GW8A 3WNQA 4EH1A 4AZ0A 4CTJA 1G98A 3W6ZA 3EC7A 1R37A 2CFCA 1Q11A 1SG9A 2C5FA 2FPIA 2ZIXA 4B3SB 5JCJD 3D4LA 4R9VA 3GNLA 4BASA 5JZBA 4UU8A 4M89A 3E9ZA 1L5VA 3UTCA 4AO7A 1P4RA 4CTNA 2R87A 3FXAA 2FZ5A 5J63A 4FGZA 3ADCA 3IV7A 4M0DA 5BO5A 1G38A 2QYOA 5CLFA 3INRA 4Z4GA 5C53B 4KTTE 2XUAA 3HDYA 4YCMA 1TO6A 3CKKA 3SS8A 1F17A 4JP8A 4MULA 4Q00A 3HWWA 1OXBB 3RJTA 4JJEA 2FPKA 4Z51A 4GXQA 3E23A 1TAUA 3HYLA 4M99A 3W9BA 2B9VA 1WB5A 3A6DA 3AY7A 3LBNA 1QZXA 2J67A 1OUMA 5E4YA 5A71A 4IIFA 3CRMA 5SZJA 5K6AC 1BXRA 4RY9A 1YJCA 2HF9A 5ULLA 4EZIA 4G8CA 4PG4A 4UFPA 2D1SA 5F33A 3TLCA 2H51A 3MCVA 3RRMA 2Q3FA 2P35A 5EQFA 3H3JA 1KI9A 3FI9A 1BMDA 2YICA 1OGJA 1KOLA 2AOWA 4LDRA 3SQDA 2Q3CA 1NR7A 1Q0QA 3KALA 2E49A 1AIPA 2VYVA 4M0FA 4BQNA 1XN4A 1X7DA 1YRLA 3CZ4A 4WZAB 1XB2A 3EIOA 3ML1A 3NWPA 4LNUA 4RVOA 1RQ2A 1U4OA 4GHWA 3WLNA 2YYSA 1P1RA 1A88A 2CUKA 4B4WA 3M81A 5JALA 2OUIA 4A23A 2QZ4A 4CCWA 3TSAA 3KKLA 1RQXA 4FDTA 5I5EA 4HB0A 5JBQA 1JHXA 4GC5A 2IEBA 1YA6A 4AJ9A 1KS2A 2CLFB 3PDUA 1G0OA 2P2SA 3DE6X 2F3UA 3AO0B 3AUFA 3BHIA 2EEPA 3MQ4A 1L7OA 4GLOA 3SOPA 3WMFA 4BBAA 4FILA 1I4OA 2JKVA 3RD5A 1R4AA 3VO2A 5GJWC 1CY4A 2FWRA 4WY5A 1NJ5A 5CMLA 1V3UA 3NHWA 1W96A 4WOCA 5LCXA 5D5PA 4ZHQB 3ZHRA 1LRJA 3B7PA 4A2QA 4AKIA 1UDWA 3Q8KA 2G04A 4OMCA 1KQ3A 1TUBB 1P0IA 3E61A 1JTVA 1E66A 1KI6B 4AUMA 2J6HA 1CUZA 3M3HA 4XM1A 3RU7A 1YS1X 2H54A 3LP6A 2DFPA 4QQRA 4IINA 3WGLA 4YJ3B 3PR3A 3SMQA 1N1DA 1K4MA 3MAAC 2DWOA 4ON9A 4TLLB 4FXOA 3KUCA 3OPNA 1VP3A 1D5CA 3CRZA 1CS0B 3RC2A 3DBVO 3FTNA 1NLYA 4JNKA 3SZLA 1HO3A 5HX7A 2Q5JA 3GPBA 4MQLA 2ON6A 3ZBTA 1RLIA 1U9IA 2CNDA 4PLCA 4QOJA 4XA8A 1UBLS 3VI3B 2E2WA 4TZ0A 2XA1A 2NPIA 3ET5A 1BVYF 1A9OA 3E15A 3L84A 2J0QA 2WINI 2VOJA 5SYMA 4ER6A 3Q88A 1XMXA 2WF6A 4EJSA 3UANA 4R7GA 4UD6A 1P73A 3D1LA 4OKIA 3TZLA 1GPAA 4O5AA 4CG2A 4JSTA 3AHFA 4R6XA 4O4JA 2PMEA 1PYDA 2W9XA 5T67A 4O4JF 5CLJA 1U3CA 1Z5PA 5JQGB 1W76A 2FSFA 3LUBA 1QZ3A 1YO6A 4BCBA 4C6RA 4WESA 5LIPA 3AF6A 1T5DX 1V5EA 3AR4A 3IE2A 5G0VA 4ALIA 2QV0A 2JPDA 2XE7A 5CPBA 4UHFA 2R65A 3UPUA 2REQB 1YIAA 3C6YA 4M0LA 4YMWA 5FI5A 1GSOA 3H2KA 4D98A 2ZANA 4RLSA 2PUJA 4D9FA 1CDEA 3TCNA 1ARZA 3IP5A 1IUOA 3TNDA 4DKXA 5K0SA 5KWEA 1HQCA 2J32A 1VSBA 2COEA 2NACA 3SZOA 1K8QA 4RSGA 1T24A 3IMCA 2FLKA 3BD7A 3DEFA 1BXKA 2QKYA 3EG9A 1KY2A 1W9MA 3M7IA 1IZ7A 2OWDA 4AVYA 5C34B 3UAOA 2PY6A 1CJCA 2G7MC 2PDAA 3HKEB 4WLFA 3TYXA 2PLNA 4KBFA 3L9XA 5ELLA 5EZ5A 1G5PA 3R76A 4HDMB 5JC8A 2O8BA 5HQ3B 1RHMA 4B4OA 3TZEA 1VYUA 2WA2A 4I5DA 3OZVA 2I4RA 3EUWA 4MKFA 7REQB 2GPNA 3DUFA 1GL6A 5P8WA 1A1SA 2RHLA 5ITWA 3I76A 5HCNA 1CQJB 3TQOA 1Y3CE 3MINA 3KJIA 3VNQA 3OCYA 1N57A 2NSJA 4IS2A 4RVCA 5AK5A 3FF1A 4F1WA 1SBZA 1TYAE 2DE0X 4XIGS 4DKJA 4QM7A 4W6QA 2C5SA 3F7MA 1NJ1A 1P9RA 4WKBA 1NQUA 2H59A 2RKOA 1PF7E 3VYUB 1LK0A 2D1QA 2PX3A 4YB8A 1OXXK 1DINA 4EVQA 3FRIA 1M3SA 1O96A 4IKEA 2J9RA 3OO0A 4BNUA 3V80A 4GGOA 3IKLA 2BF4A 3U31A 1VHWA 2ZJ8A 4LSMA 2EBWA 4R9SA 3C5VA 1GKKA 5BV8A 2OB2A 1KQFA 3QFFA 2X5NA 5EKTA 3LBIA 2SKCA 1RYBA 4FYYA 2DR0A 2A3RA 4H27A 5E6RB 3BL5A 5CCEA 3T7IA 4GRIA 2AXPA 2VRWA 2Y71A 4FMCF 5DGCA 1MX3A 4TMZA 3MT8A 4LHXA 5CDTA 2JLYA 3G5LA 4UEQA 3MIIA 4ATNA 4Q3BA 2RGNC 3AOGA 4H3HB 1M8GA 6LDHA 2RGNA 5KVSA 3TLXA 4GOXA 3FFBA 3OSZA 2N47A 4GL2A 3OIDA 4FFMA 3SC6A 4EJ0A 4I9NA 2FUG6 2IZ5A 2PGIA 4WZBE 3A1CA 5ADUS 2XCSB 3I73A 1M73E 1N7JA 1AA9A 1O4WA 1W34A 2FPIB 3BXFA 4MW6A 1F12A 4WV3A 1UT8A 4N3BA 3UJBA 2VK2A 5GM2A 1CEYA 2M1XA 3ZKWA 4LW8A 1QE0A 4A5OA 1PFVA 3BN3A 1ORVA 3F7NA 3QU9A 3OQNA 4JHXA 4NV3A 4OFBA 1SVNA 4BNYA 1RXYA 4F4JA 5TIIA 2Z4TA 3AF1A 4UMFA 1NVAA 2YWFA 1XCBA 4N0QA 3KSUA 1OYVA 4U0KA 3KJQA 3L8EA 3UOWA 2WJAA 1TD9A 4ROSA 4C2UA 1SAYA 4RVGA 2VP2A 1A77A 3IMEA 2JGKA 4Q9DA 5FL7D 2VP4A 3CUYA 2UDPA 4B7ZA 5E6SB 5JHHB 5KBYA 1E4EA 1TQDA 3C8UA 4NYIR 1IZZA 1FUKA 1XEXA 4QAJA 1UEIA 1G7RA 2H8GA 3H83A 3E7XA 2RKBA 5REQB 2FJPA 1X39A 4LZZA 3VTFA 4MS4B 4IJMA 1RZRD 1FLDA 4QDZA 2ET6A 5HQTA 5LXTA 4P3KA 1FFEA 1MIOB 3LFTA 5LZ4A 4FX5A 3BILA 1N0UA 3Q3IA 4DZZA 5AM5A 1BKDR 4G8DA 4EHHA 5C9ZA 3PT9A 3LC1O 2V96A 1FY2A 1SVIA 1IPEA 2DY1A 2NP7A 1F8UA 2VF5X 3E9DA 4PCVA 1ST3A 2IXTA 2WWIA 4O6VA 3ZDEA 5K3SA 3GOQA 2A35A 1GEGA 4BNLA 1ZW1A 3QJ5A 3P2JA 1SC1A 5EIBC 4AS3A 5KTTA 4PHTA 1HPLA 4R40A 1KQGA 4WE3A 2K5UA 4NL4H 3MS7A 3FRHA 6Q21A 1QGED 4BNKA 2LXNA 3KVYA 4RMHA 3CEJA 3OG9A 5IW8A 1DIHA 1MHPA 3KE8A 5AW1A 4YCSA 4TMTA 1D2AA 2KLHA 2FQWA 4GVPA 1JHQA 4XUDA 5F51A 3V1NA 5FWNA 3QOYA 2C8KA 2D7DA 5BUZA 2CFSA 3PGLA 2DPMA 1DC3A 2VJPA 3EFOB 4RKYA 1US8B 2MSKA 4Q7EA 5H9VA 3SXUB 1EXMA 1GN9A 3UGTA 2QAGB 4K9OA 3KR0A 2BFAA 3H05A 1GG9A 1QAOA 3CNEA 5CDYA 4IUCS 3RRZA 2B4QA 2IYPA 3FYHA 3IQXA 3QX7A 4ZU1X 1CRWG 2GVZC 2VJCA 3W77A 3F5FA 3LVBA 3WBKA 5T3UA 1OREA 1I2CA 2IXAA 3ANYB 2W2PA 3O7WA 3WGUA 2BTQB 4GPIB 1BN6A 1TQ4A 2IZ0A 1DB3A 3HUDA 1MIHA 4FDMA 1U94A 1UBRS 1VE3A 4DBVO 2A9FA 5JNLA 1GU0A 5JSZB 5DM1A 1EJ2A 5J4KA 4KR9A 3W3AD 4FBMA 1JG6A 2NO6A 5JLJA 1IXYA 1CUAA 3PUIA 5KKCA 4HFRA 5IJXA 1JAZA 2DAPA 2ZYGA 3EZFA 1QOQB 4F71A 3L8DA 4BP9A 2WY2D 4R51A 2GTIA 2X0FA 4X65B 4KN5A 4Z7OB 2WG1A 1KYIA 1R64A 3ONVA 4X85A 1J2EA 1W4AA 1Z0IA 2B2NA 5B2ZA 1UMCB 1EK6A 2WV9A 4BEJA 1CZKA 3T7AA 1XAHA 1RLMA 2V65A 2ZR8A 1ND6A 1H9AA 2SCUA 2Z3ZA 2O1XA 1RPNA 1D3AA 4PLZA 3B9QA 4II7A 4LTNA 3V7NA 3ZWQA 4YV2A 4JX8A 1RHUA 1WMEA 2P5YA 1I32A 5F78A 2QTRA 3E1KA 4M0CA 3EGDB 1YS2X 2VA9A 1TFUA 4DA7A 1GKLA 3GI1A 1ZMBA 4E08A 2R1VB 2H7CA 1RCUA 2R5NA 2NXJA 3U3ZA 4IUBS 5DF1A 4J1QA 3V00A 1F1JA 3OFNA 1T3HA 3P27A 1BAPA 4KLZA 1NJFA 1Z22A 3MWYW 2K87A 4L73A 1T35A 2XPCA 1O3YA 1XMSA 1ULUA 2NO7A 1QIKA 5L3VA 1V3QE 4G1BA 3EXFA 1VPEA 3QQPA 2PL9A 2ZI4A 3VPDA 3D0OA 4OAQA 1ISRA 5IDWA 5FWAA 4DIDA 2C00A 5IK2D 3VU9A 4URHA 1YF3A 3IH5A 3OC0A 2WJ4A 1CC1S 2QMUA 2M6LA 3ABQB 4DUGA 2P78A 4F9FA 1UJ6A 2R8RA 1OPRA 3ZJTA 2WAOA 1EESA 2JFVA 2R7NA 4I50A 3GFFA 2LDBA 4W7HA 1RKUA 2HJWA 2ZJ0A 13PKA 3VJKA 2QDXA 3WIBA 5BSVA 3H8VA 4WD3A 2PUAA 1ECPA 3FNHA 1CLUA 1PHRA 4QNMA 1NE2A 1CUWA 5AVJA 1XRJA 1VRWA 1IZ8A 5B1HA 2O6LA 3R5SA 4GM1A 3S0JA 1H9CA 2GZSA 3OFKA 1CERA 2XNCA 1W49A 3RFVA 3MZ0A 5FQOA 1YRAA 1GQQA 2ZJFA 1EFPB 4BNDA 2GH1A 4I50B 2QTFA 1V7ZA 4C0XA 2G1UA 2PTHA 4ER5A 3LDGA 5KAPA 2MSEB 5BQFA 2F55A 3EMDA 1FTWA 1OOEA 1RM0A 1X94A 1Z3CA 2WIAA 1EJ6A 3K8YA 4G0NA 3O03A 4G5OA 4OKNA 1KJ8A 4JI2B 3IAM1 4Z0HO 1J23A 1MC5A 5KMGA 1BU8A 1O58A 1V6SA 1DEXA 2YOHA 3F8TA 1WV1A 3IP9A 1WUKS 3KLOA 4HEJA 5KOJA 1M0EA 1RLTA 1W4LA 3LIIA 4G36A 4N48A 1NSTA 1E5XA 3GRKA 3S8YA 3PI7A 4RL4A 4TYQA 1SBTA 5DYWA 4DSNA 1GA4A 2CXOA 4Y1RB 5C1IA 3VNSA 1EDOA 2G63A 3OAAA 4O4IA 2OCBA 1SG0A 3L0ZA 4JIGA 2JAXA 4MS1B 1H3FA 4ALKA 3B6EA 1RQNA 3D3JA 2B5WA 1XNQB 2DPHA 1VA4A 4EKIA 1PZMA 1BN7A 1KZ1A 4GBJA 4RWEA 1S2GA 3ZWYA 3ZCRA 1P45A 3LZCA 3F0TA 2FX5A 4LPKA 2H3HA 1KWKA 3Q98A 1WDWB 1JG4A 4HATA 4P4GA 1G4AE 2AZ4A 2ODAA 2YX1A 2ZYSA 2AOUB 3KYCB 4EA9A 5LOVA 5HBRA 3K0CC 3SK0A 3OQMA 3PHJA 1NP3A 1QHNA 3QOXA 5AJUA 2RAFA 3WI7A 4FIZA 5EKSA 5CDSA 4YJKA 3CX8A 1CEXA 3P9ZA 4D5EA 4MHTA 3HDGA 1DWUA 3V1MA 1K97A 3EIWA 3TG2A 5KOIA 3IA7A 4NLLA 2RAVA 2YINC 2P3SA 3CX3A 1QAQA 4MRPA 1A9PA 1C9JA 5KSWB 9LDTA 4JA0A 4C30A 1E2PA 2XBUA 5G2OA 2QUIA 1GLNA 3OE5A 4ZMSA 5EA2A 3LUCA 3PHBE 4CMCA 4B3GA 3DL7A 4TKLA 4M8IA 3SVLA 1Z36A 1Z56C 4QU5A 5CG1A 1DTSA 4KV9A 4GPTA 5AMXA 3B1ZA 3NTUA 4OIMA 5JDIC 3MLAA 5ICGA 3X1DA 2CCJA 1XTUA 2PUVA 3EUFA 4GGPA 5J5CA 2QB5A 2EIHA 2M32A 3T7EA 4CZ2A 4HAYA 4F91B 3V8VA 4OIFA 1C29B 2RJ3A 1AU9A 2C9YA 4UNQA 3W5CA 4FBGA 1WD7A 4NARA 1RE1A 1EWQA 5FPPA 4AJ1A 1OGIA 2JIRA 1X2EA 2O2DA 1HDEA 3GEGA 4R2XA 1EFVB 3CLRC 2JBHA 5TQ0B 3ANTA 4JLOA 3ICEA 3IV6A 4NNOA 4Q4AB 5BRAA 4KRFA 1RIIA 2CV1A 2IJGX 2JIZA 4CCSA 4K0KB 3ZKWB 1MRZA 3ROEA 3ROXA 1YE3A 4MMYB 4WZZA 1FDIA 1NV8A 2CXRA 4OEHA 3A0RB 5BW4A 3JZAA 4FM9A 2HADA 1JDBB 1T3LA 4P0TA 3T3OA 1XTSA 3GVIA 4BFXA 1X1QA 3O9MA 2ZU6A 1O4VA 1PNTA 2V7UA 3PGMA 3S2GA 3UWKA 4MCHA 4OX9Y 4G1FA 1FQJA 1J39A 4IIEA 1LDYA 1T0BA 4NJEB 2XZTA 5DK4A 4WCDA 2ZSDA 4R0NA 1UFQA 2LKDA 1L4FA 3KJNA 3KQPA 2VEOA 4FFBA 4X1YB 1YB1A 4IHJB 2AMYA 4MPRA 2RGEA 2WYWA 3GBVA 4CKEB 5LYJF 2VK1A 3NC0C 2HA3A 1HYGA 2IYWA 3QVGA 1OMOA 4XR9A 2RIRA 4ZMBA 4M0UA 2GN1A 1UBOS 1U4NA 3DWIA 2IIQA 3OQPA 2CNKA 5DLYA 4C7KA 1NTOA 3NBUA 2V4MA 3B53X 1PDVA 3VU3A 5JJCA 2HHJA 3SFTA 1Y6RA 2AA3A 4JJ4A 2AOVA 2C9ZA 4RS4A 1IJKA 1XMIA 3IQEA 3N7UA 5C31A 3BWYA 3UMVA 1JHVA 4K5QA 3KSDO 3V46A 4QSMA 4KWCA 2XMCA 5J47A 2BOVA 3GEBA 2IUUA 2ONKA 4JC4A 1TA4A 1EKXA 1YDMA 2E9SA 2OSVA 2WVJA 5IZCA 3SHQA 2Y1KA 4CLOB 1KYZA 4L4YA 4UU1A 2G08A 1SKAA 2C0CA 2DBVO 1FX0B 1QRRA 4QU0A 5AW2A 3SE7A 5KOHB 2NXWA 2Q5LA 4MO9A 1F4LA 3QXGA 1XMPA 2HLNA 3ZEIA 3BDVA 2IQ5A 2WC1A 4FNGA 1L4MA 3F8WA 4KWTA 3BA1A 2I22A 2FRDC 1JXAA 1RBQA 1AB5A 5DGDA 2YASA 3ZK7A 1C3XA 4MWDA 3M2PA 4KK3A 2JFZA 3CYFA 2ODQA 4GMXA 4MUIA 3GJ7A 4CIDA 3H4TA 4ETWA 2BCGY 1OE0A 1GCOA 1KMHA 1M7BA 1GGNA 1ZH2A 3HNPA 4OP3A 3ZK9A 3D8RA 2WJGA 2M9MA 4R3UC 5BSMA 2J9YB 2O7RA 2NXCA 2B6NA 2ZRHA 3DBIA 2VDWA 4GQBA 1H4TA 1VGQA 3DMHA 1RZUA 4TLMB 4IIJF 5FULA 4YUAA 1HY3A 3G8CA 4B3BA 2NPFA 1R0CA 4I3FA 4CWAA 4R8LA 2IV2X 5AFSA 2ZZNA 3QPWA 1GLVA 3GDHA 3MFYA 4W5JA 3H2SA 4BMZA 1W30A 5D3MA 3EIUA 4J0JA 2GASA 3GB9A 1ZXBA 3MXTA 3PVZA 4M21A 3V7FA 4CDMA 4DCOA 1IFXA 4M1OA 4PR0A 5BN3A 3D81A 3A9VA 1XMQB 3MBKA 4IJUA 3IVCA 4Y1EA 1NX6A 2EJWA 2QA5A 4YCLA 4RKRA 5CBPA 3KWFA 3KO8A 1QH8A 2CXNA 1ENPA 1E79A 3QW2A 4Q1DA 4YJ2F 1YT5A 1JVNA 3WGJA 5AOBA 3G0CA 4J07A 4L75A 1D8TA 4KBGA 3WSTA 1L3IA 2VFAA 1UXGA 3P20A 1RACA 1GSAA 4PHFA 1QCDA 4ZO8A 4Q9KA 1K68A 3T12A 3TLJA 4BMNA 4XB2A 4INAA