2X19A

Crystal structure of importin13 - rangtp complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
172
structure length
172
Chain Sequence
GEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING NUCLEAR PROTEIN GSP1/CNR1
publication title Nuclear Import Mechanism of the Ejc Component Mago- Y14 Revealed by Structural Studies of Importin 13.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear transport
total genus 45
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2x19A00
3P26A 4AKIA 4URUR 3X1DA 1P9NA 1TEVA 5M04A 2NZJA 2NO1A 2WOOA 3NEJA 2J45A 4M1SA 3NWJA 4LV5B 3MWLA 5KNBA 3BGWA 1GUAA 1Q1EA 1GILA 5JCPA 3SNHA 5EUMA 1GRRA 2PL3A 2L0XA 2FZ4A 2PZGA 3R9IA 1N6KA 3CRRA 3MAAC 4F4JA 8OHMA 3DHWC 4P4TA 1PLJA 3OEEA 3OIYA 5CM8B 2ORVA 4HLQB 4AYXA 1TQDA 3KJEA 3PV0A 3OEHA 4XIGS 2ORWA 2NO6A 2Q3HA 4CEJA 3KKMA 1WA5A 4LJAA 5CIQA 1LW7A 2HV8A 1EFRD 3EZ9A 2QRNA 1DAKA 3BH6A 2CMKA 3KUCA 2RMKA 1W44A 1OFIA 2C96A 2R6GA 2J46A 3A1SA 3EIHA 3LDAA 3B1XA 4M1KA 4LBVA 3QXCA 3FMPB 4J0QA 3CX6A 4N0DA 5LB2A 3RRYA 1NLFA 1T6NA 1Z08A 1MABA 1F6BA 5E7MA 1TQ4A 4D6PA 1DAFA 3D7MA 3X1YA 4B48A 4MGYR 1O87A 4LGMA 4A9AA 2ZSBA 5EUQB 2KB0A 2HLDD 4EKDA 1VDZA 5FTLA 3VR5A 1F3OA 1G4UR 5E7JA 4IOLA 5EE5B 1E2EA 3TVDA 3AP3A 3QOFA 5DHFA 4DVGA 3AKDA 2FG5A 4QJ4A 2WJVA 3IUYA 1Z6GA 4LDJA 4MA4A 4RZXA 121PA 2JLRA 3IQWA 4KVAA 4YONB 4ILEA 4KV9A 1FL9A 1S96A 2H16A 2O0JA 3UIEA 1NNEA 5DNYB 4DSOA 1O3YA 4JLMA 2RGNC 2UZ3A 5DLQC 2JIZA 1F2TB 4IDHA 1U0HC 4Q9LA 3GLIE 1U2RA 1Q12A 3UMRA 2XNDD 5JI2E 3FDIA 2CHVA 5DHAA 4TLCA 4QHYA 4KITB 4DT1B 3JZAA 4PR0A 2CVFA 3NH6A 1N5JA 2IK8A 4CIDA 4QNMA 1IJEA 2HF8A 1JJVA 1G7SA 2WJYA 3VHXA 1P5ZB 1G3UA 1AGPA 1RVDA 5JI3E 4LC0A 4D4MA 1GNQA 4OK3A 1YZTA 2KBEA 2ZSDA 3K53A 1UM8A 3QE0A 1YR9A 1Q20A 3T5DA 1J8YF 4QBHA 5CLQA 1ZRHA 2AD1A 4CRWB 3K0FB 5SZIA 1T3SA 4KLZA 2AL7A 4ZDKA 4BZPA 4FMBB 3TUJC 2VEDA 2G6BA 3BC1A 1F5NA 4UXHA 1YZLA 2FWRA 1ZINA 1TTTA 1HURA 1YR7A 1GM5A 1Q0UA 1G9XA 4HUQB 1AZTA 1SXJC 2OFWA 3FPAA 2K5UA 2VBCA 3P4XA 521PA 2HT1A 3VNUA 4HB4A 4F7WA 2IW3A 4EIWA 5EP1A 421PA 5JS7A 3LA6A 5B64A 4M9ZA 2F3TA 1R2QA 3FWYA 2YINC 4LJ6A 1CU1A 1YZKA 4GZLA 2WMOB 3QENA 3NXSA 3TSOA 4IDNA 2P65A 3RS2A 1HE8B 3V00A 2R8RA 3FHCB 3G82C 1DAEA 2W6JA 2C77A 3KQLA 1IY0A 4YLGA 4NCNA 4C0BA 2HF9A 1XD8A 4A2WA 4AKHA 1NN5A 1N6RA 1XTIA 4MYCA 1ZUNB 4IVQA 5DSZA 1Z0DA 3LY5A 5KU1A 2HXYA 3RAPR 1Z83A 1HV8A 4RCYA 3R7WB 1KI3A 1P61B 2JASA 2AXPA 4YMWA 3WNCA 1KK3A 2JLZA 4UNNA 1E9AA 1X1RA 1TPZA 3LRPA 2VF8A 1G291 1KZ7B 2BWJA 3CONA 2V1UA 5FTNA 4OJKA 5FTMA 1CRPA 1BKDR 2FA9A 3ZDQA 1RKBA 2J59A 1UDWA 3TAUA 5EQTA 2YKGA 1F60A 1BMFD 4HLCA 3K0FA 1ZP6A 3GD7A 1QRAA 3HPQA 4DLWA 3VX3A 3P1JA 1YRAA 3EWAA 3NH9A 1GL7A 2NO7A 2V8OA 2CLSA 3PUXA 4PAOA 3VU9A 4Q1AA 2OHFA 4JL8A 5FUXA 1QHIA 1KAOA 1X8JA 2V4ZA 1RE0A 4R2IA 5B58C 1E0AA 1DO0A 2XXAB 4GPTA 1HQCA 4ZCMA 2CHGA 3LBHA 4XD7A 1VECA 4XVUA 3G0HA 5LD2B 4DLXA 5CYPA 5BQ5A 721PA 3THYB 2ZRAA 4BLSA 3L43A 3HR8A 1I2DA 1SHZA 2KSQA 1KK2A 2B7CA 5J4YA 3UK6A 4MITA 3MD0A 3B8HA 4MYHA 1E4VA 1QHNA 4V03A 4LC1A 2IYQA 2GAOA 3TSWA 5SZHB 4PAMA 5J4KA 1KSGA 1DELA 1OXXK 2GDJA 2YYZA 3NTUA 1Z47A 2QAGA 1VIYA 1FFHA 4DLZA 4TL6A 2FPLA 2Q0HA 4Q01A 2NQ2C 2ZI3A 4C9BA 3ASZA 3OHMA 2AHOA 1FW6A 3R9WA 1VCIA 1ZCAA 2E87A 4ON9A 1W4AA 3R7WA 4HZIA 5AWFC 2J41A 3KQKA 4ASUD 1E2HA 3RC3A 1SZPA 3MWYW 1LF5A 1NVWQ 4CEIA 1K6MA 3L8YA 2QPOA 4JYBA 2DPXA 4KFUA 4NL4H 3K09C 1ESMA 1KDOA 1E9EA 5K8LA 1KNXA 3DM5A 4Q7KA 2BOVA 2JCSA 1U0JA 3C4JA 1N5KA 2ZREA 1T3LA 1Z6XA 1E1QD 3KJHA 1U9IA 3QPWA 5JSZB 5FL7A 2ZJBA 2VP5A 1MRNA 1G3MA 2G83A 3AF0A 1IBRA 2N46A 3IIMA 1PUJA 2WJJA 4HAZA 4TQ9A 3LNCA 3ZYCA 4R71A 5B2ZA 3SJBA 1WE2A 4NPHA 4E07A 5IK2A 1SVMA 2WAYA 4TL7A 4HAUA 3T34A 3AVWA 2XZLA 4C0LA 2W6IA 1AKEA 3WNBA 4Q1EA 1G5TA 4CW7A 3A4MA 1Q1QA 1X6VA 2W6ID 4QOSA 3WYGA 3WMGA 3QG5A 2IYXA 4KBFA 1Z2CA 4PSAA 5SZJA 5JS8A 1IHUA 2GEVA 1G41A 2IL1A 2ZRGA 4L4UA 1GP2A 2HDNB 4M0LA 4PAQA 3SDZA 1CTQA 1RRCA 4A0GA 4V0OA 1P2TA 3E2IA 4QBGB 1II0A 3QXHA 1G8PA 2ZJOA 3EG5A 2V7QA 1EFUA 5AJVB 3LXXA 4KO8A 4A8JC 3B1VA 3CR8A 4LV6A 3W34A 3ZVNA 2F3RA 1RJ9B 1XB2A 4XH9B 3HU2A 1OXVA 5DGXA 3SHFA 3NC0C 3SBEA 1W47A 1WCV1 4CZ2A 2GVDC 2ZUBA 1Z0JA 4FXPA 5EE0A 4HLUC 4PX9A 3SJCA 4BLTA 1ZD8A 1D8TA 4F91B 1KJZA 2JLVA 3RDPA 3PVSA 1J2JA 1QZXA 2H8KA 2MSCB 3LW8A 1ZW6A 3F0TA 4V0KA 1XD2A 2YHSA 4RJLA 2RCNA 4KAXA 1L2TA 4LV8B 4ACAA 1E99A 3OZXA 4EPTA 5G41A 3CH4B 3ECCA 5FPKA 3GJ7A 4MDEA 3HYTA 3GP8A 1CRQA 3TW8B 1CXZA 1AGRA 3TMKA 3WXMA 2GEDA 3DEFA 3CKLA 3O8DA 3M4YA 4BE7B 2CBZA 4G3XA 4XJXA 3RWMB 1VG8A 3KKNA 4ZPXA 2IF2A 2GESA 1KZGB 1WBBA 3L8ZA 3AP2A 1E2LA 3OESA 4QJ3A 1IN8A 2ECKA 2X1VA 4KXFB 5KPDA 4B75A 5EXSA 1NMXA 2IUSA 5IHPA 4D0NA 1AS2A 3CF6R 1K5GA 2GZDA 4Q4JA 2OCBA 1KSJA 3FFBA 3KDSE 1E2QA 1TL7C 4GT1A 3ZVRA 3K0CC 4URZR 1U81A 4EFLA 3RC8A 2F9MA 3CW2A 3BWDD 3UG6A 2AKYA 1OPXA 4YC7A 2G1KA 3KKQA 1XJ0A 4L15A 1XTKA 2VL7A 2CL6X 4FW9A 3GLFA 1M7GA 5FUWA 2WIBA 2ZI5A 5F2EA 4DCSA 2PT5A 3QXJA 4HSEA 5DI9A 1N3BA 4IOJA 4IW3B 4PPQA 2FF7A 4WAUA 1QHYA 3I3SR 2IX3A 2ZYTX 2FMXA 2EFHB 2VYFA 2C95A 4PSKA 1NMZA 1H8ED 4JBWA 1VCMA 3FKSA 1VYTA 4LZZA 1W4BA 3GJ6A 3FMFA 2J7PD 5KSYA 4DBLC 1M2OB 3BE4A 3PFIA 1T0HB 1KNQA 1ZC3A 3CWQA 4PQFA 4G5OA 3T1QA 5CDFA 2Z4RA 3DOEA 1NSFA 2WPDD 1LTQA 1E1RD 4ESHA 2QTVB 4WA7A 3IBGA 2V7QD 2H57A 4HDOB 1CIPA 1VHLA 2WAXA 4HLDA 2XX3A 3B82A 3IPYA 4Y0VA 4NYJR 4YDSA 1G20E 2GJAA 3KL4A 4PQRA 4WZ6A 4PC7A 3BJIC 2QI9C 3KUDA 3W6PA 3H86A 3REFA 2ZITA 1E9RA 3OAAA 3LQRA 2QQEA 4U02A 5E7IA 3EXAA 3TGPA 4IOKA 3IDQA 3GJ5A 2GXAA 2NG1A 3OIUA 5FI1B 2QU8A 4TZ0A 2FFQA 4JYCA 1F2UA 1YHNA 4F92B 5EXPA 1E94E 4HDQB 3GFOA 4HYYA 5F9HA 1D9ZA 4A36A 2FNAA 2HT6A 4V0MA 1E0JA 4DIEA 1N0UA 3IO5A 4HZUA 1RRPA 4DLUA 5DIFA 1TUEA 3W6NA 3R20A 3KX2A 4IFEA 1OKKA 3ICEA 3RANA 4B76A 4ITRC 1IY2A 2XSZA 2DCUA 2WJHA 1ANKA 5K8IA 3NIBA 1XMIA 1D9XA 1P4SA 2SHKA 4PHHA 2WHXA 3EARA 5L3SA 4TMVA 4DXAA 1Z0KA 1OH6A 2PX0A 1SKYB 2XNSA 4FMDB 2YNMA 3WMEA 2E9SA 2AFHE 2ZSAA 4B6FA 4D0GA 3O8RA 4LJYA 4JVNA 1GKUB 4A0FA 1DADA 2BMJA 2Z83A 2BBOA 1COWA 1GZSA 2FEOA 4Q47A 1XU4A 3TRFA 3VFDA 3AEZA 1T5LA 3VX4A 1BH2A 5HPYB 5FBWB 3BOSA 5H8WA 3MCAA 3IEUA 1L4UA 2W0MA 1S9HA 2BM1A 4B33A 4DHEA 1UBGA 4P33A 1N5LA 2EFCB 4ZIRB 2QBYA 3T1VA 2LKDA 1KJYA 3TH5A 2Z43A 5FR1A 5JCZA 1IONA 4CGZA 2N42A 1Z06A 3QF7A 3B78A 1QF9A 3AQ4A 3BFXA 4WZBE 2ZI9A 2VH5R 3NBYC 3WNDA 2O0HA 1XXHA 1FP6A 2FN4A 1BOFA 1CLUA 1QHSA 2B8TA 2YWEA 4UXJA 1E69A 1X8KA 2XB4A 3GFTA 1ZU4A 1P9WA 4JLPA 4QBFA 2BDTA 3SN6A 4DDVA 3AGPA 4W9MC 2B21A 4B3FX 2EYQA 3QKRB 4XVRA 4XOIA 2CL7X 1SGWA 2F55A 3AGQA 4C2TA 2JLSA 4A82A 4RZ2A 3TQCA 3TSZA 1AQUA 2O0KA 3MMPA 4M1OA 5D3QA 4N0EA 3W8NA 3VR6A 1E2NA 3B5JA 1W4RA 1XNJA 2QMEA 4JLKA 1OB5A 2IYVA 2MMGA 1W46A 2ZRJA 4CEIB 4MYUA 2KJQA 1S2MA 5AJZA 4EAQA 1T8TA 2IYSA 5JWOA 1XEWY 1AIPA 3O8BA 3AVQA 3LV8A 3DMNA 2PH1A 4Q66C 1T0JB 4LJ8A 3A4LA 3QKSB 1OFTA 2ZANA 1E2IA 1JB1A 1P73A 1AS3A 3OFNA 4DEYA 2V9PA 1E79D 4DDUA 1G64A 2R2AA 3X1XA 3AKEA 3QEJA 4NKRA 1XZQA 4QXAA 3TIFA 3QBVA 4IDQA 4BPBA 3MRSA 4Q1DA 3NBFA 1XP8A 2ANBA 3QBTA 2RGNA 1NKSA 2BJWA 4JLBA 1VCNA 3FKQA 3UXMA 1TF2A 3RS4A 4DCTA 3K70D 3DVLA 4OBEA 2H7VA 1XBTA 1E9FA 2WKQA 4DUGD 1Z2AA 2PMDA 2Z4SA 1L4YA 2IS4A 4Q5IA 3B7GA 2O8DB 2PT7A 3EPKA 1OH7A 1I2MA 4QM6A 4R2HA 5D3MB 3B2EA 5J4VA 1KO7A 4A2QA 1OFHA 2F7SA 4LHWA 3FKSD 1W5TA 3I62A 1Z28A 2WJIA 1DTSA 2BCGY 1U0LA 3MSXA 5K8UA 3JVUA 3VR4A 1XTSA 2JLYA 2P0EA 1EXMA 2ZRIA 3WHLA 1XEXA 1IXSB 2JJ1A 3GJ0A 4A92A 1YR6A 3THOA 1C1YA 2BCJQ 3QKRA 1TNDA 2GKSA 4QL3A 4TMXA 1DG1G 3FVQA 2EU8A 2QT0A 4DIDA 2QZ4A 5EP4A 1EX6A 4LJ4A 4P31A 3TE6A 5EJEA 2RGXA 3EZFA 4XSHA 4PSVA 1AJEA 3AVYA 5C46F 2VTKA 3KFVA 5AUOB 5J4HA 4D2IA 1XCGB 2CHQA 3BXZA 3GEIA 4RFVA 4B3CA 3CO5A 2CE7A 4JVMA 3ZJYA 3U6BA 2RB4A 5CIWA 3EIQA 3ZD6A 1CULC 1ZCBA 2IYLD 2ZI4A 1ZNXA 3DKPA 3W8RA 2VQSA 4BRWA 3BIFA 1EFHA 2FU5C 4MQBA 4F4CA 2DFKB 4KJZA 2QP9X 4NCIA 4IDOA 2ZVQX 2OXRA 2OILA 1J8MF 1FZQA 1AKYA 4M9SA 3MJHA 4FIDA 4OQNA 2QRZA 2N1BA 3A8TA 4PO1A 3S1AB 3SHWA 2IEZA 2FFHA 4I4LA 2XTMA 4DSTA 1TMKA 5BWMA 4TLDA 3PEWA 2ODEA 3ZLJA 5FTJA 3VNVA 4XVQA 2OAP1 1DBSA 1ZM9A 3Q72A 2GK7A 1UKEA 2OXCA 1KI8A 1DO2A 3OEED 4C0AC 1SVIA 1VG9B 3RRZA 1F48A 5F3WB 1H65A 4W5HA 5EXTA 1OFUX 2WWXA 1AM4D 1HUQA 1XEXB 1W36C 3TAHA 1E2DA 3A1UA 4RD2A 1KYIA 3K9GA 2QT1A 2BMEA 2AN9A 1UEIA 2J0UA 3GLFB 1TQ2A 1JR3A 4QM7A 1JAIA 2C9YA 3UATA 1K8RA 4M1MA 1XPRA 3OF5A 2OFXA 3K70C 3C41J 5H68A 2FGJA 1SVOA 4BLOA 2BEJA 2WSSA 2CCGA 1GWNA 1HTWA 2GNOA 4JIMA 4II7A 3UANA 4B43A 4ZI2A 2XGJA 5CITA 4ABYA 4Q4HA 3QVUA 2ZSFA 4KLNA 3Q5DA 3GMTA 4TMZA 2GJ9A 2IF0A 1YRBA 2HLDA 3TQFA 3VTKA 1XX6A 2GZHA 4H9GA 1SXJB 3QXSA 2A5GA 4DLVA 4PANA 4A4DA 1XWIA 3ZH9B 1ZM7A 2RGGA 2ZAOA 1W36D 3CF0A 1G8YA 4D26A 2NOAA 4B3DA 4MKHA 1JXMA 1A2BA 2HEIA 2UKDA 3DM9B 4X8LA 4UJ5A 2CJWB 3LWNA 3T12A 3TW4A 1AS0A 3GLFE 3QSYA 1WRBA 3VR3A 4Z54A 3K0EA 1OSNA 2RAPA 2OBNA 4PHGA 1UDXA 3SYKA 2GBLA 4RKEA 2QPTA 1XEWX 1TUIA 2D62A 5DO9A 1W0KD 1S0UA 2Q9CA 1NJGA 2GXSA 2RKOA 1P60A 3MG9A 3E70C 1XF9A 3CNOA 1F2UB 2WZQA 1G8HA 3IILA 2YWFA 3CRVA 2P6RA 2AK2A 1MV5A 1NN3A 2ZS9A 2J87A 1NG9A 1XMJA 4NBSA 3U3OA 2IYZA 3AP1A 2ODNA 3WRXC 4IVRA 5SZKB 2BVNA 3RSLA 3BFKA 1NLYA 3AVPA 3CLVA 2V1XA 1W7AA 2XSZD 4WZAE 1QHHA 1P7CA 1X3SA 3ADKA 1YZQA 5JEEA 4Q9HA 2HCJB 3BH7A 3B60A 3KJGA 4NCHA 5FL3A 3K9HA 3RS7A 4LI0A 5AJYA 4B35A 1E6CA 2YOGA 1W0JD 4OK5A 1NMYA 4QGAA 5C4MA 2ZETA 1CS4C 2I4IA 4EQ6A 2ZPTX 1ODFA 1IN5A 4Q02A 2MSEB 1R10A 1WF3A 2VP6A 2W0SA 1C9KA 1FUUA 2VP2A 1ZC4A 4Q03A 2BMDA 3H2YA 4URWR 5FUYA 2ZJ8A 3U44A 4OKSA 1TQ6A 3LBNA 1XEFA 4DLYA 1HYQA 3D6TB 1R8SA 2QM7A 3T1TA 3PUZA 2MSDB 2CJWA 3CB4A 3DDCA 4BFZA 3QNUA 5L3QB 1GKYA 4EPYA 1XCMA 2D3WA 4LYJA 3VKHA 1KSHA 3WBJA 5B57C 4DB2A 1VYUA 4C0KA 4RZ3A 3TUIC 4AYTA 3ZIAD 4OK6A 3DOFA 2GF9A 3EPLA 3U7GA 1OYYA 4G0NA 4XWOA 2FFBA 2QE7D 5JRZA 5AJXA 3ZIAA 1W2GA 3WHKA 4Q9IA 2GETA 1CJTC 1DAHA 2ERYA 2OT3B 4OHWA 4AKEA 2O8FA 2F43B 1J7KA 2MMCA 1ZIPA 1OV4A 1YJ5A 2D7DA 1N2CE 3E5HA 4KI0A 3B13B 2DWOA 2G0TA 2EFGA 1HQYE 2X8AA 3N2IA 4DLTA 1EWQA 1SULA 1E32A 1A5TA 3ZS8A 2AX4A 1GTVA 1XZPA 2W58A 1KOFA 3MWKA 4KYUA 1P2VA 1PV4A 4JBYA 4A15A 3QPVA 1QHHB 3KKPA 2PZFA 1VTKA 3RNLA 3DL0A 1U99A 4A8JA 1ETUA 3SU8A 4IFBA 4B44A 2WSMA 1E4YA 3I1FA 4TYQA 4I1VA 4WW0A 5BYKA 4TSFA 1KKMA 4YXWA 4BZXA 3GFPA 1KSFX 1N6LA 4DEXA 2VHUA 3NHBA 2BBWA 4CEHA 5DISB 4DLSA 5FPYA 1ZNWA 3LXRA 1E3MA 4E22A 3AVXA 3L0OA 2BMFA 2YC2C 1GKIA 4CT4B 2V6IA 2WPDA 2ATXA 3BB3A 1FPMA 4TQUS 2ZJAA 2ZRHA 2C78A 4K8OA 1P9RA 5KPJA 4NH0A 1Z22A 3VAAA 2JIZD 4TN1A 3CZPA 3C7KA 4QGHA 5L3QA 4C2UA 3SEAA 2QSYA 1VG1A 2QP3A 5TMPA 2D2EA 3SFZA 2ODBA 2P6NA 4B2IA 2IS1A 2VHJA 3CPJB 4TZ6A 1W5SA 2KBFA 2PCJA 5H1YA 1EFTA 4MH0R 5EE3A 1S1CA 4ZI3A 2ASEA 4JLNA 2O8DA 2JJ2D 3L82B 4M21A 3NHAA 2I3BA 1J70A 1QDEA 1KY2A 3AH8A 2WOJA 4I1OA 2NIPA 2O8FB 2RHDA 3CM0A 1AN0A 1E9DA 2DFNA 1OJLA 4JJZA 4GOKA 1GRNA 4EPRA 3REGA 1NIPA 4U5XA 1G5PA 2ZJZA 4GBMA 1FQJA 3NBZC 4OI4A 4DB4A 2J9RA 5FOSA 1OIXA 2LCFA 4HLUA 4D4JA 3U7FB 4X8OA 3VQTA 2EWVA 3P32A 4DKXA 3PEVA 2QMUA 5IK2D 4CDGA 1CJKC 1N0VC 4MGKR 5JLJA 1OKKD 4ZKEA 1KO8A 4HB3A 5FUVA 3NDBB 2DWPA 3TK1A 3QUSA 1II8B 2A78A 2QAJA 3RRNA 4TL8A 3HR7A 1XCPA 2CEAA 2P5SA 5TARA 4P3YA 1VHTA 1ONBA 1I4TD 3T5GA 1JEEA 3Q7PA 1PLKA 2FEMA 4G5QA 2TMKA 4US1R 5FOTA 4HB0A 5J47A 4ZKDA 1PUIA 2JJ1D 3DZDA 4LHXA 4TTQA 5LB4A 1X8LA 3I4LA 4B74A 2WWHA 3RS0A 4GRAA 1IXZA 2QPAA 5LD2C 3THXA 5TVKA 2RGAA 1JALA 1OW3B 3BAFA 2GRJA 4B71A 3ICQB 4U7DA 2J3EA 1P6XA 3FB4A 4M8NE 2CDNA 3I61A 1R6BX 1ESNA 2BKUA 3C8UA 4JL6A 5KSZA 2ZE7A 4URYR 1QVAA 3B85A 4DZZA 2OE2A 2VP4A 4IHQA 3GLGB 2D2FA 5JSZA 2XZPA 2BIFA 4G5SA 1U9IC 1KIMA 3AVOA 3AF4A 2NMVA 1MR3F 2P5TB 3LBIA 4PQYA 3GLGE 5J40A 1A4RA 4RD6A 4HEJA 2XTZA 3ONWA 5JHHB 2YC4C 3OIWA 2ZI7A 5FPTA 2BM0A 3EZ2A 3KXKA 1YZNA 4ESVA 1ZUIA 3PIRA 1ZIOA 3RHFA 1Z0AA 2QG6A 1VIAA 4NYMQ 5B30A 2REOA 2B7BA 2ZQ5A 4CYMA 4L16A 2OM2A 3KXIA 4A1FA 2QGNA 3ADBA 1IJFA 2R6DA 3EIEA 1N0WA 1TAGA 2Q9BA 3QKUA 4HAYA 1A82A 2IS2A 2O8CB 4P4SB 4KFTA 1ZU5A 4DCNA 4GZMA 1GFIA 2D4HA 3ZQ6A 2ZRKA 1XDBA 5AJWA 1L8QA 4B47A 2PBRA 3IIJA 2GJKA 3IGFA 4OHVA 1UKVY 2FPKA 2ATVA 3IEVA 2C03A 3BRWD 3AKCA 4DJTA 3W5IA 4DT1A 1UADA 1LY1A 4NCJA 3T35A 4WXRA 1TU3A 3I8XA 1BIFA 2AD5A 3GEHA 2J7KA 5CK5A 1P3JA 1YKSA 1Q44A 3A37A 4KSCA 3RS5A 2QY9A 2PLFA 5JFGA 2WWGA 4XWAA 1UKZA 4Q00A 4FWIB 4QBIA 2G88A 4O2RA 4DDTA 2FDCA 1Z6TA 3AM1A 5HR5A 3QXXA 1XD2B 2GHIA 2HXSA 3GLGA 1SVLA 4GL2A 4JBXA 4RKFA 1E2KA 4U00A 3IHLA 4KCGA 1G7TA 4ZCIA 5HZKA 3MUFA 4Z51A 3SZRA 1SVSA 4PPFA 3PJRA 2Q3FA 3GLHE 5EP2A 2Q21A 2NO0A 4L9WA 1V43A 4BGDA 3V4RA 2AWOA 1YE8A 2VRWA 3QPUA 3A4NA 3LVQE 4PHFA 2Y8EA 4MKFA 5C18A 2ANCA 2VIIA 5HCIA 1XPUA 4C7OA 3FE2A 3SBDA 5FPHA 3R8FA 2F1HA 2UZIR 1XXHE 1S3GA 3L0IB 4TT3D 1RW4A 4KFRA 4C30A 4ARZA 4BLQA 3W90A 2H18A 4NYJQ 5GJWC 4KODA 1G8GA 3VKGA 5BN3A 3THWA 2WWWA 4LJ5A 4OQLA 1YVDA 1KK0A 2CLDX 4HDCA 4I1UA 1A7JA 1NBMA 4LBYA 1W0JA 3EA5A 4P4SA 4QG7A 2WVJA 4BEJA 2WBLC 4TYPA 1KK1A 4D80A 2XEXA 5EP3A 3GJ4A 1I4DD 3PENA 5GJBA 1PZNA 1Z3IX 2H1LA 5JWHA 4CF7A 4K46A 1IM2A 3TUZC 2F6RA 2IWHA 1RFLA 1GAJA 1M1YE 4W5WA 1N25A 5P21A 3K0CA 4V0ME 3OEHD 2QMHA 2Q6TA 3GJ3A 2ZXUA 4DSUA 2VSOA 3RWOA 2OUKA 4QJ5A 3RLFA 2R6FA 1DE0A 2OO7A 4MKGA 1DAMA 3PUWA 2LWIA 1BYUA 1T91A 3LFUA 2XOKA 2AWNA 2O8BA 2A5FA 2JEOA 4FI3C 1X1SA 5HZHA 3DO6A 4AYWA 1KMHA 1AQYA 3DMDA 3EZ6A 5BN5A 1ZD9A 3KQNA 4ZO4A 1ZBDA 2QE7A 2YOFA 2ZYUX 5KUTA 2OCAA 1Z8FA 2OLKA 4GP7A 4QHTA 3CRW1 1R8QA 2JLUA 2V54A 2BKEA 2A5JA 1WQ1R 3HJNA 5E4FA 3UPUA 2GJ8A 2G0NA 3GJXC 2QM8A 2Q9AA 3KQHA 4A6XA 3FMOB 2FV8A 3PITA 4YQFA 3EW9A 4H1UA 5DE3A 4CEHB 5FTKA 2JGNA 3Q3JB 4M2LA 1SKYE 1OH5A 4HAWA 3U3MA 4UNPA 1E2JA 3HYRA 1OLOA 2WSSD 5CDFE 1YZUA 4MGZR 4EPXA 1RRFA 1WMSA 2C99A 3TBKA 2CK3D 2FE4A 3U5ZB 4O0MA 1E98A 4BFUA 4NZYA 2W2VA 1P72A 1HEIA 2CK3A 1G4AE 5KHOC 3L2OB 1F2TA 1UEJA 4BECA 1G18A 4CVNA 1OB2A 1EK0A 1NVXQ 3QF4B 3I5YA 1E9BA 2IBMA 3AVVA 3FFAA 3PCRB 1E1QA 4OQXA 5TB5A 2AFIE 2ZSEA 2A5DA 3AB3A 3C14C 2DWQA 1JPNA 3AVUA 3PEUA 3LX5A 3U4QB 1YQTA 1R5BA 2ZRBA 3TVTA 5IF9A 2VO1A 3I73A 3AF2A 4UQOA 3GQBA 5FPSA 1NN1A 2G1JA 3JZMA 1U90A 3CWZA 1KMHB 1CR4A 5A4JA 4US2R 3J81k 4PC2A 1UAAA 5BYJA 3CNLA 1NBMD 4QRHA 2R65A 2XITA 4FCVA 2IYRA 1XPOA 3I92A 2VHTA 4FN5A 2WM9B 4G5RA 4PXAA 1A1VA 3SQXA 1US8A 4Z8XA 3ZZTA 2QTHA 4C0JA 2HUPA 1UFQA 4LX0A 2GAAA 4NYIR 4LHYA 2QENA 1W49A 4Q18A 4Q1CA 2QSZA 2V6JA 4K81B 4MRNA 3TR5A 4YDHB 2ZUDA 3F3YA 4FINA 1XJCA 1YZGA 3HPRA 3CBQA 2IXGA 3EWSA 2ONJA 1XXHB 2ZJ2A 1MRSA 1XTQA 2QP4A 3U6KA 4TMTA 2ZRPA 3M6AA 4BFYA 4HUTA 4NONA 5FBRB 1M8PA 2WTUA 2RGCA 4WOPA 3WMFA 5IT5A 1KJWA 3LQQA 1SQ5A 1GNRA 3QQ5A 1CJUC 1NY6A 5KSPA 4B3XA 1N5IA 1Q57A 2ZU0C 3B1YA 4FMCF 1RJ9A 3MJRA 1KI1A 2FX3A 2RHMA 1M34E 1KI2A 1FOEB 1JXOA 3WRYC 2W2TA 4AC9A 4O3MA 1IN7A 2YJTD 4PC1A 1IN6A 2EQBA 4B6EA 5CB8A 1JQJC 2WWFA 2GCNA 4QGFA 3PEYA 2FSFA 2QN6A 2KWIA 1W2HA 4Z8YA 1DVRA 4DRZA 3HWSA 2O52A 1VKJA 4IEEA 4D25A 1KI6A 2OZEA 4FMCB 4TLBA 4JSTA 4PC3A 5BXQC 1US8B 2PEYA 2D06A 3BH0A 3H84A 3PQCA 4JL5A 2WICA 4UNSA 2VSXA 3CF2A 4RD4A 2ONKA 1R0XA 1G3QA 4L9SA 4AI6A 3VKWA 4PPGA 4DWJA 4AY2A 3X1WA 2XXAA 3NEYA 3U3KA 5DYIA 1UPTA 1D2NA 2ZE8A 3N2EA 1B23P 2CXXA 4KVGA 1S3SA 2GZAA 4BEBA 2ZRCA 5KTYA 3KJIA 1NJFA 2BJVA 3UG7A 2XB2A 1WXQA 2C8VA 1UBEA 1KGDA 1CF4A 2IS6A 3VHLB 4EUNA 2GBLC 2DBYA 2CLCX 1AZSC 2FGKA 4NDZA 2IUUA 1NF3A 5IDVA 1IOZA 1G19A 2QAGC 1VYVA 2QNRA 2JA1A 4GOJA 1N6HA 1KI9A 4TLAA 2ZIAA 2FZLA 4PZZA 3DKVA 4V0LA 4L5BA 3OFND 1IY1A 1ZM4A 2CCJA 3O8CA 1Z5ZA 1JR3D 2J5XA 4JKIA 1V5WA 5L3RA 5F98A 1M7HA 4TWZA 4OQMA 3UMSA 1EWRA 4Q7LA 2JDIA 1AA9A 1NP6A 3ZVMA 2FSHA 4Q9KA 5HE9A 4LY6A 4O2LA 1GVNB 2GF0A 5JJIA 4MRPA 2OBLA 2CNWD 3P27A 4FMDF 5KDOA 5AR1A 2H92A 5EE1A 1I4LD 2BBTA 2JJ2A 3UWOA 2E1RA 1IN4A 3QG1A 4AURA 1Z0FA 1G5RA 2LKCA 1GSIA 2NO9A 3OAAD 1XRJA 5AK0A 2IA5A 3S1AA 2YVUA 2VSFA 3IKJA 3CNNA 1GG2A 2OEPA 4OQFA 3GLIA 3WY9A 1MABB 1Z63A 1ELOA 4KSBA 3HU1A 4Q19A 5KOYA 3EZ7A 4IXNA 4P4UA 1LV7A 2KE5A 5ANRB 3RSOA 3CPHA 2F9LA 3T1OA 3Q85A 3SE0A 4C7OB 1TEXA 4FCTA 2OSBA 1MO6A 3FTQA 1S8FA 4BLPA 3OE7D 1SVKA 2IXEA 5FBQB 1FUKA 4LPKA 4I1SA 4D0LB 4DUGA 3SFVA 4E09A 2VF7A 1LVGA 5L8VA 4OJQA 3RABA 5LPNA 4HZUB 1OF1A 4F93B 4MUBA 5GADl 1G6HA 2PLRA 1JI0A 5CYOA 1VG0B 3KTAA 4M4SA 3GLHB 4YMSA 5DN6A 4URVR 1R5OA 3RVBA 1MT0A 1LF0A 2WV9A 4EJSA 3OIVA 5DN6D 821PA 3O47A 1YR8A 4NU0A 3RS3A 1DOAA 4JMPA 3LVRE 3QVVA 2EFEB 2WKPA 3WBKA 4LOAA 5LBIA 4OI1A 2W2XA 4LJ9A 1KMQA 5A0FA 4LRWA 1KI4A 4C0SA 3A1TA 1GOTA 4G1UC 4RD0A 2P67A 3EPHA 1SXJA 1KY3A 1OXUA 4TMWA 1OIVA 4M9XA 2ZS7A 2QUZA 1ZAKA 1P62B 4ZDWA 3VR1A 1Z6YA 4XD7D 5G3YA 3CRMA 3SR0A 3AUYA 3FYHA 3NC1C 4IXMA 4XTCS 4B2PA 2JATA 1G7RA 4Z1MD 3PUVA 3PR1A 3ETLA 1BS1A 4Q21A 3GLIB 4A2PA 2WWIA 3IIKA 4BFXA 4FWTA 4URXR 1MOZA 2GXUA 2FSGA 4HUQA 2B8WA 4W7SA 2GTPA 3L0SA 2R6AA 1QBKC 5EXXA 2A2ZA 1QVRA 1W36B 4ACBA 1RYHA 4C0QC 5FBLB 4PZYA 4AG6A 2EWWA 1DPFA 1FTNA 1Y3AA 2XAUA 4JKYA 5TDHA 3K8YA 2D74A 5HKKA 2ZS8A 2X2EA 2IC5A 1LB1B 2ORIA 3SC3A 2ERXA 2PX3A 4MUAA 4EPWA 1JJ7A 4JT2A 2HJVA 4BASA 2XJ9A 3SS8A 4Q1FA 4B34A 1FNNA 1VMAA 3QF4A 1NN0A 4GOXA 2F1JA 4JJKA 5HCNA 2GXQA 5TV2A 2GCOA 2ZI6A 4GI7A 5TY0A 3ZZUA 1RC8A 2D7CA 3D3QA 3CR7A 1JEDA 1GL9B 4JLAA 1EESA 1L7VC 3K09A 4DLRA 1GRQA 4JVSB 1M74A 5G53C 1G3IA 1W1WA 3P4YA 3M0EA 4NYMR 4WIAA 4YMTA 2QTFA 3C15C 4LYFA 4EDHA 1H8HD 3EA0A 2CVHA 4JVLA 3I32A 2EFDB 1C4OA 1KTVA 2R44A 4IRUB 2GVZC 2P2LA 1NVUQ 4BWYA 2J0VA 1MKYA 1MO4A 3B1WA 5KYKA 1RRGA 3VU9B 4B32A 2VP0A 2X19A 1G7CA 1G8FA 1HH4A 2ZM5A 1U8AA 3B1ZA 1U8ZA 4JLVA 3T06B 2ZYWX 3SYNA 3ZVLA 2V3CC 3LH5A 1CR0A 2BBSA 4R9UC 1DARA 3BK7A 1NKTA 3D8BA 3BBPA 3NBXX 1X86B 4JLOA 4X8MA 5JMTA 4ZCLA 1ZYUA 1Q3HA 4TYWA 2H17A 2F43A 3MWJA 2PCLA 4JZKA 2BC9A 4EFNA 1W48A 5DYGA 4AD8A 4ZDIA 4PO9A 3A1WA 1GNPA 2PJZA 4M1TA 4IKEA 4BQSA 6Q21A 4WXPA 4MDFA 1BO6A 2VP9A 4G01B 3A58B 4BFWA 4D82A 3W3ZB 3C5HA 4Z1MA 1IQPA 3M1IA 2GK6A 3JVVA 2BEKA 4V02A 1G6OA 1RIFA 3AV0B 4LJ7A 1GL6A 4MYTA 1FNMA 2YV5A 1LS6A 2GILA 1UKYA 3GJ8A 4B3BA 5L3SB 2W6JD 3W5JA 4OL0A 1Q22A 2QL6A 5A5GA 2BV3A 2IYWA 3KZ1E 1XFAA 2OAQ1 2RGBA 3SQWA 1XD9A 2ZR0A 3BORA 1SXJD 1NVVR 2B92A 1T4GA 3SI7A 4HI0E 4JSYA 1KI6B 2ZRNA 3UWKA 3MGCA 3PXGA 4LK2A 1E2PA 3LAWA 1S9DA 3B6EA 3TNFA 1ZJ6A 4NHOA 4EJSC 3CX8A 2XZOA 2GWHA 1II9A 5BW8A 2WMNB 3WYAA 2V55B 1TU4A 2QA5A 2HYDA 1CJVC 1EGAA 4OI0A 3UMFA 4BZQA 5HE8A 4D81A 3MLEA 5CJ2A 1KO4A 4ZDJA 2DY1A 3QIAA 3Q9LA 3NG1A 4QFMA 1Q1BA 1YU9A 1COWD 4JT4A 2NPIA 2OCYC 2QEQA 1ZNYA 221PA 5CB6A 3PUYA 1Q21A 5EZ5A 1CP2A 2C9OA 4KYIB 4LYAA 2R9VA 3UKDA 2R62A 5E95A 4TYNA 2QQ0A 1TF7A 4ASUA 1UBFA 3K9NA 2A9KA 4C4PA 2FH5B 4WVFA 1JPJA 4BLRA 1K5DA 4RY2A 4QC2A 2REXB 1SKQA 1KDTA 1JR3E 3D31A 2IYYA 3EX7C 1UF9A 1KO1A 3X1ZA 3CPEA 5FFMA 5GJVC 4P32A 4A0HA 1D2EA 3U7EB 4Q48A 1UBCA 4BFTA 2JLWA 3CRQA 3L0PA 4NE2A 2X77A 2XJ4A 4UJ3A 2WWYA 1WB9A 4O25A 1N6NA 2VPPA 3AVTA 3U3RA 2PZEA 2W00A 5FOVA 3K0SA 1RYFA 1M7BA 1GITA 4RFSA 2O8EA 4B2LA 4M22A 1N6IA 5C4GB 5HKKD 2RGEA 1HE1C 2XNDA 3N5CA 3HP1A 4IVPA 4JS0A 4PZLA 1DG3A 3IQXA 2J1LA 3Q7QA 2YOHA 1D6JA 1A2KC 4PC6A 3WYFA 4XSGA 3A36A 3THXB 4DCUA 2ZR7A 4US0R 1FX0A 3U7HB 4TTRA 5C2JB 4RVCA 4GDFA 3IPXA 3QI2A 4XTRA 5GVRA 3LX8A 5HTKA 5BN4A 3U2QA 2J0QA 2CE2X 4UXIA 3NVAA 5H70A 3G5UA 1MO3A 3ASYA 3TKLA 2EYUA 5J5CA 1RPZA 1Y63A 5FOWA 4DC9A 1OH8A 5AUNB 3ADCA 3KB1A 1NY5A 4Q4JB 4EPVA 2G3YA 4POAA 2JLQA 4M9QA 1HT1E 4Q7JB 3SJAA 5K8TA 4TT3A 1TX4B 1Q1ZA 2AXNA 2IT1A 2ZRLA 1GIAA 1ZMXA 3ZGXA 4D4KA 1QHXA 4QNRA 4OI2A 3AF1A 3NDPA 2ZJYA 1QG2A 2HJGA 2DR3A 2WJGA 2ZYVX 3KTAB 2G9NA 3RRMA 3GLHA 1MO5A 4TLEA 5JJKA 5KDDA 1NSTA 5FOXA 1G1MA 4Q7MB 5DH9A 4EJSB 4W5JA 3I5XA 4ERNA 4TTPA 1WP9A 4OYHA 1RZ3A 2VA8A 2YWGA 3K0AA 3NKVA 2OLJA 4IJMA 4S2EA 3N70A 4QKQA 3ADDA 3LO5A 1T9HA 4OHXA 1CEEA 3SJZA 2FSIA 1CR2A 1N6OA 4YMUA 3OE7A 4RFSB 5C1BA 2O8EB 5G40A 2UVQA 2ZU6A 3KXLA 1U98A 2DFLA 2NZ8A 4BRUA 1JR6A 4LYHA 2KI5A 1OXTA 3FHTA 1ZUHA 3T61A 1U94A 3BB4A 2AR7A 1UJ2A 1JAHA 5IRCD 1S4QA 4AKGA 5EZ6B 1IXRC 1Z0IA 3U60B 1Z6AA 3BERA 3AUXA 3CIOA 5F9FA 1NBME 2C5LA 4NYIQ 3WP1B 1AK2A 2VHCA 4TMKA 3KB2A 1OIWA 2A30A 2NTYC 2ZJ5A 3BB1A 2NPFA 4NCKA 3X2SA 2ZROA 2FOLA 5KNCA 4LCBA 2BHRA 4GFDA 2PEZA 2IUTA 3H1TA 4PO8A 3K9LA 4E5UA 2EW1A 2GA8A 4E03A 1ZNZA 2VHQA 1VPLA 1JQLB 2A3RA 4MRVA 2QORA 1OXSC 1XTJA 4HB2A 4DSNA 3IO3A 1E0KA 4N3NA 2OBMA 1NVVQ 3FHOA 4QHSA 1KKLA 5UKDA 5JWRA 5KNDA 2HCBA 1WBDA 3GCGA 1ZD1A 4OHZA 1EX7A 2YWHA 2A7QA 4X8HA 5JZVA 2WKRA 1KHTA 3HDTA 3IHWA 3R9XA 5KDLA 1E0SA 5TXGA 4GP6A 2GCOB 3KQUA 2GJSA 1OHHA 5CM9C 4R98A 1NL3A 1CR1A 1E79A 1T3HA 2GCPA 1CBUA 4NP6A 2ZTSA 4GMXA 3C5CA 3H4MA 1NLZA 1G17A 1DS6A 2AKAB 4FD2A 2JDID 3BS4A 3AKYA 4QGGA 1U8YA 1LS1A 3W6OA 1T5IA 1H8HA 4HAXA 2CNWA 1LFDB 4RZUA 2IWRA 2EVWX 4LUCA 4MKIA 1DAIA 1H8EA 4FCWA 4BFVA 2NGRA 3CUEF 4ZV4A 2OV2A 4KFSA 2C04A 4KU4A 4MRSA 4CT5A 2O8BB 1IAQA 2HYIC 2FFAA 2OG2A 4ZIRA 4NMMA 5L3VA 2QBYB 3ND8A 1HT2E 1P75A 1BYIA 3FOZA 5JEDA 3B9PA 1E1RA 2AK3A 3SOPA 3E1SA 3I72A 3GPLA 2ZE6A 4YMVA 4V0NA 1G21E 2OCPA 2ZR9A 2Q3MA 1LNZA 4LSGA 2ZRDA 1ZM2A 2XTNA 2RGDA 4N1AA 2C98A 5CJPA 4GSYA 2Z6VA 4MGIR 4XWKA 4TQAA 4RD1A 4C0HA 5GVSA 3I8SA 2WIAA 3LW7A 1KI7A 1Z29A 5AUPB 3Q5EA 1W0KA 4DDWA 4TL9A 1TADA 5LDDC 2JLXA 3DZ8A 2ZRMA 1R4AA 2DFTA 4IOMA 2IYTA 4UNRA 1QG4A 4LPSA 5JECA 2F1RA 4WBSA 3QKTA 2GEUA 2Z0MA 3K70B 1FP7A 1NIJA 3H0KA 2PMKA 3KFXA 2IEYA 1FQKA 2P3SA 2P6UA 1DEKA 1EFRA 2QGZA 4GMDA 3LD9A 5FI0B 3MFYA 1OT3A 4H1VA 3A1VA 3EPJA 4Q4AB 1E2GA 3Q8XB 4EQ6B 5JBQA 2W83A 3U61B 5KSOA 2H5EA 3QKSA 3U3JA 3ZQJA 3U44B 4I81A 3RYTC 3A6PC 2IHBA 3IBYA 2OESA 2FJUA 4AIIA 1PLLA 1XTRA 4Y0AA 4A6PA 2RH5A 4UKDA 1MH1A 4GNKA 4IDPA 4M1YA 1ZM3A 1Z07A 3U4QA 3VR2A 3ZS9A 1T8UA 3EC1A 5AUQA 3LLMA 4R7ZA 4AK9A 5EE9A 2A5YB 1E96A 3TLXA 3V4FA 2J0SA 2CCKA 2C9CA 4KBGA 3F5FA 4UNQA 1KO5A 4M53A 4B3GA 2DHRA 4LBZA 2QROA 2ZEJA 4Q4LA 3TR0A 3W9YA 1BMFA 5D3MA 4F38A 1KAGA 3QY0A 2XOKD 2DB3A 1R0ZA 3BD9A 3B9QA 4LWZA 2JJ8A 3EASA 3K1JA 5JRJA 1FMLA 4PTLA 1J99A 3ZD7A 4A0RA 3CH5A 1FMJA 2DYKA 2I1QA 4Q9JA 1W4CA 5FH9A 1R0WA 1FTSA 1JECA 3HU3A 4M1WA 2O5VA 5JJLA 3LLUA 1XMSA 3THYA 4NTZA 1SHKA 4JLDA 4S35A 4DCVA 2F1IA 4A8JB 1J90A 2ODWA 1OHHD 2ZRFA 3GEEA 2OFOA 5DI3B 2PJRA 1HA3A 1G3RA 4TYYA 2ZVPX 1ZVQA 1E2FA 5E3HA 5FOUA 4EFMA 5JHGB 4LHVA 3T15A 5KO2A 2O8CA 5FL7D 1E2MA 4L8GA 4PPNA 2JAQA 1R0YA 4Q4AA 3EAQA 5J4LA 5CK4A 2I1VB 1JBKA 1Q3TA 2QAGB 3CZQA 4LHZA 1HY3A 1NRJB 5ELXA 4AG5A 1E9SA 4RCZA 1M6NA 4HATA 1E9CA 3QJYA 5FR2A 4I99A 4KHZA 2FPMA 3EC2A 2VLIA 1D2MA 1PJRA 2G77B 2J7PA 5CLLA 4LBWA 1FX0B 3ND9A 1DAGA 3ZZ0A 4BUJA 1B0UA 4TSFD 4YXWD 1VCOA 1SXJE 1D5CA 2REBA 1EFCA 2B6HA 1OE0A 5GJCA 3W3AA 1P2SA 2X2FA 3R8CA 3FGNA 1EG7A 4RSGA 621PA 3VMFA 4CEJB 1CJMA 1GDDA 5G3ZA 2YZ2A 4F4IA 1KDRA 1OYWA 1XJQA 1P2UA 4G5GA 4B73A 2R6CA 3FMIA 4D4LA 2IHYA 4HAVA 1JNYA 2ZAMA 4PHTA 1N6PA 4AWXA 3V9PA 1NG1A 2QMOA 2CL0X 4OHYA 2J0UB 3F8TA 1PVOA 2C2HA 2IYUA 3DPUA 4P0TA 1NI3A 1QHGA 3BFVA 3P20A 1KDPA 1G16A 3KKOA 4IEIA 3C16C 4Q1BA 3WP0A 3CX7A 4ARZB 1XMVA 3QEOA 5DI3A 3TJZA 2IXFA 4RD3A 2Z5FA 3PG5A 1II8A 1SVWA 3K0AB 4JLJA 1R7RA 3THWB 1CKEA 2ZE5A 4MRRA 5FBVB 4PFSA 1R5NA 2ZUCA 4BFSA 3AF3A 1WDTA 4Q4HB 4C3ZA 1TF5A 1S1MA 3SYLA
chains in the Genus database with same CATH superfamily
2QM0A 4NWIA 2QN9A 2WTEA 2P8JA 1K3FA 2H4WA 1YC2A 1GPKA 1U1GA 3NEJA 3Q0IA 5AH0A 3SOZA 4EOGA 1UANA 2WUWE 5I9SA 2IHTA 3WIEA 4FDLA 4JBHA 3HUFA 5KNBA 4F85A 3BGWA 1GUAA 3U39A 1GILA 1R6UA 5JCPA 5EUMA 2PL3A 1X19A 2W2NA 5AM1A 3R9IA 3CRRA 3DHWC 4GQAA 2JW5A 2C2KA 1N33B 3RREA 2ORVA 4N8EA 2COUA 1AHHA 1V1JA 1WP4A 2ZVDA 3EEQA 3OEHA 4ID3A 3VZCA 1VSVA 1ZITA 3VKFA 4E5YA 1FS4A 2NVUB 2NO6A 4D4HA 3E84A 3EGWA 1MB4A 1EUZA 3H5VA 4ZVQA 5HF9A 4KR3A 1U2GC 2ONYA 4UVGA 1JQAA 3KUCA 4Y6SA 3A1SA 2R6GA 1BXRB 1SC6A 3EIHA 3LDAA 3B1XA 3NTVA 4R2MA 1TT5B 2WAOA 1K63A 3DGFC 1TVKA 1U2QA 4J0QA 4N0DA 3OQIB 1I2BA 4MULA 2B2NA 1T6NA 5BQ5A 5LB2A 1MABA 1F6BA 3RVOA 2ZOSA 3UZUA 3V46A 4HF7A 1ISFA 4D6PA 5LOVA 3L7MA 3QP9A 1V2GA 3D7MA 3CUTA 3G8DA 4B48A 3DVSX 4LGMA 2ZSBA 1QBGA 1BXKA 1JQBA 4P38A 5FTLA 1VDZA 4EZIA 2DBRA 2JHGA 1E1MA 3GDFA 4WFIA 1M0EA 4N40A 1F3OA 3DZGA 4WCFC 3UOWA 5E7JA 4BEWA 1EK6A 4RW0A 1VLJA 3LRTA 5EE5B 5JE8A 3SLGA 4ALNA 3QOFA 1XAGA 3RSCA 4I5IA 3AKDA 1UZUA 2WJVA 4LDJA 1Z6GA 4IDFA 4B7XA 3O4VA 4JQZA 4BNUA 5C1OA 3LUHA 5TQ2B 5JJCA 2JLRA 4ND2A 4YONB 1Y4ZA 1MG5A 1QGDA 3O4RA 1FL9A 2O0JA 4LYDA 3VV2A 4CN9A 3HB7A 4DSOA 5DNYB 1AHPA 3MCTA 2OC9A 1XWFA 1DRWA 1GN8A 1U0HC 1BXZA 3DULA 1ZKMA 3ICPA 5JCOA 1QQ5A 3N5KA 4KRFA 3UMRA 2E4VA 1RWVA 3FDIA 5DHAA 4AJNA 2DLDA 4KITB 2ZIVB 4AICA 3TFOA 3H19A 1R0BA 2IPLA 3U9SA 4CFYA 3L7AA 3H1AA 4DW8A 4W5TA 3VHXA 3EXIA 5B2EA 1CC1S 4PEVA 4LZJA 5GZ6A 2R85A 5JI3E 4H7FA 1F0YA 4LJSA 1M2OA 4IHJA 3TLYA 4KK3A 2DTEA 1JIVA 3DOHA 3BE5A 2AT1A 3V4OA 5JFTA 2ZB2A 4YJ2B 4ZALA 1WUHS 4M38A 5IUKC 1DKQA 1CIJA 1F4PA 1Q20A 1YR9A 1Z7WA 4WOKA 3S55A 4CDRA 3HM9A 3K0FB 4YIHA 4BZPA 5A3QA 1SPBS 1XGKA 2QRGA 2G6BA 2OO3A 5TPZA 3RM3A 1N92A 1F5NA 4L5IA 1E8MA 4K88A 4U7WA 5IC6A 1YH3A 4G0WA 1G9XA 3D7SA 4ARVA 3F78A 5K6AA 2HHHB 4FR0A 2OFWA 2OCLA 2VBCA 3I2KA 3FYUC 1C4WA 4KQGA 4JUIA 3LWBA 4F7WA 1CUBA 4HGQA 4NVRA 3CX3A 5EP1A 1ZN2A 2VI5A 2CLLB 4XUCA 1R2QA 2YINC 4HPJB 1CU1A 4MW2A 2QIOA 1YZKA 1RQPA 2IHKA 4GZLA 1QXSA 2CLHB 5HF5A 2PT9A 3U9LA 1M73E 4M3NA 2Q2NA 1O94A 3TSOA 1TZBA 3U09A 1JWBB 2P65A 2QU7A 3F96A 1LDGA 3FHCB 2XH8A 3N6VA 3GUZA 1JKMA 2NQTA 4TTIA 3ORSA 2DQZA 2W6JA 4L4SA 4UTVA 4YLGA 1N1MA 1EH5A 1XD8A 4HQOA 1YJCA 4QTTB 3PC8C 1NR5A 1N6RA 1XDDA 2I4RA 1U63A 3A32A 1RWOA 3FTEA 5K99A 3RTAA 3E9EA 2OV8A 5DSZA 4LFAB 3DT8A 2HXYA 4U6NA 2Q3DA 3RAPR 5A4FS 3WLPA 2C5HA 4NY1A 1P61B 2G06A 4YMWA 4E5KA 1X0VA 1UJ6A 4LOHA 1KK3A 3R7BA 4UNNA 5G1OA 4DV7B 3LRPA 3M7IA 4IDDA 3JATB 2C94A 1XC7A 2V1UA 2H2DA 2A9RA 3ITNA 4F3RA 4TXJA 4BVAA 4OJKA 1SRQA 3HB4X 3H5TA 1ZKDA 1BKDR 2J59A 1NNUA 3WAKA 4EHHA 3OFSA 1WWKA 4YRFA 3S2EA 1QGUA 4EA6A 1BMFD 5DM0A 3R4VA 3ID6C 3NOVA 1N57A 3HPQA 4Y18A 2HBZA 4GQBA 2UVPA 2DERA 3QV1A 4K6KA 4PAOA 4RE6A 4WPGA 1PG2A 2H0RA 1PR1A 3NJ4A 2H1IA 1I0ZA 3SEFA 5KYWB 2DPHA 3ANNA 3N2ZB 3DDNA 3TLBA 1X8JA 1UXIA 1Q7TA 3NAQA 1R8XA 1K3UB 3M6XA 2C4WA 3S6JA 4EW1A 4N5MA 1NFRA 1Q2XA 2HRDA 5FKJA 5EWMB 5K1ZA 2O8BA 1E61A 3G0HA 3S44A 3WSWA 4RZHA 4KXQA 4DLXA 4MTCA 1PG0A 3QVJA 1JSRA 1NVTA 4FYPA 5ALKA 3HCOA 2ZRAA 3OJWA 1P1IA 3HR8A 1QK3A 1I2DA 2OCXA 3L43A 2A4KA 3TTUA 1O1YA 2IGTA 5EIBC 1ND6A 1DQSA 1CQPA 3MD0A 4MITA 3S2UA 3QFTA 1QHNA 5D6NA 5I9TA 4LE2A 3AY7A 4LC1A 2IYQA 2JHPA 3GNLA 1QTQA 1IHXA 2BH9A 1DELA 2Y4OA 3D8RA 5KBYA 2AOXA 1N1EA 7MDHA 4L6CA 1XCOA 3G0OA 1QCZA 1Z6PA 2FPLA 4U7JA 4C9BA 4ENVA 2JFUA 3OHMA 2AHOA 4LXTA 4OGFA 3TX2A 4F6RB 1T13A 4V2IA 5KX5B 1N7JA 2E87A 4B7UA 1ODIA 3FZYA 2Q5OA 2FUG1 4HZIA 4F3YA 3PQEA 3O0DA 3UHOA 3WIOA 4NFYA 1SCUB 1E3SA 4BQEA 1HF3A 4DTIA 4DY4A 1EWYA 4G0QA 1SZPA 2GB4A 1MF7A 4EI2A 4X1KA 4RWZA 3LT5A 1K6MA 1Q19A 2QPOA 4M99A 3D0OA 2DPXA 4KFUA 2VPXA 1E9EA 1C41A 4RSHA 4WFKA 4ETIA 5HTOA 2QZSA 1TJYA 3UV7A 1H23A 1JVNA 1U0JA 4ZQGA 1JTEA 4WKPA 2OHIA 5IZCA 2HCRA 3WLEA 4AP9A 4DCJA 3I4CA 2I6GA 2PVCA 1KR2A 4PTZA 5FL7A 5F33A 3DW1X 3DVRX 4MB0A 5DBIA 4L1KA 3V4SA 5EJ6A 4IIJF 1IBRA 1V9LA 2CZQA 2PGNA 1SIOA 1YNOA 1RCFA 2C5FA 3BSYA 4OUDB 1WU7A 3EA4A 3KM0A 4W8GA 4AX4A 4MS1A 3PD0A 4H35A 4NPHA 3REFA 4DR6B 3KPUA 4ZVOA 2LTAA 1CG6A 3ZE7A 5AVXA 4ARIA 2K7ZA 3QQPA 4LWPA 1Z36A 2JCXA 3DYBA 1GJRA 1SKAA 3WNBA 1UQRA 3F5QA 4DV6B 3E35A 1N2XA 5FOQA 1JQDA 2H3HA 2C4NA 2W6ID 1F0KA 3QRWA 4KBFA 2NU9B 4C5AA 5BSRA 5SZJA 1EI9A 4HYTA 4PAQA 1RRCA 4O5AA 2CFCA 2FVYA 1ZUD1 2PD4A 3E2IA 3HCBA 3MOIA 3QLVC 2QTNA 2J3HA 1W96A 4FJ0A 4J0KA 2BKAA 5CVTA 1JG7A 1EFUA 5KOIA 1VZ3A 3CZMA 1RWQA 5CLJA 2VXOA 4DCCA 3L7DA 3B1VA 3W34A 3ZVNA 2UUBB 3P94A 4WY5A 2F3RA 1RJ9B 5E6SA 1S02A 4NV3A 1JTFA 4DRYA 1GCOA 5DGXA 5IXYA 2JZOA 4RNDB 3WHPA 1WCV1 4BO4A 4MPJA 5ALLA 5B1SA 4DRXA 2ZUBA 5DVZA 3J7AC 4L08A 1C1XA 5I7HA 3U0BA 5EE0A 4IMIB 1KAQA 4HLUC 2HWXA 2AFHA 1UMCB 1JKXA 1H94A 4K7JA 4ZEWA 2PBZA 4L07A 4WOJA 4ENPA 4F91B 2OFPA 1A77A 3HCWA 3WWOA 4Y2GA 1C3VA 3PVSA 1J2JA 3WJ1A 1I6WA 2H8KA 4DPLA 3JQQA 3RARA 1QGYA 1NU8A 3F0TA 1QKJA 4FYWA 1NF9A 3NM6B 4AJ4A 4TTVA 2YHSA 1M2KA 1T0IA 2VXBA 2RCNA 3V33A 2ZZKA 1HLFA 5EYPB 3H8SA 1ESDA 1BX1A 4ACAA 3LHSA 5FPQA 2DUUA 5G41A 5FPKA 3R44A 3GJ7A 4R8LA 3PXAA 3GP8A 1LV8A 3WXMA 2X40A 3H2JA 3CKLA 3DC7A 3I01A 5BXYA 1GUZA 2CBZA 1KZ9A 3E61A 3CE9A 2WK1A 3Q3HA 4OB6A 4WNIA 3SQLA 3AHJA 2W2LA 4ZOEA 5JQGB 2IZ6A 2PFGA 3IP1A 2BFWA 1WBBA 5IZ4A 3EZXA 1SXPA 3EQ2A 3EQ9A 3OESA 1IN8A 2ECKA 1JSXA 4IG4A 4U5QA 1Z35A 2W6OA 4IO0A 1TAHA 5EXSA 2H1HA 4AIRA 3QFFA 5CFRA 1AZWA 2HWKA 2IUSA 4D0NA 5IHPA 3HJTA 3CF6R 4XYGA 5ICFA 2GZDA 4Q4JA 3W8FA 1JV2B 4HYEA 1TL7C 5F2KA 1NLUA 3AFNA 4RTOA 2HF7A 3ROQA 1OWNA 2HA3A 4GT1A 2Q5HA 1XAIA 4IGKA 3N86A 1UJMA 1I9CA 1U81A 1M6YA 2IVZA 4OHKA 3BWDD 2P27A 1QQ7A 1WAMA 2HQBA 3HHPA 2WJ3A 1K7SN 1VFNA 4J7UA 4X6LA 4L15A 4YC7A 1YFZA 4LWOA 4ATNA 3FGOA 1XTKA 4TYMA 1AUVA 1IUKA 5KVAA 2I8CA 1I3NA 3LSYA 4XOUA 4BP8A 2JFQA 2OXIA 5BMVB 2VNJA 2ZI5A 3GWGA 1TYCA 3EEBA 4G8BA 2IQIA 4DCSA 4GDMA 1G38A 1FMFA 1N3BA 3WTBA 4AT1A 1JHXA 1YVUA 4YRCA 2LCQA 4BNLA 1CZUA 4H59A 1RDFA 1FP2A 1F38A 3F3KA 2J07A 3D4LA 3JQBC 1GV0A 4O4JA 4G1CA 2QZZA 1CUEA 4QUIA 4UTOA 4L0QA 3LUBA 3QLEA 4NAVA 1QNFA 4ZCPA 1NMZA 4JBWA 1VCMA 1SHTX 2AC7A 1F4LA 1XUOA 2ZIFA 3G6WA 3GJ6A 4RK4A 3FMFA 1Y6ZA 4LXIA 1U3UA 2XCUA 3DVAB 4FGWA 2YVLA 4C04A 4JJ8A 4YRNA 4TKZA 5A4KA 4YJ3A 4QDXA 4B5KA 3MN1A 3QKIA 1QVVA 3OBBA 5CDFA 3HKDA 2Q1YA 3ZWBA 4P5EA 1E1RD 2RONA 4BTLA 2ETXA 3JSAA 1OU4A 3C5WP 3MB8A 3L7CA 2X0FA 1FJGB 1WXEA 1EJ0A 2O1SA 4L73A 1X7WA 3AM5A 1VHLA 2WAXA 4HLDA 4J1SA 4Y0VA 3RVNA 1QFJA 3H6HA 4BNZA 1WEKA 2P6MA 2DXIA 2GJAA 2ZB3A 3FPEA 2F4NA 1BJRE 4WZ6A 4L74A 3ZEAA 4X6UA 2QI9C 3JSXA 3KUDA 3W6PA 2C3YA 4X7PA 1E9RA 3LQRA 5E7IA 1S01A 3NYQA 3D4BA 2H9YA 2HIHA 2F3PA 3F67A 4IOKA 1GTRA 3O3NB 4O2AF 5AKJA 3PKZA 3OCXA 2NG1A 4U8GA 4J1TA 3TGWA 2QU8A 5KVQA 3RKRA 2NV6A 3QSGA 3VJRA 3C1TA 1NBAA 5IJXA 1F2UA 3L8EA 4LWQA 1X38A 5CPFA 5BVHA 1E94E 3MS2A 4C4YA 5F7XA 2L2QA 2Y27A 3IVCA 1D9ZA 3PC2A 4HYYA 4J29A 3WLRA 4MV7A 2FNAA 2HT6A 2FZEA 1P44A 1BVUA 1VXRA 2CC2A 2PKQP 1RRPA 3FVWA 1S2IA 4RPGA 4YO8A 3ECSA 4LAFA 4F84A 4FJ2A 3AIOA 2R84A 4PNZA 3RANA 3ZJTA 5ETJA 1MT3A 4ITRC 4P35A 5KYTA 5J2UF 2WJHA 1ANKA 2CVPA 3A0RB 3U4HA 2WRZA 3CLRC 3HVUA 4DREA 2IEBA 5I9IA 5JATA 2SHKA 3W6UA 1BE8A 2X86A 3A04A 2ISCA 3GA7A 5T57A 3L0CA 4Y1FA 3GARA 4MUYA 5LNK1 5A7GA 1A9XA 3KSAC 3L6RA 1L7DA 3TKYA 1RJWA 3H13A 1LDNA 3GZNA 3FTDA 4FMDB 3TW0A 3G2LA 2YNMA 4D74A 4D98A 4BB9A 1L4KA 1YQUA 1EBBA 3N7UA 2JHFA 2INGX 1N2JA 1QFMA 3J7TA 5KQLA 1GKUB 2BMJA 3KBBA 2BBOA 2FEOA 4X93A 3TMYA 4C5CA 3U40A 1HTBA 1OX4A 3O8QB 4ZREA 3TRFA 3VFDA 3T4UA 1BH2A 1PJQA 2CW5A 5CDTA 5FBWB 2BDUA 3EIFA 1KE2A 5H8WA 1NOKA 4C3UA 5ED4A 4GLJA 1HYBA 1L4UA 1NJ2A 2RBGA 1QP8A 1S9HA 4EJ2A 2A3NA 2XT6A 2BM1A 4L78A 3UUEA 4YHHB 4DHEA 1UEXC 3E7FA 5TEWA 3QW2A 3T1VA 1DTWA 4O5OA 4CMIB 3E3MA 3PJDA 2PQ0A 5FR1A 4LHEA 4FSDA 2LIPA 1C1DB 1MC5A 1WV0A 4YT8A 4CGZA 1Z06A 3QF7A 3B78A 4B6PA 5JROA 3AQ4A 4CQLA 4HGRA 5SV2A 3ZOZA 4KPEC 5EOVA 3NBYC 3PICA 2P79A 1NYQA 3G1WA 1RS0A 1BHQ1 4B3HA 2B8TA 2O14A 2YWEA 5C3MA 1X8KA 2XB4A 3QZUA 1KZYC 1P9WA 4K6OA 4BLUA 4QBFA 2BDTA 5HGJA 2CB0A 4Z4FA 4DDVA 3AGPA 2FQXA 3LUKA 4LXUA 3ES9A 3MWEB 5LQRA 1S2GA 4C2TA 1BSVA 3PDHA 3I9OA 1P0CA 5LIPA 4PLPA 3LUPA 2XKKA 4Q3LA 3RYCA 1KXJA 4MJ7A 2O0KA 1ZEJA 2EQ5A 4N0EA 2WF5A 2EKQA 2UXBB 3B5JA 2NYUA 4WLUA 1EFVA 1GXSA 3HWX1 4F11A 1GL3A 2QRVB 3KR9A 3MTBA 4Q82A 2IYVA 2MMGA 1H1LA 4E4TA 1I5RA 3QIVA 4I5EA 1VRWA 4F1KA 1A3CA 5JWOA 2EL7A 1XEWY 2GD2A 4Y7CA 2JRLA 1O5IA 3O8BA 1CK4A 4YRDA 4NHEA 2E4UA 1YI0A 4LJ8A 2IIBA 1NKVA 1I6LA 3D2LA 4ZI3A 1KP9A 2JFNA 1J56A 3JARA 1L4FA 1E7RA 4JSRA 5CYGA 1GARA 3DBVO 3CEAA 1E79D 3E27A 4MEJA 3I9NA 2HA0A 3AKEA 1COZA 1BA3A 4QJIA 4NKRA 2A9FA 3FUTA 4YT4A 1KHHA 3IESA 5F52A 3WWZA 4W5QA 3LQ1A 1EVEA 3A6HA 4BPBA 2XXBA 4R51A 3MRSA 1DJOA 4AMUA 4PV7A 4KRGA 3SMVA 3UXMA 1N1DA 4WCDA 2G7MC 4S3MA 2HF2A 3H9CA 4UUPA 5A5FA 2ST1A 2Q45A 1XBTA 3K5IA 4ZVVA 1M34B 1GZVA 1ESCA 2IKQA 3D8UA 3HWRA 3QEKA 1C3JA 3STHA 4EYKA 1L0BA 3FPLA 2IS4A 1MC8A 4WGGA 2FY8A 1M6EX 3VC1A 3VAYA 3WRWA 1WHTA 4KH1A 2A7XA 5EZYA 2B7LA 5J4VA 1WCYA 1XRSB 3LHIA 2NV0A 3I62A 1Z37A 2IRWA 4CCAA 2WJIA 1QPGA 1U0LA 3JVUA 1Q0TA 1RJFA 5K3AA 2JLYA 4LDRA 1DWQA 1Z4JA 4UQPA 2GYWA 1XEXA 2JJ1A 4BMPB 4Z7NB 1MTOA 2HNKA 1D8AA 3L6DA 4R1QA 3V1LA 4EGJA 4EB0A 3Q6MA 1OY1A 1QAOA 1KC3A 1Z2EA 2C1ZA 2CKMA 2JFZA 4NFHA 5EP4A 3C3DA 4LJ4A 5BT8A 4JEMA 2PK3A 3VJKA 1M2FA 3OPYB 2H1CA 4PYRA 2RGXA 1L5RA 2BHLA 1BX3A 2I71A 4XSHA 2GN4A 3AVYA 1EWKA 3KFVA 3OZSA 1CQIB 3E4CA 2VK8A 1L4EA 1WLYA 2VF4X 4LZLA 1ZD2P 1XCGB 4UBIA 4ZT7A 3CO5A 2QTMA 2CE7A 4IZHA 4QPDA 2YVAA 4O4HF 3GYBA 3ZD6A 1JDJA 2QNBA 2VYVA 4BO5A 2P3QA 1DDGA 2ZI4A 2HAEA 1P91A 1P1BA 1RWMA 2AKEA 1SD1A 2Y9PB 4E7PA 1G60A 3H11B 3PXBA 3KKKA 1W87A 2OILA 4OH7A 1Y1PA 1J8MF 5AQ1A 1CCWA 3UJ9A 2LUOA 4JEUA 5B1DA 5AKIA 3UJDA 2HBRA 4PNEA 3PL5A 1XVUA 1N3YA 1OGIA 3A8TA 4PO1A 3LTEA 3UFBA 4TQGA 4LE0A 1RRMA 5DM1A 3A4VA 1TMKA 2E5LB 5KOHA 3ZJVA 2FPGB 3DHYA 3IRUA 2A0UA 3PEWA 2ODEA 2D6FA 3K7EA 1FJHA 4OJNA 2Q62A 5FTJA 4M0CA 4XVQA 3UXYA 3ITEA 3F5SA 1SCKA 3Q72A 3S68A 3KDPA 2ONZA 1KI8A 3NIGB 2Z3ZA 2JAUA 3QOXA 2VFAA 4ZRDA 3TOVA 1NURA 4YAKA 1J0DA 1FFXA 1U0SY 1LSJA 1BWPA 1N9KA 4W5HA 4YLYA 1OFUX 2AR0A 4LE1A 1L5MA 2GD0A 5A7FA 3GAMA 2NU8B 3QX9A 4PS0A 2Z9BA 3MM4A 4ZXPA 1H2XA 1ZVMA 5I47A 1DKRA 1UEIA 2PE5A 2EKLA 1C4XA 3R1IA 5G4KA 1JR3A 3GLFB 4F9TA 1W73A 4YDRA 2YMLA 3RU2A 4ZCSA 4ALIA 1LNSA 4M1MA 1LLDA 4XASA 1ZHHA 5H68A 3LZCA 1A96A 2VNSA 3LIIA 1IBLB 2KM1A 1ARZA 4B43A 2SICE 4ZI2A 4KWTA 4YJ2F 1N32B 4WEOA 4D41A 1G2OA 4C3OB 4BAUA 1R0LA 2VK4A 1ENPA 2XQGA 4TMZA 3TQFA 4ERXA 3TLZA 2GZHA 3UJNA 5SICE 3KZXA 3QXSA 4B40A 3ZBUA 4ENSA 5GY7A 2C8KA 2GEJA 4N54A 4A4DA 2JS7A 1XWIA 4EY3A 5F5NA 2X76A 3BCUA 1ZH4A 4JLSA 1T0PA 4TV8B 3ZHUA 2WR8A 1Y8QA 1WB6A 2QTVA 2YVQA 3AYXB 3K35A 4YRSA 1W36D 2A0KA 1TD9A 4D26A 1B3RA 3EGCA 2I62A 1USUA 3BYZA 4W8HA 3JD0A 1C30B 4BX0A 3STYA 1V7ZA 2HEIA 4Y2JA 1SEVA 1JDPA 2CJWB 1CUGA 2IHUA 1AHNA 2XUGA 3LWNA 1EHCA 4W4TA 4HRVA 3H04A 2NUAB 3T12A 4JQYA 3QSYA 3K0EA 5TC4A 4NE9A 5I7UA 5CLHA 3UAOA 1KETA 2D62A 2QPTA 1G1AA 4ADSG 2H00A 3A6JA 4L9RA 1U0NA 4MI1A 2Q9CA 1PO7A 5T4HA 1GHTA 1NJGA 4MPDA 5CNKA 2CV1A 4H7DA 4D1YA 4TV9A 1ZH2A 2V3WA 1FP4A 1BXRA 1F8FA 2HRZA 5CTJA 4YH1A 4BGVA 5FDFA 3LO8A 5LLTA 1TVKB 3IILA 4U2EA 3WO0A 1FFEA 2LZ0A 2P6RA 1MV5A 3N6RA 5BQOA 3K0BA 4D9EA 2J87A 5DHTA 1NG9A 3DXXA 3OMWA 3U3OA 3RQSA 3I23A 3RRFA 4QATA 2ODNA 3H9JA 2C07A 3NWBA 3WRXC 4ZK6A 3C3CA 1Q0ZA 3H4VA 1I33A 3OURA 3P19A 4AO8A 3PF8A 1FS6A 3BFKA 4L3VA 5IWCA 3RF6A 3CLVA 2V1XA 3ZV5A 4E15A 5L4LA 3AEUB 4XRGA 1X3SA 4KNYA 5DXJA 5FL3A 2HCJB 1NATA 3ZHBA 4UHJA 3N2GA 4JI3B 4LI0A 4RABA 1F6WA 1JT2A 3GJTA 2L42A 4FBLA 1BDJA 3VO2A 2NXCA 1MPXA 1GZUA 4OK5A 2VATA 3A3KA 1PR2A 1MRZA 2I4IA 4RL6A 1G8AA 1R0RE 2CZCA 1ODFA 2K87A 1IWOA 1QMGA 1KEEA 4QU0A 1R10A 5DYNA 2R4QA 3P96A 3RADC 2CDAA 2PH7A 4BO9A 5HKLA 2CXOA 4GNRA 4FFMA 3U44A 2X0JA 3MT9A 2G4CA 5LP6C 1SH7A 2NVWA 1WJGA 3L5OA 4K0RA 2XNJA 2C5AA 2V5VA 2HRCA 3RE1A 5B6IA 2LGJA 1DWPA 1C9MA 2IEGA 1DOHA 2GNAA 2JKVA 2VPTA 3JQ9A 3Q3EA 4BO3A 3T1TA 3CB4A 4A23A 4M60A 4MHSA 4BFZA 3U4IA 1Z75A 4Z9AA 1JDSA 1QZZA 4HAIA 4EPYA 3WBJA 4IF4A 1N2GA 4DB2A 3EVZA 3IX7A 2CSXA 3TUIC 3TBHA 3EPLA 2EW8A 2VDMB 2QE7D 4K28A 2VWGA 3HV0A 3P9IA 2Q5IA 5T5QA 1HFWA 1Z4IA 1G8SA 1JHUA 4Q9IA 2PIAA 4RV4A 4UOEA 2FWMX 3KQYA 3KE8A 5K0FA 4AKEA 2OP0A 2X9VA 2TMYA 4KPYA 2CZGA 3VSAA 2REQA 3IP6A 4Y9UA 1BQ4A 1OV4A 1N2CE 3E5HA 4KI0A 3LT2A 3PRYA 1Z7EA 4FYKA 3PNMA 8ABPA 1N5DA 5IYZA 1Y81A 1WD7A 2YWBA 4EB6B 2XHEA 1E32A 2VRCA 1PKXA 2AX4A 2W58A 3NHLA 3TLGA 5JAUA 3IBFA 1P2VA 1I6MA 5CBKA 2APJA 4ED9A 2YXNA 3RNLA 1NC1A 3D02A 3O2SB 4MUKA 3GAAA 2C1EA 2DTDA 3WLQA 1HTTA 3NM4A 4B44A 1Q1GA 2WYOA 4QAQA 1LUAA 4I1VA 4TYQA 3SIXA 4RA6B 4LTNA 4AZ3B 5A03A 5BYKA 2BM9A 2P90A 1N6LA 5KNBH 4UZFA 1T4CB 3RVPA 2FJPA 3BUSA 4R2XA 4DLSA 4E6EA 1RQ7A 1USIA 3MWGA 5CG1A 3AVXA 3JVDA 2BMFA 3IA7A 1DDIA 4QYMA 2V6IA 2RKBA 4JJGA 4EJ6A 5ADWA 5IM4A 1FPMA 2CUKA 4TQUS 1VHQA 4DR4B 1GQ2A 3FTNA 3K6JA 4I9GA 1PU2A 3P71T 2BD0A 4K8OA 3A27A 2CLOB 1TA0A 4NH0A 3ZE9A 3F46A 2JIZD 4TN1A 1N2SA 4QGHA 5L3QA 1QV7A 3R3SA 2BFDB 3R5FA 4REQB 1PL7A 3NRJA 5CD1A 1WB5A 1XMQB 5TMPA 1SIBE 2D2EA 3JR7A 4MHOA 2QR3A 4M1EA 3CPJB 2Z9DA 4TZ6A 3LXMA 3F8SA 4Y6LA 2ZSUA 2PBLA 5EE3A 4KAAA 4EMTA 2PYZA 1TCBA 2HLHA 2ASEA 3HG7A 4XSVA 5BSKA 3K71B 3GLRA 2A59A 1C8KA 3NHAA 2FPIB 1EZ1A 4JXZA 3CM0A 1AN0A 5K4HA 5H3CA 2DF8A 3DZBA 3REGA 1NIPA 1P33A 2QD3A 4BX3A 2BEVB 4UVDA 2WKWA 4F97A 3EXG1 2LBPA 4CTMA 4GBMA 1ECFA 4WKGA 3RT1A 4GX1A 4C4RA 4DB4A 4ZPJA 4ZGGA 2J9RA 2C97A 1OV6A 4IQGA 4Y2SA 1OIXA 5EWMA 4RPCA 5FOSA 3WSVA 4D4JA 2I3DA 2DLCX 3IERA 1HGXA 4HDAA 3ABRB 3R5SA 4GZ6A 4FDAA 1JA1A 3GV0A 4V1CA 4MX8A 1HPLA 2Z2KA 5GV8A 5JLJA 4MGKR 1KJIA 4YCMA 1OKKD 4Y2TA 5AKLA 1UT8A 1HYEA 1T0UA 4LCEA 3MLBA 4BGEA 3HNOA 3M9WA 1B76A 4C22A 2W90A 4BVEA 2ZBDA 4KAFA 2QAJA 3TBFA 4LF8B 2A14A 5HM8A 1IZZA 5GIPE 1CSEE 4WLFA 1C9EA 2P5SA 2H1OA 3T3PB 1H5QA 2JAHA 4P3YA 4FZJA 1JDNA 1FMCA 2XYPA 3T5GA 1PLKA 4KN5A 4DUPA 2TMKA 1GTL1 4HB0A 1JAZA 1OZAA 5HHTA 4ZKDA 4CG1A 3CQ9A 1GSHA 1LSUA 1I4EB 2JJ1D 3BA6A 3GJRA 3T54A 4CV3A 4TTQA 1WUIS 1X8LA 1QH8A 3I4LA 2XE7A 4V2UA 3M3HA 2ZJ4A 3AL2A 3THXA 1ADFA 5JZOA 5LD2C 1JALA 3BAFA 4LXXA 3ICQB 1M9NA 4Z7QB 1A0OA 2G25A 4U7DA 2J3EA 4AXBA 1THZA 1OTYA 2P4HX 2XCOA 2QLLA 3KD3A 4HTFB 3BZWA 3Q6NA 1ESNA 3C8UA 2I9PA 3JR3A 3QEMB 1MQSA 4M49A 3WGGA 4AJEA 2ZE7A 5KSZA 1CEYA 2JGDB 4MRMA 2QL5A 2AZXA 1JILA 2X3UA 3L46A 4GUDA 3V55A 1MXFA 4TLMB 2CHFA 5MFPA 1DBWA 4H1HA 2HGZA 3LBIA 4RIHA 3OQ1A 3V1KA 4RD6A 2QV0A 2YV2A 3P0FA 5BSGA 3K1AB 2YC4C 2GMWA 2X8WA 1R37A 2WYUA 5D85A 2CV2A 4D9BA 1RYZA 1KQNA 3RHFA 1Z0AA 2QG6A 3R5KA 1IL0A 1C7IA 1HMPA 3DLIA 3KPJA 5KYVA 2VQEB 3DL4A 3UT5B 2QN8A 3JQ7B 2R79A 3B3QA 4ZICA 3BREA 3L8FA 1EM6A 1RI4A 2B2CA 2QGNA 1XPJA 4TM7A 1G5HA 1N0WA 1TAGA 5MN4A 3K1TA 4UMDA 1A82A 2JGKA 1NQUA 5T7BA 5CBPA 4P4SB 1H0RA 1WDLA 4KFTA 4Z86A 1ZU5A 5BR8B 3M6UA 5AHKA 1T2NA 1HDIA 2I3AA 1GFIA 3C3YA 3JQFC 3DEYX 3LQ4A 1L8QA 1JKIA 2PBRA 2WF9A 4YPFA 5JD5A 1FXWF 4IHJF 4IIVA 4KIWA 1HR0B 2BSQA 3IGFA 4KMRA 3VSDA 4OHVA 1CR6A 2FPKA 3O1HB 4OHRA 1DUIA 3QY9A 5F4ZA 1EUDB 1C14A 5HZMA 3BN3A 2FKAA 3UGJA 5BRAA 3NYRA 3T1NA 1U04A 1BIFA 4RY0A 4JELA 3GEHA 2Z2YA 4I9NA 4CWAA 4F04A 1P3JA 1YKSA 4JFRA 4UOQA 3RS5A 4R6XA 1B6GA 2QY9A 4JEHA 3NOQA 5EWJA 2UYCA 3EQ7A 2P78A 4FMPA 4OMFG 1I4WA 1WVIA 4DDTA 4R2KA 1RJDA 2DULA 2C54A 1CE8A 1Z6TA 5E3JA 5WRFA 3QXXA 2FZKA 2WAMA 4G24A 1RP1A 3JQFA 3ZDEA 4DWVA 4E4RA 2GHIA 3K5HA 2HXSA 2YJNA 1SVLA 4KE9A 5GWXA 3BL8A 2EBHX 4U00A 3GC6A 2C5EA 1XNGA 3T41A 4BMNA 4KCGA 1G7TA 3LTNC 2VS1A 4LN1A 3W77A 4R5MA 1E5LA 4PPFA 3PJRA 3L0BA 3RR2A 4BX2A 1C7ZA 2HU8A 2Q3FA 3KC2A 4L3OA 1XRRA 2NO0A 4JJIA 3WS7A 5F5XA 3RSHA 2HHLA 2XPCA 3ETDA 4E51A 2R8XA 3A4NA 3C6ZA 3NBMA 3QPDA 4U3JA 5CR9A 2E4YA 4LMBA 4HWGA 5C18A 4J16A 4ND5A 5A9RA 3SBDA 3RS9A 4BVKA 2UZIR 3WADA 3X2EA 1REQB 3IBTA 1OROA 1S3GA 4BLQA 2PX5A 3PFBA 1N9GA 5J59A 3NORA 4MPPA 1BU5A 2IJGX 2OUIA 1G8GA 1MIOB 1RHQA 1Y34E 3FWNA 2ZJ0A 2J6BA 4OQLA 3OPNA 4P98A 1YVDA 4YK7A 3L92A 3F5DA 1C9YA 2QTWB 4E30A 2WVJA 4RMNA 1NM5A 2WBLC 1FTYA 3H2GA 1C0EA 3M83A 3M81A 2W93A 4TYPA 4U4AA 4FOPA 1O0CA 3L7LA 3TOXA 5I4KA 3CGGA 4LG1A 4L6IA 3SVZA 1IM2A 3WZLA 4E3ZA 1U5BA 2IWHA 4N7RA 2A0YA 4W5WA 1M1YE 1TW2A 4GX5A 3P97A 2QMHA 4ZOCA 3VYTB 3RWOA 1ULZA 3A70A 3KLPX 4AZ0B 1DE0A 1T8PA 3WLLA 3A1CA 3D3EA 2LWIA 1I30A 2GHRA 4OBWA 5FORA 2XOKA 3KJZA 2GERA 1YASA 1U7UA 2QUAA 3DR3A 2UU9B 2C3MA 1IZYA 3K5PA 2YY5A 4CU2A 5JNTA 3JVEA 4P36A 1X1SA 1A9OA 1DC4A 3E8XA 3DO6A 4GAEA 3DKKA 3GFRA 4KH0A 1KMHA 3DMDA 4AYWA 5KVCA 1K0UA 3IVGA 4I3FA 2WHEA 3KQNA 3RUFA 1ZBDA 4CF7A 2QE7A 2ZYUX 2DBVO 1B4DA 1D7AA 2WIGA 4G26A 5C34B 5I4IA 1AQ6A 3NKLA 1A8PA 1GPWB 1T35A 4QHTA 5H4HA 3T6KA 1KORA 5HDBB 5CVCA 1HT0A 2VOJA 1PNVA 2V54A 3FXAA 4Y9DA 2YBEA 4BNGA 3HJNA 3JWIA 4NPCA 5E4FA 3UPUA 1O58A 1ZHFA 2GJ8A 4RIEA 2G0NA 4G4SP 2Q9AA 3G2NA 3LVBA 3WL7A 5HXAA 1BHJA 3TLKA 3ZN2A 5C7LO 5JJ5A 3PITA 1P4RA 1BTOA 4YQFA 3ESQA 3EY4A 3D8NA 3IAS6 1DBQA 5FTKA 4LJLA 3FNIA 4P7KA 3ZWVA 2J5QA 4EO9A 1SKYE 1X77A 1EVLA 1VE5A 1PN3A 4LTMA 4JJ4A 1PWYE 4RM3A 1N4DA 3ITKA 1Q74A 5BVHB 5HQJA 1RRFA 1FTGA 2P2NA 5JMWA 3PCTA 1AKUA 3U5ZB 1YZHA 3G1TA 3A6GA 3AEKA 4NQRA 4O0MA 4NZYA 3V4ZA 2W2VA 1P72A 3KDAA 4R2JA 5KU7A 4YFYA 3MTGA 1NZDA 1ORDA 2MJLA 3L2OB 4KR9A 1OB2A 1D1PA 1EK0A 3V8BA 3ULKA 3GT4A 1RQNA 1G21B 2GM3A 1KFBB 3O83A 4DBVO 3FFAA 3EGIA 1E1QA 1UK7A 2BI4A 2GYYA 3CLSD 5ADHA 1C7QA 2ODAA 1D04A 4TMYA 1PJBA 2AFIE 3U4CA 2Q99A 5EG5A 4QASA 4CKWB 2DWQA 4DA0A 3ZBPA 4F6CA 1DOZA 3DEJA 1J9ZA 2X4LA 3OQBA 1J2YA 1NUAA 3LX5A 1UWCA 5CFLA 3U4QB 4RAOA 4B82A 3RF7A 3TVTA 1W94A 2MWMA 2WILA 2IODA 2NTVA 2HRQA 2VO1A 4JYPA 4KUGA 4XARA 2RC5A 2VBIA 2YQ4A 4G37A 2C3OA 1FJXA 4UQOA 3WIVA 5FPSA 1TJ5A 3ZXSA 4ZCTA 5B4VA 3CWZA 3H2HA 1CR4A 2YZMA 4E21A 1TJ3A 4PC2A 2RHLA 1K5PA 1GA4A 1EJBA 2LV8A 1NBMD 3DDWA 3FD8A 3MSCA 2XITA 3QOWA 4MW0A 1B00A 3S70A 4FCVA 5IJZA 4NOJA 1XPOA 1YF3A 2VHTA 1VMDA 2WM9B 4FN5A 2ZBVA 4HR7A 1A1VA 1JQ5A 2E37A 2VPZA 5HQ3B 4U2CA 2F48A 2HUPA 1YQXA 4NYIR 5DGCA 1J1UA 2QENA 5B7QA 4Q1CA 2A33A 2PHZA