2XTNA

Crystal structure of gtp-bound human gimap2, amino acid residues 1- 234
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
208
Chain Sequence
SELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE IMAP FAMILY MEMBER 2
publication title Structural Basis of Oligomerization in Septin-Like Gtpase of Immunity-Associated Protein 2 (Gimap2)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 208
sequence length 210
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtnA00
3K0AB 5IK2D 2H1LA 3B82A 1KK1A 1X3SA 2QMHA 1ZYUA 1Z07A 1GAJA 4ON9A 3RHFA 3THWA 4EPXA 3GQBA 1NLFA 2OLJA 3OZXA 2ANBA 4V02A 1BH2A 1FZQA 2GA8A 3BFVA 5C46F 2RKOA 3X1YA 5HR5A 2JJ8A 4NYMR 2RGNA 3A1SA 2GILA 4BECA 4TMTA 2EFHB 2GEVA 2WPDD 4EAQA 2EYQA 3KDSE 4NCNA 2D06A 4XTRA 5C2JB 1FUUA 2JEOA 2PMDA 3AVXA 3L0IB 1W0JD 4EQ6B 2IHYA 1XJQA 2PX3A 3BK7A 4A2WA 5L3SB 4OJKA 3E1SA 3ZVRA 4DLUA 4NZYA 1VYVA 1N5KA 3W34A 3EA0A 3CNLA 4YDHB 4FXPA 1QHSA 1XTSA 2ZRHA 4Q1EA 1EFUA 2VSOA 1KY2A 1CKEA 3MLEA 4RKEA 1KI6B 5ANRB 3ONWA 2ZAMA 2FDCA 3P4XA 1V5WA 4K8OA 2EFGA 3QKRB 3U3MA 4C4PA 1UKYA 2REOA 3MJRA 5EXXA 3FYHA 3GPLA 4PZLA 4GFDA 2O8EA 3ZLJA 3GLHA 4XSHA 5JJKA 2VSXA 3QF7A 2R6FA 2FJUA 1SKYB 2FWRA 4TSFA 2ZE6A 3GLIA 2W2XA 3RYTC 4LJ4A 4EKDA 4M1WA 1M34E 3CX6A 2ORVA 3B1WA 3CH5A 2NZ8A 5CK5A 3TSOA 4M1YA 3GFTA 1D9XA 1ONBA 3PVSA 2ZRFA 1Q1EA 2GCNA 4URYR 4Q1CA 1PJRA 1G6OA 5SZKB 2ZS7A 3G5UA 4S35A 1M74A 1GNRA 5GVSA 4R98A 1VYTA 3QY0A 4BGDA 1SXJE 1EFHA 5HCIA 3ZH9B 4A36A 2ODNA 1E98A 3THXB 5KU1A 4G5GA 3Q5DA 2V6JA 1NVVR 2ZAOA 4B6EA 2HT6A 1CTQA 4GBMA 1EGAA 3RRNA 1Q21A 4GZMA 3U6BA 1KGDA 2Z43A 4P33A 1R0WA 4LHWA 2O0JA 1HQYE 1VTKA 4CYMA 1AIPA 1Z08A 1GL9B 1NN3A 2C9YA 3L8YA 1EFTA 5HTKA 1RRFA 2C04A 4LYAA 4RCYA 2RHDA 4IEIA 1UFQA 2XOKA 1W36D 2ZE7A 3B1XA 4LV5B 4X8MA 3L0PA 3KJHA 4LYHA 4JS0A 4WBSA 3CH4B 3FGNA 1W4BA 4RD0A 2Q9AA 3KQKA 3C7KA 1G19A 1FTSA 1NMXA 1NJGA 2MSEB 5JBQA 3KJIA 2YWGA 2C95A 2FPMA 3UG6A 4UXIA 4AYWA 2WKQA 4GT1A 1KZGB 1MOZA 2A7QA 3FB4A 4QGFA 4WXRA 1E2EA 1U8ZA 2CVHA 4TL8A 5AJVB 4XJXA 2Q3FA 3B13B 4RFSB 2G9NA 3BOSA 1I4LD 5M04A 5C4GB 5E7IA 2F7SA 3QXJA 1Z0FA 1SXJC 4XTCS 4NYIQ 3KZ1E 4POAA 4LHZA 4A82A 4MRPA 1XTQA 4ZI3A 1OIXA 3SE0A 1Z6AA 2G88A 3SFVA 1NIJA 3RS4A 3KKOA 2ZTSA 5J4VA 3E5HA 4BLPA 4D25A 4J0QA 1P62B 3HR7A 5IF9A 2YC4C 5EXSA 1O87A 4CT4B 1VKJA 3R7WB 2NO6A 3TUZC 1W36C 4EJSC 5K8UA 2WVJA 3WRXC 821PA 1Z83A 4PQRA 3ZZ0A 5J4LA 2AFHE 2PJZA 1TU3A 2FGJA 1KKMA 1SVLA 3FKSD 4DXAA 3T5DA 1N5LA 3AB3A 2ERYA 3ND9A 3NDBB 3HWSA 4IXMA 4IVPA 1X8LA 2BKUA 2ZS8A 2LKCA 2AK3A 2FSHA 2XB4A 2HDNB 2ZJOA 2ZSFA 1XNJA 3ETLA 2E1RA 5JFGA 2AN9A 4G01B 4QM6A 4BFWA 1E2QA 1ZIOA 4Q9LA 4MDEA 1VHTA 2GBLA 2O0KA 3BH0A 1N5JA 2W0MA 2B21A 4UNPA 4QKQA 5HKKD 2QL6A 3LXXA 4PX9A 4ACAA 2YYZA 4QJ3A 2NGRA 1KI6A 4X8OA 3U3OA 3WBJA 5F98A 1IBRA 2VIIA 4KBFA 4BFTA 2Q6TA 1BKDR 1II0A 3OFND 4QNRA 1KMQA 2VRWA 4B2IA 5JEEA 2BC9A 2J0VA 2WWXA 3CR8A 1G41A 3GD7A 2BMDA 2VHUA 1ZP6A 3WNBA 4MGIR 1F2UB 3BBPA 4MYUA 1Z0IA 2X8AA 4HDQB 4LI0A 4BASA 2HYDA 2W2TA 2PCLA 4MRVA 1IONA 1Z6TA 4C0LA 1COWA 4ABYA 2V1UA 4DDWA 1XCPA 4YMUA 2H18A 3CF0A 1IN8A 1IQPA 4UKDA 1ZCAA 1ZM3A 4E22A 2PBRA 3ZIAD 5EZ6B 5GJVC 1X1RA 2R2AA 1CULC 3B6EA 4FW9A 4K81B 1E2HA 1EFCA 1MO5A 1N5IA 3IO5A 5FTKA 5KDLA 5KSZA 3PEWA 3U44B 2JA1A 2J46A 3DEFA 4BRWA 4LUCA 4B34A 3RWMB 1UF9A 5JI3E 3K53A 2NO1A 2YOFA 3RS5A 4B76A 2BMEA 3OIYA 2IS2A 2EWVA 1MO4A 3CM0A 5J47A 1TUIA 1SGWA 1IY2A 2ZRIA 3I72A 2A2ZA 4WZ6A 5IDVA 1P2TA 3UMRA 1FX0B 1JBKA 1GNQA 2HXYA 4UXJA 5CLLA 2A5DA 1HUQA 1S9DA 2HJVA 2AKYA 4TYNA 1LB1B 4IVQA 4NH0A 1EWRA 4TTQA 1AGRA 2WZQA 1GWNA 2P65A 3LY5A 5L3RA 4OQFA 4FCVA 3GLGE 4XSGA 1G3UA 1DS6A 3T5GA 5FUWA 1JR6A 3WHLA 1Q20A 3KKMA 3BIFA 1DPFA 1II9A 3WY9A 4L15A 4PFSA 3SJBA 1U8YA 5C4MA 4MDFA 3PJRA 2BOVA 5FTMA 5JHHB 2F55A 2ZS9A 3I5YA 1SVKA 1AM4D 2GNOA 4B3CA 2BIFA 3E70C 2IYXA 4DKXA 3ZD6A 2VP6A 2WOOA 1WMSA 3QKSB 1GKYA 4IEEA 5HE9A 2KBFA 3RRZA 2P67A 1SXJD 2ZEJA 1D6JA 3RRYA 4XWKA 2P5TB 1W2GA 4CEHA 1OFHA 5G53C 3QG5A 4MKFA 2EFEB 4XOIA 3MD0A 1I4TD 2I1VB 1E3MA 2VBCA 4BFUA 1VG1A 1G17A 5FPYA 3THWB 2GHIA 1ZM9A 2ZRGA 2A5GA 1HE1C 1DELA 1XWIA 1L2TA 5JEDA 4CEHB 4BLSA 1QG4A 1BS1A 3AF2A 3P20A 3TBKA 5IT5A 1YZKA 1F2TB 3VTKA 2OXCA 1E9DA 1OH6A 5DHFA 4W5WA 1OH8A 3KJGA 5H70A 2O8CA 1JXMA 1YZUA 3IPYA 4IOKA 1P73A 2GJ9A 5JSZB 1KYIA 3EPLA 1YZNA 4HUTA 2F43A 4OJQA 1MRSA 3ADBA 4OK3A 1OIWA 1KHTA 2VP5A 1KDTA 2QAGA 3CX7A 5FI0B 2O8CB 5CYOA 2ZUCA 3PUYA 1OB2A 4Q5IA 3ZGXA 3K8YA 3MMPA 3HJNA 1ZAKA 2XSZA 4I1VA 4TTRA 4Q19A 1NBMA 1IN6A 5A4JA 4ZKEA 2OM2A 1NMYA 1TQ4A 3RVBA 1OH5A 5G3YA 4B71A 4TQAA 2QSYA 2XNDD 5AJWA 5CIWA 1DE0A 4DWJA 2QORA 1LS1A 3GCGA 4LBVA 4PPFA 2JIZA 3GMTA 1Q57A 4Z1MD 4YONB 2OBLA 2PCJA 2OCPA 2BMFA 4NTZA 5E3HA 5FBVB 4NU0A 1G1MA 5EE1A 2ODWA 4TMKA 2FFBA 2C96A 4KJZA 2G83A 2OEPA 3W9YA 4U7DA 2IUUA 3O47A 4B3GA 4TQUS 1CS4C 1MR3F 5FPKA 2ZJ5A 2OE2A 4RJLA 2YINC 621PA 2V6IA 3H1TA 1XZQA 3R20A 5KUTA 1DAMA 2J7PA 5AUOB 1P9NA 4QBGB 5FR2A 1E4YA 1F48A 4PHFA 4KFTA 4NCIA 1E1QA 2N42A 3VHLB 2ZRCA 2R6DA 1U8AA 2WMOB 3C14C 5KYKA 3DDCA 4N3NA 4Q4AB 1RYFA 2YKGA 3EG5A 1P72A 4OI1A 4CEIA 3QIAA 2JCSA 3O8DA 4KSCA 5DNYB 3A1TA 1GKUB 1MKYA 2F1RA 2XNSA 3OESA 4KHZA 1XPRA 3LXRA 4CEJB 5KDDA 5DHAA 1CR1A 2B8TA 2QP4A 3MUFA 4BZXA 4M0LA 1E0SA 4G5QA 5TY0A 3PIRA 2YOGA 3K0SA 4B75A 3UMSA 5G40A 3FOZA 3GJ4A 1IHUA 1HYQA 1T5LA 3BAFA 1YRBA 2RGBA 3KX2A 4TYWA 4GOXA 4Q9IA 2R44A 3VR1A 4RCZA 3N5CA 4M2LA 1PLKA 2QT0A 4AY2A 3O8RA 2JASA 4DBLC 1T91A 2D7CA 1VMAA 3LDAA 2JAQA 3ASYA 1ESMA 3BC1A 4Q47A 1G3IA 1UEIA 4NPHA 2D2EA 3BFXA 4QNMA 2PJRA 1EX7A 2GXAA 4DLTA 1R5BA 4B2PA 1E79A 3A37A 1W47A 3KTAB 2QAGC 1Q1BA 4ACBA 1XXHE 3Q7PA 1G6HA 2YWFA 3T1OA 4KI0A 3LO5A 4LSGA 4KYIB 2ZRPA 1FNNA 1IN4A 1GITA 4OHVA 1W0KD 2G77B 1AGPA 4HAUA 3ZQ6A 5TDHA 3KL4A 1IN5A 2IT1A 1IM2A 2BM0A 1E69A 1ZIPA 1Z2CA 2WICA 2KJQA 1JPNA 1KO8A 1NBME 2FFQA 2LCFA 2Q9CA 3CWQA 3D31A 4HATA 1FOEB 2ZRBA 2ZYWX 5JI2E 4C7OB 3FHTA 2OBMA 4CDGA 1JR3E 3BB4A 3A58B 2CCKA 2HEIA 3T61A 4ZI2A 3U4QB 3OFNA 2IEZA 4LPSA 1NN0A 5KNDA 1II8A 4BLTA 4F91B 5EQTA 4KSBA 2ZSAA 3WMEA 2RGNC 1P75A 2ZSDA 2EWWA 1T4GA 3FPAA 1Q3TA 4OHXA 2IXEA 5JSZA 4AYTA 2BJVA 4NYJR 4EPTA 3QXCA 3CRMA 2ZI9A 1G8YA 4OQXA 1LW7A 2VO1A 2D74A 4QHSA 2CEAA 4TWZA 5LD2C 3CR7A 3WP0A 4DEYA 1GUAA 4P3YA 1UBGA 5HZKA 2ZXUA 5FBWB 4XWOA 1O3YA 4B2LA 4TLEA 3GLHE 3DMDA 4PAQA 1E2JA 1AJEA 3HU3A 4NONA 2ZUDA 5EP2A 4TLBA 2BBSA 1OH7A 1Z0DA 3ZZTA 2WKRA 2ZRNA 2IYWA 3GJ8A 4KU4A 5CK4A 4BFVA 1YVDA 4JKIA 3I73A 1QHXA 4JIMA 3CBQA 1TUEA 4HLUC 1WCV1 4Q7LA 4EIWA 3R9IA 3AF0A 1IJFA 2KI5A 1D2MA 1GILA 1N25A 2XTMA 2G3YA 4WZBE 3LX8A 1WF3A 3L0SA 4RD6A 1FUKA 3QF4B 4RZUA 1NG9A 1NN5A 3B9PA 1MH1A 3VR5A 2XZPA 3ASZA 4IFBA 3RS7A 1TF5A 1JJVA 3CZPA 4F4JA 1VIYA 2WKPA 3GEHA 3B78A 3MWLA 1M7GA 2O8FB 5FL3A 2VF7A 4D4MA 3LBHA 4IDHA 1MRNA 2H5EA 3QUSA 4JKYA 2K5UA 3VR6A 4ITRC 5G41A 3O8CA 2DWPA 1V43A 4Q4AA 4FMCB 2CBZA 1OFIA 4JJKA 4MRSA 4A15A 2XITA 4UNRA 1HE8B 4G5OA 3EARA 5F3WB 2BEJA 1UKEA 1N3BA 3FMIA 1G5RA 3GJXC 5JZVA 1E1RA 4V0MA 4IDQA 4LJ6A 4EPRA 3VX3A 2NPIA 1M2OB 3PV0A 2GCOB 3PEVA 1NSFA 3ZZUA 3UATA 4KFRA 2FFHA 2FSFA 3WMGA 3OE7A 4OHZA 4TL7A 4P4TA 5TXGA 2VQSA 2PL3A 3P1JA 4M9SA 4R71A 3PQCA 1MO3A 2F6RA 4QBHA 3KTAA 3EPKA 2KSQA 1IXSB 2WPDA 3OAAD 4LHYA 2CXXA 5JWHA 1G8FA 1RYHA 1VCMA 5DI3B 2WWHA 4BFZA 5BN3A 2Q3MA 4M1MA 3UPUA 3TJZA 1E9RA 2HCBA 1VCNA 2GBLC 2GVDC 2Q3HA 1QF9A 2QEQA 3BGWA 3SDZA 2DFTA 2IXGA 5LD2B 4C7OA 2ZRLA 4UQOA 2CCJA 4Q7MB 3OHMA 1KDOA 2DHRA 1KK2A 4O25A 3OEHA 5KNCA 5DI3A 2C77A 4CT5A 3KUCA 3AUYA 2C9OA 4R7ZA 4TL9A 2IYUA 4PAMA 5CLQA 3I5XA 1XPOA 5FTJA 4Q4JB 3NH6A 1HURA 4C0QC 1E0JA 1S2MA 3MWYW 4NCJA 3QKTA 2RAPA 1G9XA 2WWWA 3BD9A 1XD9A 4IFEA 5TARA 4FINA 4BZQA 4F4IA 1E2KA 4UJ5A 5EP1A 4GOJA 4QHTA 1QRAA 1SVIA 1ZNZA 2J7PD 3B60A 4HZUA 5B64A 1GVNB 5J4HA 4LGMA 3THOA 1X8JA 3CUEF 2I3BA 2HYIC 1MO6A 3GJ0A 3IQXA 1D8TA 5F2EA 3VAAA 1F3OA 1M6NA 1U81A 4QJ4A 2IUSA 3PR1A 4ESHA 1UBCA 2F43B 4HB0A 4KFUA 3OEEA 4US0R 5K8TA 1R0ZA 1Z06A 3L8ZA 1II8B 3X1DA 4KVGA 3SJZA 1A82A 3KQLA 1OB5A 2QM8A 3AVYA 4LYFA 4DB2A 4BZPA 2WJIA 2QAGB 1G7SA 1YHNA 3V9PA 2VL7A 4FMDF 2VHQA 5EE0A 4DSTA 5FL7A 3ZS8A 2YZ2A 3EC1A 2BCJQ 2V4ZA 2CHQA 2ZRMA 4LJAA 2QAJA 4MYHA 1RZ3A 4CGZA 3BH7A 1NJFA 1XX6A 2GVZC 1Y63A 3LNCA 2AK2A 2DR3A 4OQMA 4DLWA 1IJEA 4EPYA 3SHFA 2J1LA 1QHYA 2H16A 3NBXX 2QMOA 3K9HA 1N6OA 2D7DA 2XGJA 1HH4A 1YZLA 1C4OA 2F9LA 3LLMA 3ADCA 3A4LA 3C8UA 3FDIA 1ESNA 4QBFA 1CJVC 3MJHA 1US8A 3UWOA 1RPZA 2Q21A 2H7VA 4JLVA 3VFDA 2KBEA 1E9FA 1N6RA 1TX4B 2QPTA 2YVUA 3TW8B 4JLKA 1N6LA 2WTUA 2XTZA 4PTLA 2EU8A 4AG6A 1KI3A 1YRAA 5C18A 3KFVA 4PO8A 1US8B 5B2ZA 1RE0A 2VHTA 4ZPXA 2W6JA 1E1QD 4M1TA 1E9BA 2RCNA 4DC9A 2GDJA 3PG5A 4BFSA 3IUYA 5C1BA 2V7QA 1M8PA 5D3QA 2FFAA 5JJIA 1OPXA 2GF0A 2W6IA 5BN4A 4I99A 3ZVLA 4CEIB 1IY1A 3EASA 4US1R 1E9AA 4LV6A 5JHGB 3ICEA 1D2EA 3CF6R 1ZU4A 1SVWA 2Z6VA 4ILEA 3TRFA 1SVMA 3WMFA 2VSFA 2R65A 1KO1A 2GWHA 3HU2A 3EA5A 5BW8A 3IEVA 5GJWC 2C98A 2Z83A 3CPHA 4TLDA 5SZHB 3ZDQA 4YQFA 3NEYA 2RGCA 2GK7A 2IW3A 1YZGA 3I1FA 3K09A 1LF5A 2QGZA 3FKQA 4HB4A 5LB4A 3VR2A 1G64A 1TU4A 1DOAA 2O52A 2VEDA 4N1AA 2QBYB 3IBGA 4D26A 1AKEA 3FWYA 4Y0AA 2LWIA 1U9IC 1G18A 1A2KC 2OFXA 1CR0A 3ZVMA 1XPUA 5DO9A 1P2SA 4OI0A 3DZ8A 4AI6A 1ZM4A 3AVQA 3ZYCA 2OILA 5ELXA 3HU1A 5FUVA 3UKDA 4XVUA 4PO9A 1RFLA 2IXFA 4PQYA 4TQ9A 1UKVY 3Q3JB 3KB1A 4MUBA 3Q85A 1OXXK 1LVGA 2H92A 1HQCA 4I1SA 4HZUB 5JS7A 3GLFA 4PC2A 4YMVA 3H0KA 4ZIRB 1KI1A 4O2RA 1NVVQ 5H8WA 2D62A 3AQ4A 2QRZA 4IDPA 2WAYA 1KNQA 1TPZA 2D3WA 2QTFA 1P5ZB 4HUQA 5EZ5A 1DBSA 1JPJA 1S3GA 2B92A 2D2FA 3TQCA 1CJUC 1N0UA 1T0JB 2WJJA 3DPUA 1NKTA 2REBA 3BXZA 3Q9LA 4U02A 4LBWA 4KYUA 4HAVA 5JRZA 2XXAA 4M1OA 4HYYA 1TF7A 5BWMA 1EWQA 1VDZA 2Q9BA 4M4SA 3C15C 1UJ2A 3W5JA 1XFAA 2PLFA 4AG5A 2B7CA 1OKKA 4A8JB 4A6PA 2L0XA 1H65A 4RZ3A 3SNHA 4AKEA 1QBKC 4TL6A 2FPLA 1QVAA 2LKDA 3S1AB 1JECA 5FI1B 1ZMXA 3VNUA 3V00A 3REFA 4GDFA 2I4IA 2PZGA 1LTQA 3SBDA 2Z5FA 2IS1A 2FA9A 5J40A 2JLUA 2R8RA 1DAIA 3FFAA 3QEOA 4BE7B 4ARZB 1I2DA 4C0KA 2CK3D 4BFYA 3CKLA 5BN5A 3EIEA 4LJYA 1KK0A 3RANA 3S1AA 1E94E 1P2UA 4PSAA 1OJLA 4IKEA 3IQWA 3K9GA 4HAYA 3RS2A 2NO7A 5CM9C 4LZZA 3OF5A 3WRYC 2ZRDA 4ZCIA 2FV8A 2Q0HA 4RZXA 1JR3A 3BB1A 4OYHA 1EXMA 4F4CA 2IL1A 4GNKA 2EFCB 1GRNA 2W2VA 2IC5A 4Y0VA 4JSTA 1U2RA 1C9KA 1SZPA 2W6ID 1QHHB 1NP6A 3AGQA 1Z63A 1K6MA 3K9NA 3PUXA 1WXQA 1G4AE 4I4LA 3QKRA 1NY6A 2DFNA 4OL0A 3A6PC 2J0UB 4ASUD 1I2MA 3IGFA 4JLAA 2IYVA 4DCNA 3K0FA 2QRNA 1CRQA 2GAOA 1ETUA 2ODBA 3LQQA 4PPGA 2FH5B 2P6UA 1YKSA 2DFLA 2HXSA 1NMZA 2B8WA 2QE7A 1A2BA 4JLOA 4TZ0A 1WA5A 1XEFA 4GPTA 2IYYA 2WIBA 4DT1B 1DAGA 4DSOA 421PA 1P60A 1Z8FA 1KIMA 5EXPA 3U3JA 2RGXA 4PQFA 4BUJA 3ICQB 4DUGA 3RDPA 1KO5A 1GSIA 4HDCA 4Q4HB 1EFRA 4BRUA 5IHPA 2IS4A 1K5DA 1GP2A 4JYBA 4B3FX 4GZLA 3W5IA 1G3MA 1VCOA 5FPTA 4HI0E 1XCGB 4GMDA 1RRCA 1OLOA 4JBWA 1R8QA 3P32A 3SBEA 2MSCB 3QQ5A 1DARA 4PZZA 1Z29A 4M53A 4Z51A 3AVOA 3QBVA 1JB1A 2PT5A 1UBEA 1DG3A 1D9ZA 1KI2A 1F6BA 4IOJA 3W8RA 4YXWD 4DIEA 4C2UA 3T15A 2N1BA 4Q48A 3IPXA 3K1JA 1R8SA 3L0OA 2OLKA 1KK3A 3AGPA 4AD8A 3RC3A 4UJ3A 1A4RA 5FL7D 4BLQA 4OHWA 3B9QA 4PANA 4IOLA 1Z0JA 3EWAA 121PA 3H4MA 3HPRA 1TNDA 2D4HA 1BIFA 1RRPA 3MG9A 4OHYA 3LH5A 4B74A 1XEWX 2OG2A 3Q8XB 4CRWB 3FE2A 4FIDA 3DMNA 1I4DD 2ONKA 1UDXA 3QXXA 3AKCA 1AZTA 5KSPA 2O8DB 4LWZA 5CDFA 3U60B 3RSLA 1CF4A 3R9WA 2B6HA 2JLWA 2QN6A 3CRW1 2J59A 1VG0B 2XSZD 3GFPA 2YJTD 4QRHA 4QL3A 2F3TA 2EVWX 2V1XA 3EXAA 2OFWA 1JQLB 5DN6A 2PH1A 4IVRA 3EPJA 1Q44A 2RHMA 3C4JA 5FUXA 3PUVA 4RFVA 4ZDIA 4NCHA 1P4SA 2G0NA 1RC8A 3GEIA 2ZU0C 4YXWA 3TR5A 3AM1A 3N70A 2C99A 4FCTA 2GEDA 1P3JA 1SVOA 1ZW6A 1JR3D 3CPJB 4XIGS 1XEXA 2ANCA 4A92A 3MRSA 4KODA 3CNOA 1G8PA 2QMUA 3TLXA 3ZVNA 1NBMD 1R6BX 4W5JA 3I62A 3TAUA 3AVTA 2A78A 2OCBA 1E6CA 3SJCA 1UPTA 2ZE5A 1G7RA 1KI7A 1CR4A 1NIPA 1R5NA 2FMXA 1A7JA 4LC0A 5F9FA 4URWR 1QHHA 4P4UA 2WJHA 3WNCA 1N0VC 2FZLA 2ZPTX 3CLVA 4I1UA 5SZJA 1NL3A 4UNNA 1PUJA 3C41J 3CRRA 2A5FA 4AKHA 4BFXA 2GJSA 4G3XA 3W6NA 3GEEA 2ERXA 5AR1A 5E95A 2R6CA 1Z28A 5J4YA 2X2EA 3TKLA 3NIBA 1GRQA 3H2YA 4QFMA 4M22A 1KI8A 1JEEA 3NHAA 4WA7A 3MFYA 3TE6A 3VHXA 3T34A 4MGKR 3CF2A 3I92A 2GZHA 5AJYA 1VECA 3AKDA 1KAOA 4D4JA 5D3MA 4M8NE 1XMVA 4NMMA 5KTYA 4JVSB 2VP4A 3NBYC 3SYLA 4D6PA 1HT2E 2HV8A 4P4SB 1JXOA 4IRUB 2O0HA 1OYYA 3VX4A 3G82C 1JAHA 2FSGA 4B43A 5FUYA 5CJ2A 2OO7A 3M0EA 2UKDA 3K0FB 4V0KA 2R6AA 2JLYA 2IYZA 2P2LA 2VHCA 1F2UA 2P3SA 2AFIE 2J45A 2TMKA 3WXMA 2V8OA 5JCPA 2O8BA 3DO6A 5FPHA 4MGYR 1YR7A 4EFNA 3R9XA 2XAUA 4F38A 1E2DA 3M1IA 2HF8A 2QNRA 3W8NA 2ZSBA 3U3RA 3VNVA 2IBMA 2BJWA 2ZJBA 1XTRA 3AEZA 4Q7KA 1WP9A 2GK6A 4E07A 4WVFA 5HPYB 4D82A 5EP3A 1FPMA 1Z0AA 1E0KA 1VHLA 1R10A 1TF2A 4LBZA 2WWFA 1CJKC 2QROA 3JVUA 2GZAA 4Z8XA 1FQKA 4JSYA 1FL9A 2EYUA 1GG2A 2RGAA 3IIKA 3K70B 3PENA 2A9KA 5SZIA 4Z54A 2VF8A 3OIUA 2DY1A 4RKFA 1T8UA 1TEVA 4B35A 1XMJA 3VKHA 5A5GA 2MSDB 4OKSA 1OYWA 1VG8A 2V55B 2ZQ5A 3SOPA 3ADKA 2RH5A 2C78A 4PC1A 4WXPA 5KSOA 2AL7A 2WSSD 3HP1A 3AF4A 2NPFA 4B3XA 4G1UC 4LJ5A 1WQ1R 2JATA 2G6BA 3DKVA 4GI7A 1KMHB 2OCYC 1W0JA 2GXSA 2IF2A 2QU8A 3WBKA 4D81A 1F60A 1AS3A 3AVPA 3U7GA 4L4UA 4U00A 1XEXB 1KOFA 1OXTA 3EIQA 2F1JA 2WWIA 4FMBB 3QSYA 1FX0A 2A30A 2VTKA 3SR0A 5DSZA 2HCJB 4DB4A 1H8HA 1NF3A 4JVNA 1UKZA 4QXAA 3CZQA 1E79D 3RABA 5TV2A 2CVFA 4PHGA 3SFZA 3N2EA 1LS6A 2VP2A 5IRCD 1LFDB 3DM9B 4YC7A 5KPDA 2ASEA 1TQ6A 2W6JD 5J5CA 2Z4SA 4DEXA 1PV4A 2G1JA 1SQ5A 4II7A 4A8JA 1H8EA 2IWRA 1OFTA 4XVQA 4LYJA 1XU4A 5CITA 3C5CA 4C9BA 1RJ9A 3RC8A 5TMPA 3IHLA 1W4AA 3AKYA 4EJSA 4M9QA 3FHOA 5E7MA 4TZ6A 4DUGD 4A2QA 2RGDA 3U2QA 2JJ2D 4X8HA 2WOJA 2WSMA 2E9SA 3DOEA 5BYJA 1VYUA 4ZV4A 2WJYA 4ARZA 2CE2X 4C0BA 2RB4A 4JT2A 2Y8EA 3OAAA 3SYKA 4FWIB 4YLGA 2GEUA 2FZ4A 2DCUA 2ZETA 4EFLA 2CHVA 4KXFB 4A8JC 4CIDA 1ZCBA 4DLZA 3J81k 1WBDA 2RGEA 2P6RA 3ECCA 3WP1B 1YR6A 4M9ZA 1Z5ZA 1ZD9A 2V3CC 2O8EB 2G1KA 4LY6A 1T0HB 3EZ9A 3L43A 5EE3A 4B3BA 1E1RD 2X1VA 2AD1A 2ZVPX 2VYFA 4WOPA 1H8HD 2X77A 5B30A 1G8GA 3F8TA 4LPKA 5LBIA 3TVDA 1OE0A 2C03A 1Z3IX 2FF7A 4UNSA 1W5SA 2PX0A 3MWKA 1BOFA 2DWQA 3G0HA 1CEEA 4MKGA 2QTVB 4WW0A 3I3SR 1H8ED 3KXLA 4B32A 4MKIA 1W5TA 4RSGA 1XMIA 1AS0A 1XCMA 3EX7C 4OI2A 2P0EA 4PR0A 4DCVA 1G3RA 1EG7A 1Z22A 3LX5A 1Z47A 3QOFA 1ZVQA 4UXHA 3MAAC 4BLRA 4XH9B 1ZM2A 5CIQA 3A4MA 3T1QA 1R0YA 4C30A 2EFDB 3K0CA 3EZ7A 3M6AA 4Q9HA 1NLYA 1CXZA 2WWGA 4AURA 2DYKA 5H68A 2O8BB 4MQBA 2ZVQX 2PZEA 2QQ0A 4W5HA 2XNDA 3FHCB 4TYYA 2QP9X 1E9EA 1TL7C 3OEHD 2ZRKA 1T3SA 3KUDA 4NYIR 3TK1A 4TT3A 1TAGA 4Q18A 5GVRA 3RRMA 4EPVA 5AUNB 3THYA 4IOMA 4JLMA 4BLOA 4AKGA 1UDWA 4P31A 5FOSA 3TSZA 3QEJA 3ZS9A 4TN1A 3A36A 4TYPA 1NKSA 2OUKA 3QPVA 2J0SA 2VA8A 3WYAA 3KKPA 3V4RA 4DRZA 5EXTA 3P4YA 2BV3A 5FOWA 5B58C 1ODFA 4JLBA 5EE5B 2OAP1 1U0LA 1CBUA 4DCSA 1GKIA 4EDHA 3SYNA 3KQUA 1OHHA 3I8SA 1J8MF 5FTLA 3BORA 5EP4A 2GJAA 3EZFA 1T6NA 2KWIA 4IW3B 1XTKA 1Q3HA 1DO2A 2GF9A 3IIJA 2YWHA 3PITA 3UANA 3AVWA 1KI9A 4HLUA 1CP2A 2BWJA 1CU1A 3DKPA 1P6XA 3LQRA 1N6NA 3WNDA 2NMVA 4Q1DA 1E9CA 1IAQA 3H84A 2F3RA 2XJ9A 1GTVA 3KB2A 4IDOA 3KXKA 5AWFC 4B73A 4WAUA 2J0QA 3MGCA 5CYPA 1R7RA 1KMHA 3FTQA 1ZNYA 4LC1A 3VR3A 3VMFA 4GL2A 4URVR 2GRJA 2JLXA 1FW6A 2BDTA 4M1SA 1U0JA 1A5TA 4HB2A 1PVOA 3ZD7A 1CR2A 1FFHA 2NG1A 2OSBA 5DISB 1J7KA 4RY2A 1TQDA 4BEJA 5UKDA 2O5VA 1QG2A 2IYSA 4MGZR 1DVRA 3TNFA 1XJ0A 5JS8A 4ZCLA 4KBGA 1J90A 4D2IA 4MUAA 4KLNA 5CB6A 1XD8A 2JDIA 3U3KA 2QSZA 4B48A 4RZ2A 1IXZA 4H1UA 4D4LA 2REXB 5L3QB 5P21A 3LV8A 3NTUA 5J4KA 1Y3AA 3KQHA 2IYLD 1E99A 2UZ3A 3QXHA 4NYJQ 3RNLA 1X1SA 1OXVA 2QPAA 2FN4A 5A0FA 2NO9A 3AVUA 1ZD1A 4HAXA 1FMLA 3TVTA 4A0GA 4MRRA 5IK2A 5GADl 4MH0R 4TTPA 4E5UA 4ZCMA 3B1VA 5L3QA 2N46A 2CNWD 3LBIA 4JLPA 4DCUA 2ZUBA 1W49A 3QJYA 4MA4A 1HY3A 2QMEA 2ZIAA 3QE0A 2JJ2A 2QM7A 2A5YB 1E96A 1K5GA 3GJ6A 1CRPA 1P2VA 4QG7A 2BEKA 3Q72A 5JWOA 1L4UA 5JLJA 2PT7A 3LVRE 4HZIA 4U5XA 1KJWA 5L3SA 3FVQA 2ZM5A 1F2TA 4JT4A 3CW2A 3DOFA 1ZNWA 1SKQA 2ORIA 1G7CA 3I32A 1GL7A 2AHOA 3A1WA 3BRWD 1EX6A 1SXJB 1AQYA 1U9IA 4ESVA 1P61B 4QGAA 3F5FA 2PEZA 4P32A 1DAKA 3FMFA 2GAAA 1XTIA 1YJ5A 2R6GA 1ELOA 4I1OA 4YMWA 2J5XA 2QTHA 5TVKA 4A0FA 1BO6A 2X19A 2YNMA 3AUXA 3BH6A 2X2FA 4A9AA 5FBLB 1SXJA 4PSVA 4NYMQ 1P7CA 4QGGA 4XVRA 3THYB 2ZE8A 2NZJA 5JECA 3GLIB 3B1YA 1Q1QA 4URUR 5H1YA 4RD2A 3IDQA 2HLDD 3O8BA 3QNUA 3D3QA 4MITA 2W83A 2AWNA 3UIEA 3R8FA 1S8FA 4A6XA 2QA5A 4E03A 1KSFX 2ZREA 3IIMA 5E4FA 1KNXA 4AYXA 2YWEA 5FH9A 3QKUA 2ZYUX 2WSSA 2I1QA 3A1UA 4Q01A 4V03A 2R9VA 1ZM7A 3D8BA 2FEOA 4LOAA 1XP8A 1NNEA 4W9MC 4BEBA 2QZ4A 2WIAA 1DEKA 3KQNA 1XZPA 3VQTA 4C3ZA 1YR9A 2CL6X 3VU9A 4LV8B 4OI4A 3REGA 3WYGA 1E2FA 1NSTA 1P9RA 2QGNA 2E87A 4GP6A 5AJZA 3NC0C 4TSFD 3Q5EA 3TIFA 3IO3A 1F5NA 4DJTA 4UNQA 1RVDA 1DAHA 4H9GA 4PC3A 2DWOA 3UMFA 1KSJA 2JLSA 2ZR7A 4JYCA 4PPNA 3AKEA 4HSEA 4R2HA 4TLAA 2WHXA 1JNYA 1NI3A 1D5CA 1AN0A 4CEJA 5DYIA 5GJCA 3NEJA 3B85A 1GNPA 1QVRA 5EE9A 4Q9KA 1JQJC 1KY3A 1ZU5A 2GXQA 3D6TB 3LA6A 2CE7A 4A0RA 4ZDJA 4N0EA 5FTNA 1OXSC 4XD7D 1W48A 5FOVA 4M21A 3NBZC 3CO5A 5BYKA 4JZKA 1KAGA 4RFSA 2J7KA 2OESA 3LVQE 5KO2A 3QENA 3SI7A 5K8LA 4L5BA 3X1ZA 2CHGA 4KCGA 1PZNA 1YZTA 1QHNA 2ZRAA 3TQFA 4NE2A 4IDNA 2F9MA 4BWYA 4CW7A 4QHYA 1RRGA 2FSIA 4PC6A 5HZHA 4D80A 2B7BA 4ZIRA 3W3ZB 1CJTC 1T3HA 1W1WA 1OIVA 1CLUA 1T3LA 3D7MA 3X1XA 3GLGB 3PUWA 2ATVA 1VPLA 4B6FA 1W4CA 4HEJA 1ZD8A 1OHHD 3U4QA 1GM5A 4DSNA 3ZQJA 1NVXQ 3V4FA 1KJYA 2CL0X 4ZO4A 2AXNA 3X2SA 3T06B 1KTVA 3OIWA 2W58A 4FCWA 4JVMA 1SULA 5JJLA 1U90A 2J41A 5KPJA 4FN5A 4OQNA 2V54A 3X1WA 3GLGA 1G5TA 3B1ZA 3LAWA 2JLZA 1U99A 1FNMA 1G291 3W3AA 5FBRB 4DSUA 4OQLA 4L8GA 3QPUA 1S96A 2FOLA 3T35A 4JL6A 3HDTA 1XB2A 4JLDA 3GJ5A 4Q4JA 3TUIC 4YMSA 2CNWA 2WAXA 1PLLA 4HAZA 3W6PA 4AC9A 1XRJA 1Q12A 3VKGA 3HPQA 1IY0A 4D0GA 3TR0A 4O3MA 2FNAA 3T1TA 4Q03A 3LFUA 2AD5A 4MYTA 4URZR 3NDPA 1GFIA 4E09A 4DLVA 1G8HA 2V7QD 4A2PA 4KO8A 1R5OA 1XBTA 3IBYA 3CPEA 4R9UC 1LV7A 3QXSA 2YOHA 3PCRB 2GETA 2FEMA 2GXUA 4GP7A 3SQXA 4V0OA 1YZQA 1DO0A 4Q66C 2H57A 3AP2A 1HV8A 4XWAA 1YR8A 3GJ7A 2AR7A 1VCIA 3QF4A 4LJ7A 4Q7JB 1QDEA 1MABB 2WJGA 4D0NA 2XX3A 3BFKA 4C0HA 1W4RA 1QZXA 2GZDA 4PPQA 3DHWC 3P27A 1JAIA 4WZAE 3VU9B 1SHKA 1BMFA 2XZLA 3NG1A 4RD4A 4FWTA 2ECKA 4FMDB 1VIAA 2WJVA 2Z0MA 4N0DA 1U94A 3NC1C 3K09C 3K70C 1N2CE 2FU5C 8OHMA 1AQUA 4YMTA 4F93B 1GL6A 2HUPA 1KI4A 5JRJA 1AK2A 1ANKA 1T9HA 4Q00A 1N6KA 3QI2A 4ERNA 4TMWA 2NIPA 3ZIAA 1CJMA 4DLRA 4ZDKA 1GOTA 3TGPA 3PEYA 4NP6A 2IHBA 1LNZA 5CB8A 521PA 5HKKA 1S1CA 1YU9A 2BCGY 4JLJA 1XXHB 4XD7A 1Z6XA 1ZBDA 1DAFA 221PA 2OFOA 1NVWQ 3I61A 4C0AC 3BS4A 2WV9A 1OFUX 2F1HA 3WHKA 2JIZD 1KZ7B 1JJ7A 2BKEA 3B7GA 2HF9A 2O8FA 4NCKA 3VR4A 3U61B 2CLSA 2GJKA 2ZROA 3DVLA 1E2IA 2AWOA 1XXHA 3KFXA 4Q1AA 5F9HA 2BM1A 1G5PA 4LCBA 1GZSA 4QJ5A 3A4NA 2WBLC 1ZC4A 4M1KA 5K8IA 6Q21A 3DZDA 4B47A 1QHGA 4GMXA 4BQSA 1BMFD 2ZJZA 4WIAA 5CDFE 4DVGA 3BE4A 2UZIR 2QT1A 2OHFA 2PZFA 4D0LB 4CZ2A 5EUQB 3W6OA 3IEUA 1N0WA 4HDOB 4Q21A 4JMPA 3VKWA 3L2OB 4Z8YA 4KVAA 1AA9A 5HE8A 2QY9A 1M7HA 1WRBA 2IF0A 1IN7A 2EQBA 2UVQA 3QPWA 2XTNA 4HLDA 2XZOA 2VLIA 3BB3A 4EFMA 1T5IA 2WMNB 4HB3A 4F7WA 3LLUA 5DN6D 1COWD 5FOUA 1KSHA 4I81A 1U98A 1KO4A 2BBWA 2MMCA 5CJPA 1RIFA 2JGNA 2ZU6A 3DL0A 4S2EA 1BYUA 1JALA 1TADA 1UBFA 1U0HC 4PAOA 4HLQB 2W0SA 4DDVA 4DIDA 3TW4A 3B5JA 4H1VA 1OT3A 4L9WA 1RW4A 2JLQA 1SVSA 1G21E 1GIAA 3W90A 2EW1A 5FR1A 3AF1A 2WWYA 1OXUA 1B23P 2H17A 2FE4A 2P6NA 2PEYA 2NTYC 2NOAA 1Z6YA 1G3QA 5DYGA 3U5ZB 3K0AA 2XOKD 3I8XA 3ZJYA 3EZ2A 1E2LA 1W2HA 2IYQA 1E2GA 2Z4RA 2PMKA 3TMKA 4GRAA 1Q1ZA 3HR8A 1FP6A 2A3RA 4KV9A 4LHVA 2NO0A 4V0ME 4EPWA 3KKNA 3T12A 2G0TA 2RMKA 1RKBA 3CX8A 5DIFA 2IA5A 1Z0KA 4DDUA 3LD9A 1A1VA 4JJZA 4C2TA 2ZYTX 4OBEA 4EQ6A 2OV2A 5E7JA 4DLSA 3JVVA 2ZI4A 1CIPA 4G5SA 1TQ2A 3KXIA 1HEIA 1K8RA 3CONA 1X8KA 2ZRJA 3AV0B 3CWZA 1OF1A 5AUPB 2W00A 4LX0A 3GLFB 2IK8A 3F3YA 3SZRA 3IKJA 5DI9A 4G5RA 1VG9B 3AVVA 2ZI3A 4P0TA 4BPBA 4TLCA 3NXSA 3RS0A 4A4DA 2YV5A 3NBFA 4HAWA 3RWOA 1TTTA 2AX4A 2C9CA 4PHTA 3CRVA 1M1YE 1E2NA 1XEWY 4Q4HA 5KHOC 5FPSA 3NVAA 1OV4A 2F1IA 3JZMA 4AWXA 1JEDA 2GKSA 2H8KA 5L3VA 5GJBA 1XF9A 2CLCX 5JMTA 4L9SA 1PUIA 2XB2A 4LK2A 3B2EA 1KKLA 3C16C 2JLVA 2BVNA 4PO1A 2QBYA 5BQ5A 3EIHA 4PSKA 5TB5A 4LRWA 4A1FA 1NN1A 1N6HA 5AJXA 2VP0A 1N6PA 1ZRHA 3NH9A 2ORWA 2ZI5A 4HLCA 3EPHA 1ZC3A 2C5LA 4QC2A 2GCOA 4FI3C 3F0TA 5FOXA 3R8CA 5JWRA 4MKHA 1KJZA 2YC2C 3QBTA 4PC7A 1LY1A 2QI9C 1KSGA 4QGHA 4ZDWA 4Q02A 3LRPA 1ZUNB 5DH9A 1YE8A 2A5JA 4Q4LA 2MMGA 1UAAA 2CK3A 4PXAA 4RVCA 2BHRA 2CJWA 4DCTA 2HT1A 3KJEA 3M4YA 2ZJYA 4PHHA 2AKAB 3JZAA 4CF7A 2SHKA 5KNBA 4OK6A 1FMJA 3DM5A 3EZ6A 4FMCF 4V0LA 4Z1MA 2JLRA 1BYIA 1J70A 3K0CC 1HT1E 4KLZA 2OZEA 4B3DA 1AKYA 3CNNA 2JJ1D 4LJ8A 5AUQA 2CJWB 1LF0A 1OKKD 1W46A 4LDJA 2J87A 3LWNA 1ZJ6A 2WM9B 3HYRA 1WBBA 3UWKA 3U7EB 3K9LA 4W7SA 2J9RA 3GP8A 3E2IA 3HYTA 2IYRA 1XD2B 1FTNA 4CVNA 2QUZA 3A1VA 3IHWA 4ASUA 4IJMA 1NVUQ 3I4LA 4FD2A 3P26A 1W0KA 3NWJA 2BBTA 4JL5A 3LW8A 3RS3A 1T8TA 3TUJC 1D2NA 2CDNA 1R0XA 3QG1A 5KSYA 1E2MA 2ZJ8A 1S1MA 2V9PA 1ZINA 2ZITA 2BMJA 3GJ3A 1X6VA 3LW7A 1XD2A 2ZSEA 3MSXA 1IOZA 3PXGA 3U7FB 1WDTA 2VHJA 4IXNA 1DADA 1KDRA 4C0SA 2VH5R 1DTSA 4GOKA 5DLQC 4EJSB 1MT0A 1ZUHA 1W36B 5FBQB 2JDID 4YDSA 4DDTA 4AKIA 2GJ8A 2XEXA 2ZANA 1OW3B 3Q7QA 4K46A 5B57C 3OEED 3BJIC 1EFRD 1OSNA 3IILA 3FMPB 3R7WA 3U7HB 5FOTA 2CLDX 5DE3A 1Q0UA 5KOYA 2KE5A 2QPOA 4F92B 3TAHA 1Z2AA 2ZYVX 5HCNA 1PLJA 2CMKA 3K70D 2DB3A 4Q1FA 2CL7X 1W44A 2ZR9A 3SQWA 4KAXA 1E4VA 3GFOA 4NDZA 3B8HA 4KITB 1R2QA 1P9WA 3AF3A 4OK5A 3EC2A 3TH5A 4D4KA 2IS6A 1N6IA 2GCPA 1DAEA 4Q1BA 3A8TA 2CCGA 5LPNA 3H86A 4EUNA 2HJGA 1E2PA 1IXRC 1MABA 4P4SA 5FFMA 2VPPA 2FGKA 1FQJA 1ZNXA 2ATXA 1HTWA 1KO7A 2QP3A 1ZUIA 3AP1A 3ND8A 3GLHB 2FPKA 4A0HA 1NY5A 3MCAA 3EW9A 3AP3A 3OE7D 1EK0A 3FKSA 1QHIA 1KDPA 4TMVA 3PEUA 1M7BA 2IEYA 1SHZA 3GLFE 4R2IA 1Z6GA 4PZYA 1S9HA 2J0UA 4B44A 2PLRA 1E9SA 3C5HA 1HA3A 1R4AA 2OBNA 2ONJA 3FFBA 5L8VA 2QENA 2QQEA 3GLIE 5D3MB 2ZJAA 3BERA 3ADDA 1TMKA 2IYTA 3EWSA 4DZZA 5LDDC 1G7TA 1TEXA 5EUMA 2IX3A 5DGXA 5AK0A 1J99A 4NL4H 4TT3D 4DT1A 1SKYE 4IHQA 3RAPR 1FP7A 4NHOA 3FMOB 3THXA 4TMXA 4C0JA 1Q22A 4JBXA 3SN6A 3MWJA 4NBSA 3SS8A 1E32A 4DHEA 2OCAA 3RSOA 3PFIA 1XMSA 3UG7A 4JL8A 4LHXA 3AH8A 1L7VC 3KKQA 2JJ1A 3T1VA 3U44A 4G0NA 4O0MA 3NHBA 4JVLA 5JCZA 3N2IA 1C1YA 2NQ2C 3K0EA 1GRRA 4MYCA 2ODEA 4L16A 2ZR0A 2GTPA 2OAQ1 1UEJA 2DBYA 3L82B 1X86B 1AZSC 2HLDA 1B0UA 1J8YF 3BWDD 1NG1A 4TYQA 5CM8B 4GSYA 2IWHA 3CIOA 1G16A 4MRNA 2ZI6A 2IUTA 5LB2A 4ZKDA 1XTJA 3CB4A 4US2R 1J2JA 1XDBA 1AS2A 2KB0A 1G20E 2DFKB 2P5SA 4LBYA 2QE7D 4O2LA 4TMZA 4RD3A 4V0NA 3RLFA 4X8LA 4DLXA 1JI0A 4QOSA 2RGGA 1XJCA 1WE2A 5G3ZA 5KDOA 5BXQC 2YHSA 2BBOA 2VP9A 1L4YA 4RD1A 3PUZA 4QBIA 1L8QA 2FX3A 4JBYA 1UADA 3QVVA 3SU8A 721PA 3U6KA 2FG5A 1G4UR 3SC3A 4DLYA 2C8VA 4URXR 2OT3B 2ZJ2A 4B33A 3OIVA 3QVUA 1MV5A 3TSWA 2GESA 4QM7A 2O8DA 2R62A 2XJ4A 4HUQB 4AK9A 2J3EA 4LJ9A 2AXPA 1NRJB 1S3SA 2DPXA 4JLNA 3WYFA 4M9XA 3CRQA 3SJAA 3SEAA 1NLZA 1S4QA 3SHWA 1YQTA 3NKVA 1RJ9B 3UK6A 1WB9A 3QKSA 1W7AA 3UXMA 4KFSA 2XXAB 4AIIA 4Q9JA 5EJEA 2QG6A 1S0UA 3LBNA 1E0AA 2OXRA 1DG1G 3EAQA 2ZI7A 1UM8A 2C2HA 1GDDA 1EESA 4NKRA
chains in the Genus database with same CATH superfamily
3ZWQA 1W85B 1ZYUA 1NJ2A 1SUCA 2VJMA 4FYYA 4OMCA 3H9JA 3ONEA 1S8OA 1R9JA 2QYTA 5KNLA 1I80A 2PGOA 1NUUA 1X9GA 2B5VA 2JJ8A 3QU2A 1M2EA 5EMKA 1CLEA 1AG9A 1U9ZA 4BECA 1NR5A 5K8CA 4TMTA 1CS0A 2EFHB 2GEVA 2JZCA 4KBYA 3KB8A 2UZ1B 4CIYA 2GGSA 1AF7A 2XDYA 1Z12A 3CX3A 4NCNA 5AKIA 1EFVB 3HQ4O 5AKLA 1TA4A 3OU2A 3AEUA 3DCJA 3G1WA 2MJLA 2CB9A 3HBJA 1APBA 4OPMA 2H59A 4ZO6A 2JAPA 2JHCA 1HYEA 3AVXA 1WDLA 3OZIA 4IX1A 4EQ6B 3QVOA 4YPFA 3OLCX 3A10A 1TRHA 3QFRA 4HFMA 4KO2S 5DHUA 2PX3A 1RADA 3UOGA 5L3SB 2H63A 4DMFA 3E1SA 3ZVRA 4J90A 4TXJA 4NZYA 4EUEA 1G1AA 1VYVA 3FTPA 3P52A 1YRYE 3EZXA 1BHSA 1XTSA 3VH3A 1EFVA 2R3SA 3WR5A 4AY3A 1YL5A 3EPRA 3WGNA 1D1PA 2F67A 2C07A 1LTHR 1N7JA 1T9GS 1K1EA 2BGNA 3AERB 3ENZA 1SCKA 3BIOA 1T2CA 3VR5D 4D3ZA 1V5WA 3TDNA 4ZEVA 4BWFB 2PSEA 3BGSA 5AI6A 5H3HA 1Q6ZA 1TB4A 3U3MA 3GP8A 1P5RA 1KXJA 2C2MA 2REOA 3KQPA 1FFGA 2O8EA 5JJKA 3N76A 5DBIA 3QF7A 5IM5A 2FJUA 4C01A 3GZNA 1MEOA 2FWRA 5KOIA 9MHTA 2IDJA 5IMBA 4LJ4A 4EKDA 4JI0B 1T5HX 1GGVA 1VJCA 3TTTA 4D3FA 1PT6A 1P81A 3CH5A 5FI5A 1MX1A 5KSWB 3K9CA 2NZ8A 2W11A 3TSOA 2VZ8A 1SH7A 1D9XA 2AS0A 4OHUA 2VJYA 1Y42X 2C4UA 1Z15A 4URYR 5DCUA 1IM5A 1M1NB 1T2DA 3KU4A 4PLTA 1N34B 1G6OA 5SZKB 4D57A 1EDZA 5BSTA 3MRVA 3S2IA 4RK5A 2X8JB 4S35A 4KYTA 4JKOA 5GVSA 1WDMA 2CF5A 4YAJA 1VYTA 3QY0A 1RWKA 4BGDA 1KQFA 4BHTA 1EFHA 3A6FA 4A36A 2ODNA 3FCOA 1LK7A 1JS1X 1E98A 4GF5A 4KXVA 2XB9A 4G5GA 4GLFA 1NPTO 3LPDA 4V38A 4HPXB 4DIOA 2V6JA 1NVVR 3PU6A 2CJFA 2B9EA 2QD5A 3PC2A 3RRNA 5BQXA 5JXWA 1FF9A 5E6SA 1OC4A 2Z43A 2I54A 1GV1A 1TCVA 3LT0A 3NHKA 1R0WA 4NBNA 3ZWOA 5A03A 1AA6A 3STVA 1GZ6A 3HJFA 1T4BA 2JFXA 2Q1YA 3O2NA 3L8YA 1NN3A 3VZQA 3HUTA 5KTOA 3NTLA 1WPGA 5HTKA 3DT8A 4P7KA 3EEFA 1CUSA 4IEIA 2XOKA 3NHWA 4I19A 2AMFA 3QFSA 4KN6A 4X8MA 3L0PA 3KJHA 4BIMA 4JS0A 4F3CA 1LJ8A 1SU4A 2HU2A 3CH4B 4FD3A 1JX6A 2IIQA 3K2IA 3QVSA 4RD0A 2YCBA 2A94A 4PCUA 4WEQA 3RH0A 3C7KA 3HMQA 3HBFA 2O57A 1NMXA 1NJGA 4YASA 5CTAA 1XI2A 1FS4A 4PG4A 3QEKA 1E9VA 5AW6A 1SUWA 1XCOA 2WKQA 2ZBRA 4J0KA 4KN8A 5FCDA 3TPZA 2XUOA 5IKOA 1NLUA 3NTVA 4IG9A 4QGFA 2NV2B 2IXAA 3EVAA 4LEIA 4CMKA 1IJKA 3R6GA 1E2EA 1U8ZA 3I30X 5AJVB 3ZX5A 1V8PA 3NETA 1V1JA 2C58A 2H1CA 2I87A 3B13B 4X41A 2FXIA 3ESDA 3FCAA 2FLKA 5M04A 2FUCA 4XWYA 3W5BA 1XKXA 2QB5A 3QXJA 4Y7CA 3FYUB 4M86A 3WDSA 1E66A 3VO9A 1AGNA 1DRKA 3KZ1E 5CB6A 4IMRA 1Z8NA 1TZKA 1XTQA 4QE3A 1KXZA 2HHLA 1OIXA 4ZGWA 1HLGA 1W9HA 2FQYA 3EXHB 1B93A 4N5IX 1CUXA 2BFCA 2MSKA 4UTZA 3RB8A 2PGJA 5IKPA 3AKZA 3ZHYA 2HQ1A 4K8RB 4ZZ2A 3VR6H 1WXWA 3KKOA 2V7TA 3GGOA 2CV2A 5HILA 4CTOA 3E5HA 2RHHA 3F74A 1VLZA 4CKCB 2RHWA 2J6CA 2VPTA 4G9GA 1B8NA 1MJGA 1P62B 3HR7A 4BNZA 4FILA 2B4YA 1YHZA 2A35A 3FI9A 5EXSA 1VKJA 3UJPA 3E8MA 5EWLB 3TUZC 1DB3A 5K8UA 2YS7A 1BJKA 4JD5A 3T0FA 4G1VA 5J4LA 1BJTA 1CG6A 3EVNA 3FKSD 4EYQA 1KKMA 4DXAA 3T5DA 1L4FA 2I6SA 4OBXA 2D1TA 1OU4A 4UMVA 5TQ0B 4BLWA 2ZVJA 3NDBB 2O3UA 2Q45A 4F6RA 2R68A 4IVPA 3KWLA 2HA7A 1H1DA 2LKCA 3PC7A 4WY5A 3I01A 3ZI0A 1RC1A 4KK3A 2ZSFA 4YR7A 2IVFA 4CM7A 3V1KA 1RAHA 2E1RA 5CLIA 1MHPA 5EIBD 3FPJA 2VDWA 1JIJA 1ID1A 4G01B 2LE0A 3IR5A 2AMLA 2AR0A 1E2QA 4WCVA 1FMTA 4L95C 3ZYZA 1GLNA 3B9RA 3JATB 4PRYA 4BMYA 4D9CA 4MDEA 1VHTA 2GBLA 2R6R1 2O0KA 1N5JA 5C3MA 3K7EA 4QKQA 3RF7A 4LY9A 1EFPA 1Y5RA 3E1GA 4U6SA 9LDTA 5K9ZA 1KI6A 1U1EA 1MAAA 3ID6C 3K5PA 1GCUA 2D13A 5JALA 1Q1NA 3NCHA 5L40A 5F98A 3OPNA 1FNDA 2VIIA 4A5OA 1U5CA 3A25A 2Q6TA 1II0A 4EFKA 1B42A 1FDWA 2VNKA 4B2IA 5GTDA 2RHJA 3TIGA 4CNQA 3CR8A 3DBHA 3GD7A 1M66A 2BMDA 4YMHA 4FHEA 5LL6P 4MVJF 4MGIR 2AHRA 4CIAA 2B20A 2WT8A 1N2XA 3ILSA 2WK1A 5FF9A 5CCDA 1F2UB 4EHKA 1RP1A 4LKOA 4ZJUA 1TZCA 3A31A 2PAAA 3FRIA 3NIFB 1A9XA 4ZU3A 4BASA 2W2TA 2PCLA 3N2NA 1IONA 1Z6TA 4MRVA 2V1UA 1SC3A 1QYVA 3SC4A 4BRSA 1XCPA 4CHGA 3HH8A 1KZ9A 3QEBZ 3Q10A 1ZCAA 5G0WA 4AZ3A 5EPOA 5BMOA 4CG0A 4FW9A 3B6EA 3M1YA 5HBRA 1EFCA 2Q3BA 1MO5A 1N5IA 5IC4A 2V3VA 4KXXA 2VWQA 4V0RA 4BRWA 4KGVA 4UDXX 5T3YA 3T3EA 2G70A 2OWDA 5BVHB 1K98A 1UF9A 2BISA 2PKEA 2XT9A 5K3BA 4BMCA 2NO1A 4B76A 2ZWIA 3OIYA 4RWEA 3A05A 4XOUA 5GIOE 1MO4A 3CM0A 1TUIA 3CH7A 4MP3A 3WBFA 4YCMA 5IN4A 3UYKA 1VRVA 1AO3A 4WJKB 4DMCA 2Q5JA 4S04A 3QUCA 2HXYA 1GNQA 3K2BA 4HD8A 4GE0A 4UASA 5JS6A 2O2EA 2AKYA 3AWDA 3PUJA 4ITVA 1NV9A 3K1TA 1LB1B 4NH0A 4AB1A 2C5HA 4EATA 2PLNA 2P65A 1P6QA 4CHTA 1Z8HA 4TVOA 3F78A 1JSXA 3TRKA 3B6MA 4FCVA 3GLGE 2ZBDA 4XSGA 4YV7A 1G3UA 4IM7A 1KS2A 3T5GA 4LX8A 3WHLA 1NOKA 1YE5A 1ZVMA 3KKMA 2C7QA 2F8TA 1KOJA 3TLKA 4J76A 3S1LA 3VYVA 2FW1A 4DQKA 5NULA 3PJRA 1ZS9A 5JHHB 2R48A 3FW1A 4CLOA 3V8MA 1PFGA 3GNSA 4MICA 2E5WA 2GNOA 1T4MA 2RHCA 3AL2A 3QVLA 1UPUA 3UT0A 3JQDA 2I9KA 2YJZA 2XF2A 1YOVB 4MLZA 2PNFA 4IEEA 4PTYA 3HA7A 4L6IA 3GRAA 5HE9A 5KOJA 4LTDA 3MQFA 2JEYA 1SXJD 2ZEJA 4QXPA 2O2XA 4XWKA 2RI6A 4EKEA 1J8FA 3RV3A 4AJ4A 3UCXA 1L5MA 1WSWA 3FI0A 4I6EA 3AESB 5AVOA 1TVEA 3UAYA 4LDQA 4AM8A 5IP5A 2J09A 1F8YA 1JDNA 2PMCA 3A7EA 3CINA 3MD0A 4UAJA 1YS2X 3PJEA 3GMIA 1VG1A 4KKVA 4II2A 1K4YA 3TTSA 3RGGA 2GHIA 1ZM9A 2VPZA 1KETA 1XWIA 4MARA 3LDFA 3MOIA 4C3VA 1QGUB 1KQOA 1YAJA 1QG4A 1JHRA 1M2GA 3QJGA 4TYMA 5LCXA 4RTPA 4ZV9A 2OK8A 4P7JA 4HV4A 1JQBA 1JT2A 2BR4A 1JAZA 1MPXA 2RG7A 2XECA 4XQEA 5GGXA 2BGKA 2O8CA 1JXMA 2VHEA 4UEOA 3KHUA 4IOKA 4EL0A 3O4JA 1QCYA 5J58A 1UC8A 1DIAA 1MVNA 2F43A 2RG1A 4O4HB 2FPXA 4YUAA 3ACCA 5L3ZA 4B6RA 3UT5B 1KHTA 1O6BA 4YHHB 3M6XA 1EP1B 1H4VB 2DBVO 3M6FA 2QAGA 2XKJE 1T3TA 1FFAA 2O8CB 1OB2A 1XQ1A 2I2AA 1OGJA 1XAGA 4FXOA 3MMPA 5D7BA 5SY6A 4B6OA 1FDTA 3TLGA 4EAAA 2L42A 3LKZA 5ICEA 2HZ7A 1A72A 3QBEA 5C8YB 1O58A 3C7TA 2UYOA 1QK4A 1NONA 1RABA 1M9NA 4YIKA 3BE8A 2QSYA 2JI9A 1YNSA 2XNDD 5CIWA 3CRNA 3IEIA 4DWJA 1LS1A 5DRTA 2HLPA 2PK3A 3GCGA 4IHAA 4LBVA 4PPFA 4ESEA 2E4YA 5FLXA 4P0QB 3EQ8A 4Z1MD 4Q0MA 2OBLA 2XQGA 3ROEA 2ERCA 5LXTA 4UBOA 4ENPA 1Z5UA 5EE1A 4KR9A 1FLAA 2ODWA 3KU1A 4NECA 4TMKA 5K3SA 3RAEC 3DTVA 2CMDA 3UXEA 2FLVA 5KBYA 2QRJA 2R8XA 6REQB 4B3GA 5FNVA 3UUWA 3HBAA 3FTCA 5HIKA 5JTUA 1XTTA 4L76A 1QANA 4ZZIA 2OG1A 2GUGA 5HFAA 4QQKA 2PT6A 1M5TA 2IP4A 3UAZA 621PA 3MT8A 3COSA 2D0OB 4Q6BA 3M81A 1UK6A 4TS3A 4QBGB 1E4YA 1WTCA 1LQUA 1UMDB 2A4KA 3AIOA 2IQIA 3WJ1A 3LTNC 1KU0A 2P9CA 3TL6A 2R6DA 3RUDA 3N6VA 1TLLA 3FZGA 3S28A 1CUIA 2WFLB 1P72A 3O1HB 4LDPA 2BPOA 3O3MB 4ND6A 1Y98A 5C7YA 3IC5A 5AW0A 3KTDA 2ATIA 1L4EA 5CT6A 4KHZA 2D2VA 1U28A 4LYYA 3VSCA 2BM8A 4RS4A 1CR1A 1AO0A 4H4DA 1PW5A 1ZHOA 3MUFA 5HQJA 3MPOA 3L7KA 1N1MA 4GG1A 4BZXA 4DLAA 1NRWA 2X2PA 3B3JA 4OGWA 4RM3A 3BA1A 3I1IA 3HVIA 3UMSA 1H42A 3GJ4A 4W8HA 1T5LA 5LA6A 2X1HA 5K2MA 3I42A 1YRBA 4AO7A 5I7WA 1VBNA 2QX9A 2QXTA 1V5GA 4GOXA 1NM5C 2CJXA 3WI7A 2BELA 3B2QA 3D4OA 1YCGA 4TQGA 4EHDA 4GYYA 4M2LA 2UYQA 4K9NA 5K3DA 3IOEA 3INRA 3D6JA 5LZ5A 4QWWA 1R8JA 7AT1A 3HO1A 4D97A 5K01A 2C1ZA 1Q17A 2NSHA 3EXIA 4JWKA 3QLTA 2XHZA 4E2YA 3ASYA 3BC1A 5JZOA 3H9GA 4Q47A 4G23A 4LVNA 4JY7A 3OJWA 3VC7A 2PJRA 1OZGA 1YR1A 5DCWA 4PNZA 1UMBB 3I9LA 2FOIA 3LFHA 3P97A 4JP2A 3KTAB 4XAQA 2QAGC 4C7KA 3VUFA 4ACBA 1XXHE 3Q7PA 4JEUA 4KI0A 3ODPA 1J8DA 4KYIB 1LSSA 2ACEA 2ZRPA 3KVVA 4RETA 2P9TA 4HGQA 5JZBA 2A7XA 4ENTA 1GITA 4OHVA 1B00A 4KQKA 1S2IA 1QF6A 5BN1A 3JPYA 1M33A 3L49A 1F4VA 1B0AA 3H2KA 1T29A 4O59O 4B8WA 4BATA 2OXTA 2RAUA 1RI5A 1PL0A 3IUNA 4K6KA 4LTMA 4PBRA 1QH1B 5H4GA 1KO8A 5CRIA 3W4JA 3CWQA 3MTJA 4GGPA 5MN6A 2ZYWX 3UA3A 4OLAA 1J0DA 2EBFX 3FHTA 4R1NA 1SBYA 3MAJA 3PE4A 1VB3A 2C3PA 2I71A 3TIXB 4CCYA 1V16A 2PE5A 3A2KA 4CMAA 1JR3E 3BB4A 4ZARA 2DQYA 3A58B 3HRHA 1UR5A 2CCKA 2Q6OA 1L9XA 2Z5VA 3OFNA 4YAOA 3U4QB 1UWLA 2IEZA 4O08A 1FVHA 1NN0A 2QLJA 4YVFA 4BMDA 5K45A 4QXMA 4KREA 3WMEA 3RLIA 2I8LA 3NHSA 4LXYA 4RZHA 1LZLA 4LOJA 2JFZA 1NT4A 3N07A 1CY4A 1W94A 1Q3TA 3FPAA 4OHXA 4EK9A 1TCAA 2PXXA 4AYTA 2VG8A 1JNXX 3L07A 4MVJI 4NYJR 4RLSA 4UM7A 4EB6A 5BWNA 3FTFA 4OQXA 1CUWA 4WH0A 4YXFA 2D74A 1SU6A 4E2XA 2ZATA 4Y9TA 3LM8A 5HKBA 5IZCA 1O94D 3CR7A 4DEYA 4PY2A 1L7XA 3GLQA 4OGKA 3ZKAA 5HTOA 2O2HA 5HZKA 2X58A 1BXRB 1NKVA 3AR2A 2EZ8A 1ML3A 4YMGA 2PJUA 2FRXA 2N75A 2XA1A 1E2JA 1FPQA 4CU5A 4NONA 4ZVSA 2R6ZA 2ZUDA 1G8KA 3HGQA 3LO8A 3OMWA 3OLXA 3ANXA 3KJNA 4R16A 2VUHB 3IEPA 5GONF 4JI1B 1SZCA 3AF6A 2VJOA 3ZZTA 1GA6A 2XTAA 1PSDA 4OM7A 1JN0A 3KSMA 2ZRNA 3NT5A 2IYWA 3VH4A 4KU4A 4C87A 4EG7A 2Z3WA 1R12A 3QITA 4S1VA 1YVDA 1J8QA 4JI7B 1BXRA 1QHXA 4EITA 1L5GB 2Q8QA 5F7JA 1MIOB 1K06A 3CBQA 4HLUC 1MVLA 4PS1A 1PT5A 3QFCA 4F1WA 2BI4A 3L8CA 5HNKA 2L2QA 4WVLA 1XHEA 3ORSA 4MB6A 2C20A 3IAEA 3QPBA 1YB1A 1TZBA 4ARAA 1ZUWA 1VP9A 3QF4B 1JYEA 3W8EA 3ST7A 1COZA 1SKAA 1YBAA 4JGGA 4L4ZA 1FDVA 1C41A 1E92A 3G23A 1TF5A 2XE8A 1JTFA 5EJ6A 5KYWA 5CXSA 1K8YB 1NM5A 3GEHA 4M0PA 5B1IA 3KWJA 4G4JA 1RQRA 2AQ8A 4HMOA 3E35A 4MS4A 3RFFA 1ICEA 3TL3A 2C9ZA 5LQDA 1MRNA 2VJLA 2O54A 1ML4A 2H5EA 2P6MA 3ELUA 3IQIX 4EOGA 4ZVTA 1Y4UA 2POCA 1WHTB 2IPMA 2HMWA 2X5JO 3ROKA 2Z2XA 3VR6A 3ZLVA 3M34A 4FMCB 4I08A 5T4EA 2FB9A 1CJCA 3BDIA 2BEVB 3DMYA 3O8NA 3MT9A 1HE8B 3BXGA 4G5OA 3O4FA 2OXIA 4ZYYA 1K0UA 1UKEA 1ORDA 2GK4A 3GJXC 3OM9A 4HH1A 4TS1A 4WBXC 4D56A 4V0MA 4KMMA 1NNLA 2YIDA 2Z3VA 3PD0A 3L92A 4FGLA 5ITWA 2NPIA 4CM3A 2R4TA 5CA1F 1AUQA 2QTTA 3GT3A 5LN1A 2WNIA 4I1RA 2YYYA 3F96A 5AOAA 4INAA 4HDSB 4PSDA 4X1KB 5TXGA 1JFVA 5LMNB 1NBIA 3DSRA 5JVDF 3IBSA 5JROA 3PQCA 4UMFA 1V39A 2HPAA 2V7PA 3A4VA 1HBJA 3T7RA 1IXSB 3BUSA 3OAAD 1V45E 4LHYA 3MYYA 4F21A 1YBMA 5I51A 3S2FA 2YW2A 5TPZD 1V96A 4IXWA 3PNOA 4Q39A 3GCWA 3T5PA 1BWSA 1DJMA 4RJTA 5DI3B 2Q2WA 2WWHA 5DYTA 4B82A 4EH1A 5BN3A 4CM6A 4IGEA 3RIHA 3D0QA 2WD7B 1NNI1 2H9AA 2OP0A 3PNQA 2VA9A 1E9RA 3FBTA 2V45A 2GBLC 3UPUA 3DCNA 1TUBB 1MAHA 4HK4A 4AJ1A 3KUXA 4ONEA 2OYSA 2ZRLA 1I6LA 1G55A 4QPJC 5LUBA 2CNOA 1NDQA 3JWEA 1ZJJA 2DHRA 4WKPA 1KK2A 3INTA 4O25A 3OEHA 5DI3A 4KIUA 1SNYA 2WJWA 1XOIA 3DBIA 5ARBA 4TL9A 4PAMA 4AY6A 1YJAA 3I5XA 2OV6A 1Z3CA 5BV2P 3ROGA 3V8NA 4AWBA 4BQEA 5JV5A 3F5MA 4OMUA 2EJCA 4XM2A 4MQMA 1KU6A 2ZKIA 3MWYW 3QE4A 3PFHA 2WWWA 3BD9A 4IFEA 5JS1A 2CHEA 5TARA 4DV7B 1DXOA 5K20A 4UJ5A 4QHTA 1ZNZA 3L8GA 4HZUA 1A7UA 5CGZA 1TCCA 1W8DA 4IKOA 4LGMA 1D2GA 1QAQA 4XDGA 3W6UA 3CUEF 2I3BA 2HYIC 2YASA 1N5DA 5ECDA 3T7TA 1OWPA 4WCFC 3BYZA 4J9VA 1NYRA 5F2EA 1B26A 3GPDG 1U81A 2PRJA 3MMSA 2QK4A 4QJ4A 5AKKA 3WL5A 4L7QA 3TNYA 1SIWA 3MGAA 4I8DA 4US0R 1JIQA 2FK7A 1R0ZA 1SQSA 2VDQB 5D00A 1X42A 3R7BA 3L8ZA 3QIVA 3D59A 3RROA 3TTXA 2SCUB 3AVYA 2QM8A 5CVCA 2HDHA 2WJIA 1Y8QA 3RUFA 1WCYA 2AA3A 4ED9A 2YZNA 5LMCA 3K6SA 3UWSA 4GOND 4FMDF 2HHAA 5FL7A 2GN2A 1J39A 1R4ZA 3NJ8A 1QZZA 2BCJQ 4ZP1A 3D5QA 2ZRMA 5ICFA 3JSAA 1RZ3A 2P2SA 3OMLA 3RYFB 1NJFA 1P1BA 2XKAA 4QFBA 2Z2KA 3ZDYB 3O1JC 1VA5A 2AK2A 2DR3A 1F1JA 2VRBA 3CURA 3PICA 4XLZA 1USWA 2J1LA 3SHFA 4BO5A 5IG2A 2H16A 4OXNA 1A8HA 4I50B 5DX8A 1N6OA 3G5TA 3HY3A 1FXUA 1HH4A 2HTFA 1YZLA 2D2IA 2ILVA 3TQQA 3F8WA 2Z8ZA 4MKXA 3FDIA 2YV4A 4OQQA 5AHRA 2FWMX 4IMPA 3N7UA 1CQWA 5ELMA 1KERA 4JUIA 3WKAA 3MJHA 2QL5A 2Q21A 4R0VA 5CURA 2ECPA 3D1JA 4RKRA 4KXQA 5G4KA 2KBEA 4ROTA 2BSAA 4I50A 1A96A 3BMOA 3N0VA 4TMFA 1N6RA 1Q3KA 1U1IA 1YVEI 2QPTA 4C07A 3OZEA 4AJOA 4QUHA 2IU0A 3PI7A 5JNSA 3E9QA 4AG6A 3Q7IA 1YJXA 5C18A 3KFVA 4DG9A 4D1YA 1ECCA 3IR7A 2AN5A 1RE0A 2VHTA 2GM9A 3PFWO 4QUDA 3VOSA 4BFCA 2W6JA 4IS2A 2XUQA 3G5AA 4M1TA 2O5EA 2GDJA 3SD7A 3P2YA 2EL7A 4YB8A 3IUYA 3S0JA 1RXCA 3P2JA 2QD4A 2V7QA 1M8PA 2BZ1A 1PG0A 3CFYA 5D3QA 1N2CB 2FFAA 4QTYA 1GL3A 2FMUA 5JJIA 1OPXA 1IY8A 2QIOA 3LHSA 2QZJA 3BIXA 4I99A 4PF1A 1K6XA 3ZD9A 1IY1A 1UJ4A 1TJ4A 1E9AA 1KFBB 2AMVA 1D2EA 3R5HA 3CF6R 2OKGA 1ZU4A 2QTRA 3NUZA 4V0QA 3SLGA 4FTWA 5SYMA 4XARA 4TTSA 1JDJA 4Q7QA 2Z6VA 4Z4FA 2VZEA 4O2AB 1SVMA 3KAPA 3WMFA 4X91A 5D5QA 1EVJA 2X3FA 1E1CB 2IPAB 2CV0A 1KO1A 5BW8A 3HU2A 5LWQA 2O5CA 1F9AA 4OO3A 2C98A 1ULTA 3OE1A 4GEGA 3Q98A 2GK7A 2IW3A 3Q40A 1U2SA 2BHNA 2D1QA 1LF5A 1J2EA 1W25A 1ZD4A 4HB4A 4ZQHA 4DARA 5C81A 2CVZA 1FY2A 1TU4A 2SBTA 2O52A 2VEDA 1AV7A 4LI3X 4MW5A 2I5PO 3JVDA 4QXOA 4X90A 2QBYB 1EK6A 3LQYA 3ZQKA 2LWIA 5F1KA 4B9EA 2H2WA 4X6YA 4YV2A 5CG1A 4OYLA 2W9XA 3KQMA 1LC0A 1A2KC 3EIXA 2OFXA 1CR0A 2B4RO 1XU9A 1E8NA 4WQMA 4AI6A 3V1TC 4E2ZA 1ZM4A 4OXIA 1DJLA 3MNFA 4PLFA 4AKSA 2YHBA 1NBWB 2IKQA 2IXFA 2RK6A 4KR0A 3QBJA 4PQYA 4TQ9A 1U1GA 3S8MA 3RADC 4Z9AA 4RIIA 4BNNA 1D03A 4MUBA 5A2QA 5TE9A 3TBHA 2BUAA 1OXXK 2EX1A 1P5FA 1QQBA 4I1SA 1LSOA 2C7BA 2VKQA 4PC2A 5E0OA 5DDIP 1A9OA 1KI1A 1NVVQ 4O2RA 1PQ4A 4D9BA 3PKIA 2QRZA 2WF9A 5HSGA 5JD6A 1TPZA 2QTFA 2QVXX 1P5ZB 3O7MA 4HUQA 3IRUA 5EZ5A 3IFSA 1EXNA 4HS9A 2FEPA 3UWMA 1CJUC 2GN9A 2HJHA 3RAJA 4WKGA 3BXZA 4U02A 2HO4A 4LBWA 4KYUA 8MHTA 3M9LA 4BNUA 2XXAA 1XZEA 1EWQA 3QKIA 3TYXA 4PEVA 2JH9A 4M4SA 3PFBA 3C15C 1UJ2A 3W5JA 1KZHA 4E5PA 2EKZA 3PYXA 1FNSA 2CZGA 4EG3A 4A8JB 2L0XA 4R83A 3ESRA 1LDMA 2LKDA 4Q37A 4HUJA 4OJTA 4YUZA 3VNUA 4WCFB 1Y6RA 3GBVA 4NZ9A 3ZDAA 3SM9A 2VDPB 4QTZA 2I4IA 3Q11A 4F3KA 1P0CA 2ZT8A 2I6XA 4I14A 2B5WA 3HKBB 2R8RA 4LG1A 3FFAA 7REQA 2JLUA 1JHQA 1C30A 4RPLA 4BE7B 5LZ2A 3I2YX 4C0KA 5ALRA 5K09A 4CM8B 4J7AA 2JFNA 3LL4A 3SDSA 2CXSA 1E94E 1P2UA 5ALLA 2P75A 1Z17A 2DQZA 4QTUB 3U40A 3VPHA 2OGWA 3AR9A 1JR3A 3MD9A 3L41A 1JEOA 1LI4A 1PJBA 1QH8B 1WMDA 4RO0A 1PJ2A 4F4CA 4Z4IA 2ZSUA 2QTLA 5KTNA 2IC5A 3N8GA 2F3QA 2YWBA 1XUOA 2QY6A 2W6ID 4PX5A 4Z99A 2PXCA 1TA0A 1D0SA 3OQHA 4A26A 3B6ZA 5AVUA 4I4LA 4PVCA 3QKRA 5GOZA 1XMPA 2DFNA 1QH8A 2BF4A 1EM8B 3JATA 1XE3A 2C84A 3D0KA 4OL0A 3LCCA 4JLAA 3K0FA 3FGOA 2ODBA 3CW9A 4OA5A 4PPGA 2FH5B 2O3RA 4M7RA 1YKSA 1RJFA 1SPBS 2C97A 2Y1GA 3T4XA 2CXUA 3O8OA 5BURA 3ZDDA 1GZHB 1NMZA 1OX4A 2QE7A 3AIKA 5LOVA 2ZZKA 1CDDA 4GPTA 4D4IA 4EJ2A 1BC5A 4G4IA 421PA 3S8YA 1URPA 3GWZA 1KIMA 3E22B 4X9XA 5HYVA 1ZXXA 3GV0A 3JX9A 3HN7A 5BW5A 6GPBA 1GAQA 2CMGA 1I7SB 1MTZA 1QB7A 1SWWA 3QVMA 2VT6A 4OHKA 5TR9A 1C3JA 2W2LD 3JQ7B 2PS1A 3KZXA 1U5BA 1QK3A 3AEKA 3M82A 4HDCA 4Q6WA 2H2DA 5DX0A 5DOVA 5EJ9A 4NH4A 4A0SA 4B3FX 2V0NA 3COPA 4F3NA 3W5IA 1G3MA 5JXIA 1JV2B 1YI1A 4IZ6A 1OTYA 3W1EA 5IJWA 4HI0E 5MN5A 1ZBQA 4JI2B 2HCTA 3BQ9A 3DO8A 4XIIA 3UA4A 3C8DA 3GZNB 4GZ6A 4JBWA 1R8QA 3W9UA 4AJLA 3SBEA 1XGKA 3QQ5A 1DARA 1SY7A 4QYIA 1G20A 3SX4A 4O63O 4J91A 4AS2A 4YXWD 2IHTA 1DG3A 1OT5A 3CPSA 5JNVA 1QHEA 2I66A 4C2UA 2HA3A 2YW9A 4KL8S 1IJBA 1NJ5A 1UZAA 1QONA 2ZTMA 3IUEA 4IS3A 3U49A 5K0SA 3L0OA 3IPCA 4BVBA 1JAXA 3FYSA 1DBQA 3K92A 4PQGA 1MX3A 1XYVA 2A0KA 3G0BA 3KSDO 1W30A 4UJ3A 3TF5A 5FL7D 3S8EA 3H04A 1XDUA 4IOLA 1PJ3A 5BPHA 3WZMA 4KQIA 1VJRA 4D3XA 5CFQA 3V2HA 2CD7A 2Y76A 2V0GA 1V6SA 1B6TA 1E5XA 3HV0A 2CUZA 3D1LA 1EVZA 1M6HA 1RRPA 4OHYA 3LH5A 3KQWA 4B74A 1PUXA 3FE2A 2AZDA 2J33A 4FIDA 3ZOKA 1E1LA 1GA4A 1X7YA 1UDXA 3AKCA 2O5RA 2O8DB 1YFKA 4RW0A 4ZEOA 2Z2JA 3K1YA 2J85A 3ZY6A 2OFFA 4FDMA 3ESYA 4AS1A 1O5TA 3R9WA 5I8PA 1GPNA 4FEGA 4KQ9A 2JLWA 2DQSA 1E1YA 1LKZA 4CKEA 4M0UA 1PHPA 2DUNA 1JR4A 2F3TA 2OTCA 3QXGA 4FE3A 1THZA 2DH5A 1L8OA 1VFNA 3EGWA 3K72B 3TINA 3H75A 5DN6A 3EBPA 3P2EA 3P0IA 3ZGOA 4IZOA 3OF3A 4K9LA 1K7CA 1LLFA 2X1MA 3C4JA 4BBZA 4DCGA 1PTKA 2CWDA 2JI6A 5EGNA 4XUGB 5B55A 5K4GA 5KTSA 1Z4LA 3G7SA 1RC8A 1Y7IA 3D54D 2EDCA 2ZU0C 3C7CB 1U7WA 3AM1A 4AJKA 2GCEA 2PTHA 5JSHA 1QIHA 3GN1A 4FM9A 2A3NA 3CPJB 3GRYA 4XIGS 5KOJB 5ENDA 2AG5A 7GPBA 1DAOA 1G8PA 1R88A 1YDFA 3LUKA 4DBZA 4LWPA 3V4OA 2AJDA 5TS2A 2PN1A 1SUSA 2B1RA 3FNHA 3KOUA 5DK6A 4D0RA 3WGZA 3H8SA 2A78A 3NHMA 4PCAA 5G4LA 4RQBA 3SJCA 3BX1A 3FYTA 3ZQUA 2ZE5A 1G7RA 1NIPA 4DADA 2OXEA 4N12A 4ECEA 2JNWA 4BO3A 2HADA 5ALXA 2O7QA 4URWR 2UYGA 4P4UA 2AX3A 1CDOA 5EHNA 3SC2B 1W8IA 2J6IA 1REQB 1OXMA 2ZK7A 4UNNA 1PUJA 1OU0A 1W2WB 3Q8WA 4RKQA 3ZI4A 4C5BA 4AKHA 1HMYA 4BFXA 4MA0A 4MQ5A 4PRZA 5CU7A 1UFRA 1DJPA 3ER6A 2RHOA 1SRRA 3GEEA 5AR1A 3GQBB 2H1HA 3S2YA 1Z28A 5DEOA 2QM3A 3OE4A 4GIBA 1GRQA 3H2YA 2HSGA 3I37X 4PIVA 4NVRA 4M22A 1KI8A 4ZI7F 1JEEA 4RUKA 2HQBA 2ZYHA 3HV2A 1GGMA 1T6YA 4GPAA 4U2FA 5LNK6 3OIGA 3W6ZA 3ENKA 1EGHA 2I3GA 4PX3A 4N5LA 1M54A 3LL7A 4PZEA 5AJYA 4B0PA 1L3CA 1C0EA 1O9HA 2QTMA 1XVLA 4YT8A 1VLVA 2WD9A 4NMMA 4LSMA 3UQYS 1JG1A 3DVQX 1FX1A 1HT2E 1KEVA 3M6IA 4L51A 4P4SB 3SZUA 3WK8A 3COJA 3A06A 3PWZA 3VX4A 4MWOA 5FUYA 2EP8A 4H4EA 3FLEA 2WKSA 2OO7A 2HZBA 4TXHA 4L0MA 3V42A 5KNCD 2IPXA 1SWVA 4OU5A 1ISHA 2CUKA 2IYZA 2P2LA 2X0RA 3PJDA 3KYDB 4NHEA 4PO3X 4OBBA 3RSFA 3O9ZA 2AFIE 2FWBA 2J45A 3T4UA 5I9TA 1H6CA 3LF2A 2V8OA 2FZKA 1XMOB 1N36B 3FD8A 1JL3A 3PXBA 2R751 4KO1S 3DLPX 4EGAA 4F84A 4MGYR 4Z6KA 3K3PA 1YR7A 2O05A 3GMDA 3URKA 3VGPA 3PHBE 3R9XA 1P19A 4RF2A 3HM9A 3PGMA 3VA7A 3AUJB 3PXAA 4LECA 1KP9A 4XD2A 5DRYA 4EECA 1Q16A 1ZWLA 1OCEA 1B4DA 1WP9A 2D1FA 1TC1A 2GK6A 2I34A 3AEZA 3CLHA 4WVFA 4D8VA 4D82A 2CJPA 4AMBA 3I62A 3RJTA 2QX7A 1E0KA 1VMEA 3R9XB 4X71A 4YRLA 1CJKC 2ZRQA 3CKMA 3JVUA 4Q4CA 2FQQA 2FWJA 1OWLA 2A0UA 3HM2A 2ASVA 3QELA 4GHWA 4JQOA 4ZVRA 4F2GA 5CVTA 2FF5A 3AHFA 3L8DA 1NW3A 3ICVA 4ZZ3A 3O3NB 5EJIA 3K9WA 4AQDA 4R2XA 3W2GA 1XRSB 1R6UA 3F98A 4X93A 4HEQA 4NS4A 3OIUA 3DF7A 4CTJA 5EMJA 3VKHA 2I67A 1AXGA 2R1TA 1LTKA 2NSYA 4S2UA 4TZTA 5BNFA 3QTLA 1XYGA 4JJ4A 4IICA 1IIBA 3INNA 1PE0A 2UUAB 5T3UA 4C4RA 2P35A 5CNJA 5AMXA 3OI7A 3ADKA 5D84A 4QTXA 2WE7A 2WSSD 3HP1A 3AF4A 2NPFA 1DRUA 4LJ5A 3FWKA 3T52A 3OUZA 4EEXA 4DGSA 2O3SA 5JJCA 2PZKA 4KIJA 3A3PA 3WBKA 3MINA 1K8ZB 2BGMA 4PZ0A 1EI9A 1F60A 3U7GA 3FMVA 1EKXA 4U00A 1XEXB 4UE6A 4BNKA 5A62A 1GU7A 1KVSA 1M1YA 4F97A 1IG0A 4JP8A 2F1JA 1D6MA 2Y1KA 4UHBA 3QSYA 2DR2A 4XIYA 2JAHA 3EH1A 5DBHX 4PBTA 4A03A 1XROA 2VTKA 3H5RA 4K6MA 4DLWA 4HVLA 1NF3A 3Q7SA 1C50A 4U2GA 1UINA 1E79D 5TV2A 1E6MA 1UQTA 3LP8A 1D0IA 2VP2A 3N2EA 4J43A 3GEMA 3OLQA 4JHLA 5CUQA 5EJ2A 3WGOA 5K6AA 5K3EA 3DMTA 3OCZA 5KVAA 2Z2ZA 2Z4SA 4LISA 4BWVA 2VTBA 1NA5A 3RQIA 4NC9A 1SQ5A 1H8EA 3G0OA 4OY3A 1OFTA 2YMPA 4LYJA 4XVQA 5CITA 3C5CA 4C9BA 4POOA 1RJ9A 2R8BA 1Y3FE 1QRTA 1UWVA 4NCXA 4M9QA 4TZ6A 4ALIA 3GO4A 2RGDA 3D7KA 3IELA 3JASB 5E3IA 2XT6A 2JJ2D 2BHSA 3NHJA 4X8HA 3U1TA 1A9TA 5DNWA 3DNMA 3LJKA 2YBDA 3V9AA 2ZUFA 4ARZA 4C0BA 5BQFA 2HK6A 3GNTA 1D4OA 2J5KA 3ZGVA 4YLGA 1SK9A 4OVKA 2ZETA 4MRAA 2XCSB 1J0CA 1EBUA 2RIRA 4LVCA 4CIDA 4DLZA 3QLEA 2RGEA 3LLCA 3HCCA 3T3GA 1CUUA 3VPCA 4IHJA 2FSSA