2XVMA

Crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sah
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
AMVIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDRQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWERVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TELLURITE RESISTANCE PROTEIN TEHB
publication title Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.1.1.265: Tellurite methyltransferase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2xvmA00
3BKXA 9MHTA 2ONZA 1JQDA 1WY7A 4YMHA 5LQUA 1N2XA 1O54A 4DM3A 5GM2A 2YXEA 3Q87B 3UJDA 3THRA 4GQBA 4YUZA 5K8VA 5KS2A 2AOXA 4AZVA 4LWOA 1XDZA 5ICCA 4Z2YA 1QANA 4X61A 3EVDA 2EX4A 4ER3A 1XCLA 2GH1A 2YVLA 3LSTA 3U81A 2VP3A 4P7KA 2AOUA 2BR3A 1X1AA 3I53A 3LBFA 2VZ9A 1EAMA 3C3PA 4P7JA 4WVLA 1VLMA 3C6MA 1XTPA 4GUAA 4QVGA 5BXYA 3MTEA 2JH8A 1EJ6A 1KHHA 2I6GA 3E8SA 4YV1A 2NP6A 4GOND 2I7CA 4XCXA 3T7RA 3GRUA 4C05A 5FA8A 4OQDA 2P3LA 3I9FA 3KQQA 3FPEA 4WXHA 4RTOA 5EKXA 4F84A 2HR1A 2PXCA 2FK8A 2VS1A 1EQAA 5JUWA 1EJ0A 1AQJA 4U7PB 4PYQA 5DXJA 2G70A 5E8RA 3SSOA 2I9KA 5DSTA 2QM3A 5DX8A 4YV0A 4M7RA 5HZMA 4QTTB 1JSXA 3R3HA 4X63A 1NW8A 1X1DA 3R6TA 4Y30A 3FTCA 5CUQA 4YUVA 4EQZA 1VE3A 3SR4A 2ZIGA 3HCFA 3KQYA 5FHQA 4E32A 3E7PA 3P9KA 4LECA 3DMFA 5E9JA 1JQEA 4DCMA 3ELUA 1UFKA 2P8JA 2C7OA 5GIPE 5EKUA 3CVOA 1INLA 3ELDA 1JQ3A 5DX0A 1JTEA 3M4XA 4PCAA 2Z6QA 1YZHA 2F8LA 3TRKA 5EMJA 1R6AA 3BGIA 1YF3A 3FPJA 2C7PA 3EGIA 1BC5A 2WA2A 2EFJA 3KQSA 3EEYA 2ZSUA 3NW9A 3EEOA 3IYLW 3KQWA 1NW6A 4RVGA 2Y1WA 1VQ1A 1RI4A 5CVVA 3FUTA 1JTFA 2ZVJA 2PX8A 3HVJA 1XXLA 4GOMD 4FSXA 3UA4A 3GRRA 2N47A 4C4AA 3EVZA 3EVGA 3JWIA 3FUUA 1VPTA 3TM5A 3P2IA 2ORED 4FS8A 5E1OA 5DLYA 1FP1D 4KIFA 2XYVA 5K01A 1ZGAA 3R0QA 2P3QA 3HCAA 3TR6A 5K0FA 1V39A 3C6KA 2PWPA 2NXJA 1L3CA 5EEHA 1KYWA 10MHA 2ZBQA 4KVZA 4PYOA 5E1MA 4FP9A 4RTPA 3DP7A 3KR1A 4C07A 3TM4A 4EKGA 3SMQA 4YUYA 3NDJA 1NV9A 2FK7A 2Z6UA 3OU2A 3LCUA 2CWWA 4PYLA 3GRZA 4QPPA 3UJ9A 4X1OA 3E05A 3E23A 5FA5A 3HCDA 5CVEA 1XCJA 4ATNA 2NXCA 2P41A 3FPFA 3V8VA 3BZBA 4F85A 3I5UA 5HOQA 2B3TA 3TOSA 1KYZA 1RI5A 2PJDA 2YTZA 3CJTA 3BT7A 3O31A 2FRXA 4K6MA 1L1EA 3GO4A 5FTWA 3SSMA 1BOOA 3JWJA 3DR5A 2FPOA 3SXJA 5CCXA 3X0DA 2HNKA 2PT9A 3CJQA 3M70A 4PINA 5EZSA 3TKYA 3CC8A 5IKMA 3KKZA 1F38A 2PSSA 3SGLA 4IV8A 2BM9A 3PLAE 5T64A 5GP1A 1MHTA 2HMYB 3FPGA 1B42A 3NDIA 3BXOA 3P71T 3T7TA 3UA3A 2O06A 3GNLA 2PX4A 4MQ4A 3BWBA 2H00A 1NBIA 5HEKA 4DQ0A 1ORHA 1N7IA 2UYOA 3HTXA 2O05A 3KU1A 4PGGA 4DMGA 1SVUA 1QAQA 5FUBA 3AXSA 4ISCA 5FQNA 1T43A 5EEGA 5KQRA 3UBTA 1L9KA 2R3SA 5BP7A 5HIMA 1I4WA 1AV6A 3M6WA 5ICGA 2ESRA 1M6YA 5LQJA 1YB2A 2O07A 3KR0A 2B25A 2P3OA 3T0IA 1KXZA 3B7PA 1X1CA 2GPYA 2JHPA 4M36A 2Z6AA 2XBMA 4PCLA 4E2YA 4KIGA 4P7FA 2OY0A 4RWZA 3UZUA 4RTKA 5B1SA 3TLJA 1IXKA 4AZTA 1I1NA 4C03A 4V0QA 2FHPA 1KIAA 1YUBA 3IV6A 3OFKA 3HCCA 4PGHA 4QPNA 5EVJA 4DCGA 2PBFA 1MJFA 4RV9A 5LQAA 2CMGA 2BR4A 3BWMA 3C0KA 1ZKDA 3DMHA 3LGAA 5U4XA 1TW3A 3MQ2A 1DCTA 3GCZA 1XJ5A 3DOUA 2PXXA 3DXXA 1RJGA 1NV8A 2AN5A 3A7EA 3P97A 5E2AA 3K6RA 3NJRA 5EIWA 4V0RA 4PIMA 2ZWAA 1UIRA 2R6ZA 1P39A 5DT2A 2PY6A 4RTQA 2ZCJA 3HP7A 3EMBA 3LKDA 2YXLA 4HGYA 2Q41A 3G2QA 3TPZA 5FULA 3RODA 5GWXA 5C0OE 3Q7EA 3UJBA 2ZZNA 4HG2A 4MIKA 2XYQA 3NVKI 2XYRA 5K0NA 2I62A 2IBTA 1EG2A 4E30A 5LQCA 3EVBA 3C3YA 3OU6A 3KR9A 2HV9A 3LDUA 2QYOA 3UJ6A 3R9XB 2GB4A 3BKWA 2PT6A 1QZZA 2CL5A 5DX1A 1I9GA 2AOWA 2BR5A 1QYRA 4HRAA 4RTLA 4IWNA 5DSXA 4BLUA 3B5IA 3ME5A 5ERGB 2VDUE 2YX1A 4MWZA 4BP1A 3CBGA 4PIPA 4R6XA 5E1BA 3A26A 3KHKA 2ZULA 1ZHFA 3OZTA 1FBNA 1ORIA 3B89A 3A7DA 3LPMA 4GBED 4M37A 5DWQA 2B78A 2BM8A 2PGXA 4AZSA 2FYTA 1U2ZA 5DM1A 3MB5A 1NW7A 4FR0A 2ZWVA 4HSGA 1M6EX 2NYUA 7MHTA 4QDJA 4ER6A 2BH2A 1KPHA 1VP9A 1QAMA 3P9CA 5K0CA 3EVCA 3LX6A 2PX2A 2P7IA 5GIOE 2IP2A 4Y2HA 2C7RA 4IKPA 1WZNA 3ER9A 3L8DA 1PJZA 1JG2A 1NE2A 4ER0A 5E9QA 1UWVA 3B3GA 2IBSA 2PLWA 1R74A 1R18A 4EMSA 2IFTA 3REOA 3RW9A 3G5LA 3FUVA 3VC1A 2IDKA 1M0EA 3OE5A 2IH2A 1OR8A 3PVCA 4O29A 1D2CA 4RTNA 2OPBA 3D2LA 4HGZA 4KW7A 2OB1A 5T67A 4DKJA 3DULA 1SQGA 5FADA 3IEIA 3P2KA 2GA9A 2O0LA 3GDHA 5EMKA 3QOXA 3THSA 3OZRA 2IIPA 2G71A 3SX0A 4BLWA 3BWCA 1G6Q1 3DTNA 3KPWA 5K0LA 3OE4A 5EMLA 3HCEA 3FRIA 5CCBA 3HCBA 5HIKA 2GS9A 3PX3A 3HA5A 3FUXA 5KYGA 5GINE 2JJQA 4PYIA 4R05A 3MHTA 3VSEA 2AOTB 2O57A 3LL7A 2QRVB 4GC5A 1XDUA 3TQSA 1IY9A 1WXWA 8MHTA 3P9NA 3OU7A 5JR3A 2FCAA 3EGEA 4QQKA 4BY9E 1AQIA 3LECA 4QDKA 2HWKA 3GXOA 3GU3A 2OYRA 3CKKA 2G72A 3JWHA 2ZZKA 4FZVA 1R8YA 3FTDA 1JSZA 4RYLA 3EVEA 3G2OA 3F4KA 3TKAA 1R8XA 4E2WA 1KR5A 3MCZA 4UOEA 2AZTA 5K0EA 4RTJA 4NECA 1RJDA 4RVDA 4MHTA 3FTFA 3ER8A 3P8ZA 5D1HA 4RTSA 3DUWA 2HTEA 4CXMA 3IHTA 3FTEA 2EJUA 3KQVA 2K4MA 5HIIA 2OBFA 2XVAA 1ZGJA 3UWPA 4ER7A 2QRVA 2NNWB 2PWYA 2OXTA 2JG3A 1VBFA 2PV0A 4POOA 3LKZA 3HM2A 2GAFA 4OBXA 5K0JA 4AUKA 4CKEA 1NW5A 3RIEA 2ZW9A 3MCTA 4AX8A 3G8AA 5E2BA 2CMHA 4EK9A 4CKCA 3GGDA 4DF3A 1Y8CA 4C08A 3WSTA 3I64A 3FYCA 5LQKA 2YXDA 4YUXA 1WXXA 2WK1A 1JG3A 3ORHA 5GOZA 2UYCA 4QTUB 3HNRA 3PFHA 3KPYA 3GWZA 2OZVA 4BP3A 3MTIA 2DULA 4ER5A 1JG4A 4F86A 5K0GA 3B3JA 2WA1A 3OPNA 2OB2A 2AS0A 2A14A 4X60A 3EVFA 4RTMA 2KW5A 2AR0A 5CM2Z 1KPGA 2VDWA 2OKCA 2P1DA 2YR0A 4YV2A 4HTFA 1ZQ9A 5BW4A 5F2KA 3UJCA 4R6WA 3NMUF 5DTMA 1BKYA 3SSNA 3KPVA 3UJAA 1G55A 3G7UA 4E70A 1G8SA 1FJXA 3HVKA 3AXTA 4GOOD 5DM0A 2EJTA 3GRVA 4CWAA 1DUSA 3G88A 1BHJA 3HVIA 4RX1A 2AOTA 1Q0TA 3EVAA 1JG1A 3B3FA 4XUDA 5K0BA 2NP7A 2ZZMA 4LWPA 4ZTBA 3S68A 4EVIA 1L3IA 4FGZA 1VL5A 1XVAA 2QE6A 4H0NA 2ZLBA 5H02A 1FP2A 4GC9A 3KPUA 3OCJA 4CTJA 5C9ZA 4C04A 2AVDA 4OBWA 4FT2A 4OX9Y 5K05A 3AY0A 2H11A 2ZBPA 1P1BA 3PB3A 2UYHA 1RI1A 3LDGA 1TPYA 1RJEA 5FCDA 3CJRA 5ICFA 3P9IA 2IGTA 2ERCA 1D2GA 2PVCA 3PX2A 3M33A 2GLUA 2ZIEA 5DXAA 5FQOA 4B17A 4C06A 1PRYA 5HFJA 2LD4A 5DTRA 5HIJA 3P2EA 2JHAA 3PS9A 2PX5A 5T6BA 3VYWA 2IH4A 4P58A 2VDVE 3TFWA 2ZFUA 3QV2A 5CVDA 5LSAA 4IV0A 5EZQA 3MGGA 2Y1XA 1VP3A 3DXZA 5CVUA 4GF5A 4U7TB 5DPMA 3CCFA 3JWGA 2ZBRA 5EHGA 1YFLA 4R8SA 4E31A 4R8RA 3BGVA 2B9EA 4YUWA 2PKWA 2G1PA 5KVAA 4PYNA 5DM4A 4LG1A 3LCCA 3A4TA 1SKMA 3GRYA 4QQNA 3G2PA 1SUSA 3PT9A 5CD1A 3G8BA 3M6XA 1ZG3A 2YQZA 4CKBA 4YMGA 1XDSA 4GOLD 1WS6A 2AN3A 2UZ4A 1Q0SA 1RJFA 1NKVA 1R00A 3EGVA 3FPHA 4KRGA 5EIFA 5FWAA 1KPIA 4RSRA 5GM1A 5EC8A 3BGDA 3UJ8A 1H1DA 3FRHA 5EGSA 1AF7A 5EMMA 3ERCA 3SM3A 2AOVA 2ZIFA 2ZTHA 4PYJA 1JR4A 3AJDA 1P91A 5EOVA 1SG9A 2ONYA 4CTKA 5LQRA 3DMGA 5ICEA 1TW2A 3G89A 5EHIA 4E2XA 3BWYA 3EMDA 4HH4A 3MERA 2NXNA 2IH5A 3LCVB 1SUIA 4FT4A 1X19A 3G5TA 3HVHA 5CIYA 1RI2A 3NTVA 3T7SA 4M38A 5FHRA 3O4FA 2BZGA 4E2ZA 1F3LA 1HMYA 4DA4A 2XVMA 2EG5A 2P35A 3O7WA 1NT2A 3OFJA 5G02A 5LR6A 4KDCA 3ELWA 3TMAA 2CKDA 1SQFA 1VIDA 2DPMA 4PYKA 1WG8A 4A6EA 2UYQA 2V7EA 3HA3A 3KQMA 2PXAA 5FWDA 5EG5A 5K09A 2H1RA 3FUWA 1G60A 5DM2A 3PTAA 2NXEA 4JXJA 3ELYA 2QY6A 4PONA 1DL5A 5BW5A 2AVNA 3KQOA 2P40A 4HC4A 3DLCA 1G8AA 3NWBA 4QVKA 1P1CA 3VC2A 3KQTA 1YFJA 5E1DA 3KR2A 1G38A 3HA7A 4OA5A 5P8WA 2V74B 3R24A 5LQNA 3EPPA 5F2OA 2B2CA 4FSDA 1KP9A 3UJ7A 3LHDA 1RI3A 3NWEA 5F2NA 1IM8A 3BUSA 2P7HA 4OQEA 5EPEA 5KQSA 3PFGA 1O9HA 2JH9A 4L7VA 2E5WA 4RVFA 5EQJB 3V97A 3FZGA 1QAOA 3A25A 4EKIA 1Z3CA 3MAGA 3LBYA 3K0BA 4G56A 5C1IA 3DXYA 3LDFA 4KDRA 5IH3A 3A27A 5D1NA 4P7GA 4XUCA 5DTQA 4DZRA 2C7QA 1YZ3A 2IPXA 1O9GA 4RTRA 4PWYA 3HEMA 5K03A 3H2BA 4A6DA 3SVZA 2IDJA 3FYDA 3M6VA 3G2MA 2G8NA 3DLIA 1FPQA 4MTLA 1NBHA 5DRTA 5M5BA 1HNNA 2JHCA 5CVJA 3ID6C 1X1BA 1N7JA 4HTFB 3ANXA 4E33A 4PYMA 5MHTA 4PNEA 3UFBA 1D2HA 3DH0A 2OO3A 1NW3A 2AN4A 4GEKA 2AOUB 3AWIA 3CGGA 3GIWA 4X41A 2ADMA 3NVMB 5DRYA 5HILA 4BLVA 3M6UA 3GJYA 4XUEA 5E9WA 1L3BA 2YUIA 5E8JA 1EIZA 3QOWA 4RVHA 4AZWA 3OZSA 4KWCA 4OA8A 3KQPA 3KPJA 3I58A
chains in the Genus database with same CATH superfamily
1ZN2A 2FWIA 4CI0B 3DJYA 2QV0A 2XTNA 4LDQA 3NBXX 1F8FA 1T8PA 3D8UA 4AU1A 4HJXA 4B8YA 1JWLA 4B3GA 2GD6A 2ZAIA 4E13A 4FFOA 4GQBA 4ZEWA 2GN0A 4MW4A 1CV2A 4X94A 5KAPA 1U7HA 3FZYA 4DQDA 2DCUA 5IWAB 1FYDA 2OLJA 5E6RA 5EWJA 1K8QA 4FYWA 3OHPA 4DCVA 4C4TA 3OQNA 1AUOA 1NQUA 4Y1RB 4QBHA 2H5LA 3W90A 7ADHA 4KQCA 2CFIA 1MABA 5C31A 3EAQA 4Q21A 1TUBB 1WTAA 3SOPA 2YQ4A 1WW3A 2FZKA 3A9UA 4E3WA 1K86A 1VPWA 3D6JA 2FW8A 3KRTA 2GA8A 3O83A 4BO2A 3OZBA 3HKBB 1Z0AA 1E2JA 1H9BA 1YUMA 2HIMA 4D9KA 4XCXA 2O20A 2WNHA 3E2PA 1Z4IA 1NVFA 1CY0A 1VMDA 3ZD6A 1Z5WA 3FPEA 1BXZA 5E0KB 2BONA 3V4VB 3WO1A 4RY2A 2CUTA 5FDFA 4FIDA 4IMJB 4K9MA 4FB4A 1DLIA 1GLNA 2CEAA 2REQB 3QTBA 5DXJA 4ASUD 4B4WA 2G70A 3VOBA 5I47A 5CB8A 3K0FB 3SSOA 5ED4A 3JD3A 5DSTA 2OWEA 3FR7A 4EG0A 3LWZA 4D5EA 4KJXA 5LMCA 2C5EA 4FYKA 3LP5A 3SZRA 1IAVA 3KQYA 1YK1A 4N5NA 4MYRA 5FHQA 3GFTA 3RVPA 4B32A 1AV7A 1QZ3A 5AQ1A 5AVUA 3FRJA 1JA0A 2O2XA 4JJFA 3DLTA 3CVOA 2P5SA 5LZ8A 3BIOA 1GDTA 1R12A 3EIEA 1GCUA 1NI4B 1VRWA 2ZU0C 1CJMA 3FJ1A 2YJ5A 3C2QA 4AIIA 1ADGA 4CQMD 1IWOA 1TRHA 4NEQA 4GKJB 1WF3A 5D00A 1KAEA 1WDMA 1YQEA 4PBRA 2Q4EA 3BGWA 4N6NA 1SIWA 3H5TA 2QL6A 2IPOA 3LVQE 4IOMA 3QOFA 4B6RA 2HK9A 4B5KA 2OWDA 2LP4Y 3DV0A 3SFTA 2V0GA 1ZD1A 1O8CA 1G98A 1GPAA 3TQQA 2HMVA 4ZCPA 1LSSA 2BF7A 5LJIA 3PSHA 4URFA 2QU8A 2HRZA 4MJ7A 1YIDA 3L05A 2IWRA 1M0WA 4RVNA 2ORED 2WUDA 3CBQA 3HB1A 4KIFA 1AQLA 1ZGAA 2B4QA 1GQRA 3MRTA 5BRJA 3ZR4B 4QXQA 3U4MA 1TU0A 1NZDA 3NTOA 5AXCA 3VVMA 2NWQA 5EE0A 5FORA 3VTFA 4F3KA 1D0SA 4IIJF 1GL6A 1R4ZA 2HBZA 2O2CA 3DYIA 3BA1A 4IWYA 1EEXB 2M6KA 1E0DA 1XQXA 3A9WA 3IO5A 4QULA 4WY8A 5BVHB 2JAUA 1OX6A 2IYXA 4M2LA 2QF7A 5BVGB 3M1YA 1OC2A 4PQRA 4CG1A 3HVUA 3VR3A 3JAKA 3CPJB 2I6SA 3IBCA 3TOSA 1CS4C 2ODQA 4MMZB 4ACBA 2NUAA 1KMNA 3CJTA 1NM5C 3ZQKA 2QL5A 3OT5A 4Y3UA 2JLAA 4E2FA 1SWVA 5P21A 3VZCA 4BMOB 8GPBA 5KYUB 3L7IA 1QP8A 4A2CA 5AD1A 2JGAA 3ZDFA 5AJHA 1SUPA 3DEJA 4B81A 1DC6A 1PR0A 3H1TA 1FFEA 5GGXA 3TLCA 5CBKA 1OASA 4PLWA 4D6YA 3EZ9A 4RK1A 3FCEA 4TLCA 1ULBA 3E5MA 1RJ9B 1UANA 4EAQA 3CCBA 3HJTA 3NDIA 1B42A 3P71T 4GZ6A 1R2QA 3GFBA 3N76A 5LMUB 3VKHA 2F64A 2DHEA 1NBIA 1RMQA 2JVJA 2JW5A 4RLHA 4E88A 4IKEA 1GFSA 3BVPA 2NZVG 2GKGA 1KYIA 3CISA 2FEMA 4WUTA 2FWNA 3AEYA 1NZFA 2HMWA 2IEBA 5EZ5A 2XR1A 3ZCSA 5AXBA 3O9VA 3PEEA 4W6ZA 3RPEA 2QP4A 3G2JA 2O0KA 2D5AA 3ZG6A 5FQNA 4B83A 2DUNA 2YZMA 1KJWA 1TM7E 4BO7A 3QEMA 1M6YA 1OV4A 1E6LA 1RAGA 5DF1A 1SELA 3SJAA 3LZCA 1CQJB 2Q45A 3SPXA 1O96A 1BOFA 4TZ0A 3LNCA 3WIDA 1XLTA 1Z0UA 4G4SP 4V0QA 1NVDA 3QM1A 3B9BA 3IV6A 4RXUA 3PVZA 3OZAA 2H29A 3X1DA 4D79A 4YY3B 2PGAA 4RV9A 3PQFA 1NDUA 1OA1A 4KG7A 2X1VA 2LXNA 4ZHQF 3N28A 3R7SA 1XJ5A 2IYUA 5LKRA 3ZDXB 2K7ZA 1QS0A 3A7EA 1YCGA 5H82A 4L5IA 3KKQA 1YQXA 1QYCA 1QKJA 2RHCA 5K8LA 4LYJA 3EZ7A 3VNRA 2I65A 5EJ6A 1O08A 4DT1A 3K1JA 2ZJ0A 2PXHA 3D02A 3B1WA 1H4VB 1KH1A 3I8OA 3ZQ6A 2H57A 3RBXA 4GI1A 3WI7A 1F2DA 2YXLA 1C50A 3HJFA 2BIFA 5GWXA 3Q7EA 4P0PB 1TF5A 1Q50A 4LQ4A 3JQEA 1RZVA 5TX7A 2GO7A 2OD9A 2NO0A 2QLJA 2ZRKA 3E7WA 2AD5A 3H0CA 4HPXB 5LQCA 1IM5A 3KHUA 4C4PA 2QYOA 2XDYA 4EJMA 3FX2A 4F9GA 5KOYA 2P78A 4ZVOA 3GJQA 3GG2A 3T5GA 4AS1A 3OCWA 4FZJA 1IJKA 4II3A 2NO9A 1AGPA 3LNTA 4BLUA 4LY9A 5IJAA 3I5AA 3WMEA 3Q88A 1P0MA 2D1RA 4HEHA 4MIOA 4Q03A 3WP0A 4EL0A 1PFKA 1Z12A 1ZHFA 3OWOA 4E1AA 4M37A 2XBUA 1GPUA 1ZM2A 2VYNA 1NUHA 3BH7A 3HYTA 1U2ZA 3Q9NA 1T2UA 4QOFA 3Q3CA 2OL4A 2GEUA 4REMA 1AO0A 4JT2A 1OKKD 1DHTA 1FDRA 4Q3AA 1CQIB 3I9OA 5AOAA 1QK4A 4HXYA 4AJPA 4BO5A 5JZMA 4KZKA 2EJBA 3VNBA 4B85A 1YE3A 2VPXA 1DAPA 5I01A 1YASA 3K9WA 1XZBA 3K4HA 3BAFA 1JDJA 2DFVA 1CQZA 2G09A 1P8JA 5J4KA 4U63A 2UDPA 1A8QA 4LMBA 1AZTA 4JBHA 4X6XA 4U2GA 3WYFA 4HWOA 2OB1A 4Z0PA 5G4LA 5GONA 4MQEA 1P4HA 1EBUA 4IGFA 1IZYA 3RFVA 4EVSA 3BS4A 3EXG2 3NT2A 1E6UA 2TS1A 4RDXA 1PK8A 3ABIA 2JFXA 3KVYA 2XKKA 2PRKA 4OU5A 4BFWA 2GS9A 3UC9A 3U3RA 2Q2VA 4ZYUA 1HFKA 4Q9AA 4MKIA 1V5EA 2D62A 2X0FA 1ZOOA 5K51A 2BBOA 2IIQA 1SGWA 3VDQA 3SEZA 3B1XA 2HA6A 1U5BB 2VJMA 3F3SA 2I71A 4ND2A 1MKYA 1OLUA 4TYYA 2BFFB 4IVNA 2Y0CA 4TV9A 4B2PA 2QY9A 2Z2YA 3DHVA 3GXOA 4KIJA 5L3QB 3FDFA 2VP5A 1P80A 4ID3A 5IU6A 4HHEA 1LTKA 3BC1A 5CXUA 4MVJH 2NXWA 3LWDA 1OE0A 3CSDA 5IEBA 3H16A 3LHSA 4NXMB 4A1OA 4TN1A 1E7RA 1C3OB 4WOJA 3CM0A 3V46A 3P8ZA 2BEWB 1D3AA 5CLLA 2YWGA 3VZBA 1K7SN 1YIAA 3H4TA 4N0QA 3TVDA 2FMKA 1ADBA 1P7ZA 2WU3A 3BM5A 4Q7LA 1PU2A 1V8FA 3TZKA 2BGRA 4RF5A 4CCWA 2WNSA 1TTQB 4MUGA 1CNMA 1AZSC 1LB1B 3WSWA 3QU4A 2R4QA 2FKAA 4MQMA 3OTHA 1QZUA 1W6RA 2B61A 4RACA 1GZ4A 1M0TA 4L8FA 4TLMB 3RT1A 3HM2A 1XLUA 2QOEA 2EFYA 2P68A 4OBXA 5FEMA 4AWBA 1Y1PA 4BYGA 4GMXA 4WZAA 5C1BA 4MI9A 3QA9A 3KWMA 3HWSA 2A94A 2X0NA 4QBFA 1AURA 1NUUA 1Z83A 1V8ZA 2XHEA 1K8XB 4RHTA 1IWPB 2G36A 1N2BA 4KQ9A 2WK1A 2HDHA 4TM7A 2QR3A 4IJQA 3QU5A 4RPIA 1NBOA 1UBNA 3GR6A 2X14A 1XWWA 3W6OA 1Y3DE 5K0GA 4JEIA 3VX4A 5I9NA 3KJIA 2CEKA 4HFRA 4AXBA 3ISJA 4QGHA 4FEYA 4JBYA 1NBMD 4B4VA 5CD9A 5EJ7A 4K86A 3C3EA 4EJSA 3W5DA 3AF0A 2GM4A 1ORVA 5EE1A 2WU0A 4PG4A 2XQKA 1UDXA 2LIVA 3OZCA 3FETA 1IFXA 4RH1A 3KUDA 1Z5VA 2KB0A 4WNAA 4E70A 3Q5EA 1BMTA 3S81A 1M8PA 3RADC 1D6NA 1E4VA 1V4BA 3JQ8B 3ZWQA 2IS2A 2RGDA 3W4KA 5HOEA 4JJAA 1XK7A 4HB2A 2X2FA 3T7CA 3IKMB 5LZ9A 1TM1E 1M2WA 4JKYA 4Q4HB 1AJEA 1LNQA 2YASA 4C4RA 3RSOA 1PNVA 4ZGGA 1ODKA 4JLWA 5DNEA 3GDOA 4C04A 4CMEA 1DQPA 3CONA 2RI0A 4YALA 2HUPA 5FCDA 3DBIA 5JJIA 5J43A 3SZLA 1NOIA 3KAKA 2G1UA 2O52A 1L9XA 1D2GA 1ZQ1A 2PVCA 2FN3A 1S96A 2W93A 4IZIA 4RL4A 1W5EA 3BEOA 3R20A 1KBQA 2RAPA 4IM7A 1JHUA 5HIJA 4CLOA 3BHMA 3W6UA 1QX3A 3KYBA 3MJFA 3HKEA 4M86A 3VYWA 4LBVA 1X7ZA 5JI3E 3S2UA 4GL2A 4GP7A 4MOWA 1GNQA 3MAAC 3PC4A 1A7AA 2C31A 3I8XA 1NMZA 1DKRA 1OFUX 2ZBRA 4WEQA 4X7PA 1FX1A 2KBEA 3DE4X 1E98A 2HLNA 3D0RA 3WJ1A 5LLDA 4WGFA 2C2HA 1S2OA 3GZJA 2EL9A 3W05A 1HO3A 1JEYA 1WXIA 1E1CB 4FC6A 5JCJA 5EXXA 2HFJA 1IB0A 1ZG3A 3DFZA 4WNYA 4CKBA 1FPMA 1EDZA 3U31A 4XEUA 5I7WA 2AG5A 1Y1TA 1EFPA 5LOVF 1ENYA 2NZ8A 3EGDB 2OUIA 4EENA 4LZOA 2EEPA 1YACA 3D7MA 3RSLA 3C6XA 2PGLA 2WT9A 1X39A 1HDXA 1TCCA 3CNOA 3FOZA 4G36A 4JJ4A 5IYZA 2H7XA 2RH9B 3B1ZA 4B3HA 4NENB 1D1QA 1XZGA 4Z4EA 3CUTA 1X19A 4JNKA 1IBRA 1WPRA 3KVOA 4E2ZA 1F3LA 2FGKA 2LR0A 3KBBA 2H1VA 2QLLA 4H7IA 4QOJA 3C4JA 5ECGC 2NSDA 1L4KA 5AJZA 2R6CA 1CS0A 1N0HA 2GD1O 4J9UE 1CE8A 2AUNA 5FT9A 3E4CA 1NQ5A 2E82A 4OQ4A 4M0UA 2IODA 3L7CA 1IZ8A 1NR1A 2FPIA 2HLDD 2F62A 1IN1A 3NTUA 5LOVB 1D03A 3WBJA 3OD5A 4WH0A 1NE7A 5CFOA 3FUWA 4Q6WA 1VBKA 1Q20A 1EWRA 4GQAA 2Q0QA 3VHXB 1XRSB 2KM1A 3KTAA 5DE3A 3EG5A 4YRKA 3ZY2A 2FOXA 2J3LA 1XGKA 1UAYA 3IV9A 2ZS9A 3KQOA 4HC4A 2R6DA 3VR4A 4DCPA 1Z38A 3G7SA 5JMOA 1YDFA 1NUQA 3K0CA 3CU5A 3UKJA 4PX9A 4ZWNA 3FWYA 1RZ3A 1ENOA 3FOWA 4J49A 3NVAA 3UJ7A 1KORA 4ND8B 4HOYA 4JU8A 4TL7A 3ZXIA 3WG9A 2Q9BA 2QTAA 4QUDA 1T36A 3LF1A 2NUAB 4LF8B 4KE6A 3RAEC 4KGVA 5K0ZA 3PU6A 3D8TA 2WP0A 5DKFA 5TARA 1JT2A 3SAJA 1VTKA 1JKJB 4PVCA 5AIBA 9ATCA 3MAGA 2VF8A 2P90A 1WV1A 5KDDA 1HWYA 2YY5A 4OUKX 1P2DA 4X1YA 5IWCA 1RXEA 1J25A 5HUQA 2H59A 5JYEA 5CT6A 3ZDYB 4QJBA 2QRQA 5ER6A 4AJEA 5C7OO 5KTMA 4K3VA 4CF7A 1HBJA 4XARA 2H4WA 5BMVA 1N3LA 1RM4A 5L7YA 2GOYA 2IDJA 3MNFA 4FSHA 4Z9FA 4NJEB 3RTCA 2GFHA 3D43A 1HEUA 3PF9A 4PPYA 5BSWA 3I23A 4J29A 1G4HA 2JHCA 4GSYA 2B2XA 3Q40A 1J8FA 4D74A 4YCDA 1XPJA 2QVLA 2CKMA 3TRDA 1E66A 5IAJA 2B4TO 4QPJC 1RPJA 1D2HA 2OLKA 3IHLA 4GX1A 3S2EA 3UFBA 4A8PA 4AECA 2ADOA 2R5FA 1LBIA 3HEBA 4YRRA 2C99A 1MHPA 4N18A 3A2NA 3W9SA 2PK3A 4AP5A 2XQVA 4BX0A 1PS8A 2WYUA 1IB6A 5IX8A 4IIVA 1K3TA 4PTLA 2E4AA 3OI7A 2CY0A 4A9AA 4E15A 3L0SA 1Q7TA 4UMDA 3AVPA 3UGTA 3PI7A 1CY6A 5G0WA 5LQUA 2PLFA 1DS6A 4YTEA 1CXZA 1DC8A 2WAOA 2IA5A 2ZSFA 4M9CA 3TWOA 2PSEA 4GU5A 1B0PA 4HN2A 4YLEA 2AOXA 3SNKA 3HL0A 3FDIA 4QHYA 4CMAA 4DE5A 4I5FA 5ICCA 2C3YA 4LI3X 4WN3A 1JZTA 1U0RA 5E3JA 5E4YA 4KJZA 3PGKA 1ZUHA 3O9ZA 5EWMB 3D4NA 3BCSA 5IAEA 1DJQA 1T34A 4OYLA 1E32A 2GN1A 5ESDA 2CVZA 2Y6UA 2ZXUA 2W42A 5GY7A 1JAHA 3DEIA 3FR8A 1HQYE 3HB4X 5JS6A 1PD1A 1KDVA 2FPPA 1KHHA 4MW0A 2BKEA 1HA3A 3I72A 4J0DA 1OLSA 2PZLA 4OATA 4P93A 3JYQA 3WICA 2J1LA 4D43A 1OD6A 1F4PA 5FYDA 2Q5FA 3A4YA 3CN7A 5FPPA 4URVR 3PUJA 2VCHA 4B44A 1W0KD 3DZBA 1UKZA 3S44A 4AWXA 1TLTA 1X7XA 2AXEA 3M82A 1EUQA 4E5VA 1CY4A 2P9GA 1EUDB 4UHBA 2X5KO 1T6YA 3K7EA 4N7JA 2JFHA 1MRNA 1PD0A 2IYYA 1N36B 2XB8A 3ZJTA 5LYJB 2PPVA 4FQ8A 3WWDA 3G5UA 1VSTA 5AOVA 5LP6C 5LZ5A 4EQZA 4TX1A 1DAHA 4BLTA 2WR8A 3V9AA 2VHTA 3I9NA 3JQRA 3WK5A 3ROMA 3ELUA 1VHQA 1V6CA 1WXGA 3KCQA 4F56A 3QBDA 3EMVA 4FEGA 5BOSA 4CEHB 2Q3MA 2VTKA 4WKPA 4DMUB 1R0RE 2W4MA 3ESDA 3NFYA 2ZIXA 3X1WA 2O8FB 1K1EA 1KBOA 1OBOA 1JNYA 3SR3A 3ZZMA 2XCTB 2GILA 2XSZA 1ZH2A 3QQPA 3GEPA 4FOOA 5FPSA 3SQXA 5U9CA 3SKVA 3HO6A 4UOZA 1FTSA 2C07A 4MCHA 1LRJA 1E4EB 1GGNA 3GBVA 2BHLA 3IYLW 1UC5B 4R81A 3ZWDA 1Z2PX 1QH1B 2X0EA 5B3AA 3D1LA 4Y6GB 2HU7A 3HZRA 1AKQA 1NDQA 2PH5A 3AB8A 4HMOA 4RQUA 2RKOA 4WZBA 3E1GA 4F4HA 4W5NA 2PJRA 1DTWB 4YYEA 3AR5A 1T5LA 2JS7A 2WTAA 2XZOA 4S1PA 1FFXA 3N05A 4LRWA 1OF1A 2OV2A 2ANBA 3PFIA 3P4XA 1U0LA 1JU4A 1P6UA 1V39A 2XWBF 3C6KA 4Y0NA 4AX4A 1LPOA 4F3RA 4MXDA 1IY0A 4TTQA 1Z3IX 1PS0A 3QKRB 1VIMA 4EB8A 5J23A 1P73A 4KBGA 4CPDA 3K20A 1I1OA 4EKGA 3NDJA 2H0RA 3DE6X 3K6JA 1R5NA 2JAQA 4DARA 1UM9B 4RQAA 3BICA 3U44A 5CA1A 2WMYA 1GVHA 1T15A 2QT1A 2YJGA 1X0XA 3QV1A 2B1QA 3CRQA 2B3TA 1KIMA 3OQBA 1E6MA 3ZGNA 4B35A 2C0PA 1H2AS 3FVRA 4HAWA 2GK7A 5EYPB 2HRRA 2VRBA 2EKQA 2ZJYA 3WTBA 4LBZA 5FTWA 4EI9A 1JFSA 2ZSJA 4A0GA 2IZZA 1L7MA 3AC0A 3K8OE 3VBEA 3KALA 2EARA 2BEWA 2CXNA 5DISB 2DLDA 1ORTA 3ZNPA 3FLEA 3KVRA 4NBUA 1QPZA 1ECJA 1CEEA 4DWOA 3CC8A 3N8GA 4DLWA 3NAZA 1DJOA 1MENA 2XGGA 3SGLA 4J1TA 3SJUA 4IV8A 4BV3A 1W0JA 4JVOA 3JARB 3OMXA 4C89A 2CD7A 4QEKA 2H31A 4EA7A 4YR7A 3T7TA 2ZRLA 1M2VA 2FWRA 4R1OA 2OK8A 4JI1B 5IAAA 1Q15A 2BL4A 1PJ3A 5F23A 2ZITA 3IAXA 2WUWE 4E30A 5LIRA 2DPLA 5EQFA 1NMXA 4YNBA 2AZDA 5KC8A 3UAZA 2ZAGA 4MQUA 1ZNYA 4LNAA 2MCFA 3Q0EA 1KXJA 2H5EA 2JGLA 1U7PA 1W5AA 2J6BA 1T4BA 3IE0A 3JYPA 3PP8A 2QV7A 4U3JA 4BLSA 1PZFA 1W7AA 5F9FA 1SC1A 4PPGA 3V9PA 3R5XA 4LRUA 2QRPA 2Z6AA 3LQ1A 4I55A 2BBSA 2J3HA 4BWYA 3KIPA 1EUCB 2W5UA 4RWZA 5FPHA 3HXLA 4CMJA 3R0VA 3R7WA 2GZ3A 2J4DA 5G4KB 3MWDA 3TRJA 1V2HE 2QSYA 3A6HA 2DX7A 4M0CA 4B40A 1PEYA 2GM3A 2PS1A 2QRNA 3C16C 4IDQA 2J67A 4ITVA 3MQ2A 1WAMA 4GYKA 4Z86A 4UD2A 4CZ2A 1DCTA 4MWGA 1CFZA 3DXXA 4V0KA 5A0FA 2A33A 3SDBA 2CUKA 5E2AA 3AG6A 3OP1A 3QU2A 3JQ6A 4QOGA 1FXSA 4KFUA 1Q0UA 4M9QA 2J31A 4PPNA 3Q7RA 1Z88A 3NV7A 5F9HA 3ITNA 5FBHA 2VZEA 2ICAA 2QTHA 3DUFA 1Q22A 5CDUA 4HGYA 4PFSA 3G2QA 4TXMA 2YNMA 4IINA 1J2RA 2E4YA 1UBKS 3NC1C 1L6RA 2E85A 2XYQA 4YI3A 4AVYA 2WJVA 3NM4A 3R3JA 1UBRS 1N75A 1QQ7A 2H2GA 1DXOA 2NPOA 4O4HB 2IHYA 4DGSA 1M73E 3CFYA 1YS1X 1RLUA 3G2KA 4KGXA 1XCMA 4MP6A 3RUDA 4BAZA 5JAIA 4BNKA 1UJ6A 2BR5A 3GFVA 5H7XA 5KNLA 2PSJA 4ODIA 4Q12A 1RBZA 2CJWA 4E5NA 1ZUWA 2AYXA 1VPDA 5F21A 1ZO8A 3PHIA 5AXDA 3WVNA 1BX1A 3M4ZA 4AKSA 1T9KA 3B89A 1F8UA 1Y6FA 2YIMA 2YMLA 3QWIA 3L0ZA 2QZPA 4GM1A 3ZK8A 4AZSA 3V8RA 3L4KA 3G68A 2F3QA 2KE5A 3GEEA 3N0RA 2C1ZA 3IXLA 5I9LA 2NQTA 1OZGA 4OL9A 3IUYA 1GPLA 4KPFC 1DIHA 2PX2A 1P0IA 5BWNA 1MB3A 3J81k 4XIIA 1EFHA 2X3UA 4WESA 4Y9TA 5FYQA 3W5IA 2XDAA 1A82A 2FW6A 3E84A 4B0OA 4EF6A 1UWVA 3FDZB 3FF1A 4D3YA 1E1DA 3REOA 3RW9A 1EH5A 5K4HA 1UXGA 2ZJAA 2J32A 3I01A 4YRCA 2GPAA 4RTNA 1DNPA 1Y33E 3ITEA 4FCTA 1MW8X 3HJCA 3HR4A 4D9EA 1J2JA 3IEIA 3K96A 1DQSA 4PLZA 4C21A 4HDRA 1HDRA 3UYKA 5ALUA 4FOLA 3BGOS 1LPPA 3INYA 4NENA 3KTOA 3OE4A 4H27A 1Z56C 3UTDA 5KYGA 3HA5A 1WABA 2GM5A 1QS0B 3QFTA 3V2HA 2XOEA 1EQ2A 3QG5A 4RAOA 1YOBA 4KTTE 1UMBA 2L69A 5JR3A 1SZJG 5JT1A 4WGGA 1A3CA 5DK4A 2WHRA 3EGEA 3ILSA 5EQDA 2BHRA 5WRFA 3TLAA 3AEQA 3ZXYA 3BWEA 1BDBA 1YDWA 3AETA 4O8ZA 4ZVNA 1IU9A 3WXMA 3F46A 3TH5A 1PZGA 4R9UC 1XZ8A 4NZOA 3R5SA 1GP2A 4C0JA 4HVLA 1P0PA 2R96A 5ADVA 2PUJA 3CR8A 1JIIA 2X4GA 3RRNA 3TKAA 4RHYA 4XWKA 5G0VA 2XYHA 4LBYA 4ZVQA 1WTCA 2GYVA 5D5PA 4BQSA 3FKSA 4KUGA 4B87A 1IOLA 3I05A 5BN5B 3F9RA 1WCXA 2H17A 3OG9A 2AUTA 3IHTA 3K0EA 5AKYA 5DLEA 1K4YA 2HKIA 3F97A 5FP0A 5LXTB 3FTEA 2AFIE 2VDQB 3FLBA 4OEHA 1N3IA 1SKYE 3ORQA 1K7CA 2NV6A 4ND8A 3IOCA 2PV0A 2FFQA 1VE1A 4HS9A 4ZPXA 1LQ2A 2H9YA 1OI4A 4AF7A 1C4WA 1T36B 1FNMA 1YR2A 4CKEA 3EF0A 5JWOA 2AJCA 1ZJ6A 2ZW9A 2VJYA 1GV1A 3M9XA 3G8AA 1NY6A 3ODGA 3UKOA 1EFRA 3HJRA 4P38A 5CDTA 4WN9B 3WLJA 3KOYA 1X7YA 1ZMXA 3JQAA 1KA9H 4Z4QA 3AHEA 4DHWA 1NMQA 2A58A 3C1UA 1O9BA 1TK9A 3IUEA 3L8FA 3OFSA 2Y1KA 4OI2A 4YC7A 1DP4A 1HOXA 3HKCA 4RSGA 4ENWA 3TNFA 1RSZA 4CNBA 1YZKA 3P0IA 1DHRA 3FYUB 3LQKA 3V2UA 1QHGA 2A14A 3ZV5A 3RVLA 1PTKA 2I0FA 1ZD9A 5BW4A 4EHBA 4MGKR 4IFBA 3WIEA 5LNK6 2OT3B 4CL2A 4IICA 2C4VA 1BCSB 1KJJA 4CF5A 2J9FA 2WG0A 2WJWA 3UJAA 1KWGA 3VC7A 3IP1A 2E2WA 1YMVA 4R5HA 1KVRA 5LA6A 5CYOA 1K8RA 4RX1A 4S0ZA 5JD4A 5FFMA 1EBFA 1JG1A 4FMCB 1SY7A 2X3FA 2Z4RA 5ADHA 2CWDA 2Q7XA 1VA4A 1WVMA 2JAWA 1C81A 4W1QA 4MV7A 3KSBC 3ZDDA 3PT5A 5A1TA 2JLYA 1YB6A 2D1QA 2KMLA 1AM4D 1DJLA 1RJEA 3GGCA 3B8HA 3A4VA 1CKEA 3D6HA 1FLDA 3P9IA 4ALMA 1QWSA 4ZCIA 2JF0A 4KHZA 4XRRA 5CJ2A 4IDEA 4LGVA 1MPXA 3JQFA 5KDLA 2JGMA 4QUIA 2GLUA 2R8XA 4DABA 3L6BA 3IULA 2GK3A 3A6PC 1ZONA 3BCRA 3ZCUA 3CX4A 2PRJA 3DA8A 3K2QA 2IHVA 4HAXA 4GKAA 3WGJA 4JYZA 1AMNA 1G4UR 2I2FA 1OLSB 4JQCA 1E9EA 3T6KA 3QUQA 4RK5A 1K92A 4J6FA 5JYCA 2OD7A 3OKAA 3QPCA 3G0BA 3ZE2B 5EUMA 3X2SA 3VUFA 3T0FA 4BGUA 1XKTA 3O4JA 1W85B 1FEZA 3ROXA 1M1UA 4MHOA 2Q3BA 3R44A 4H31A 4RD3A 1QIKA 2DEUA 1WS6A 5KJ6A 4HWRA 4I3HA 1JIXA 3Q9LA 2BGNA 4N5HX 1XQVA 3W2HA 4C2BA 4M87A 3FRHA 5EGSA 4C6SA 1YB1A 4HL6A 1GKLA 5A4JA 4DDVA 1F4VA 2EOAA 4PYJA 2WKSA 5BOSB 2I80A 1XMQB 4D3SA 1TCUA 4EECA 3LUKA 4EATA 2JFQA 5UKDA 2IHNA 3VJRA 1NG9A 3A4IA 1LCIA 3TIVA 4WCFB 4G8BA 1VJGA 3D3WA 3NHKA 1DC7A 3G5TA 4I0WB 1PEDA 5ALJA 1U8ZA 2IJGX 4KDEA 4E08A 1TVEA 2P62A 3RVOA 2G76A 2WB4A 4UPDA 5L9AA 3TLYA 5COAA 4ZO8A 1HDOA 1ORWA 3CE6A 3O7WA 4O4IB 4K6HA 5LR6A 4Y67A 3AJEA 4JQZA 5IAOA 4HQ6A 1RE1A 4E22A 3AFOA 1L4NA 1LVGA 2Q49A 4DUPA 4HDMA 4MRMB 2Q9CA 1Z4PX 2IF2A 3I2KA 4TMZA 2REBA 3VR3D 4OBEA 1GG9A 3OAAD 1AK1A 4UNRA 1M2NA 1Y5MA 4M9SA 4XYMA 2NVUA 2HQOA 1EVLA 1Y4ZA 2J0UA 3T4PA 2IY9A 3FPKA 1C7EA 1FDOA 3ZXXA 2G9ZA 1P1CA 2ZPUA 4QVKA 3SHQA 1FFDA 3MJVA 1AKVA 5TVKA 3S2YA 4UNIA 4KR6A 1WHTA 2V74B 1KY2A 1U04A 5DM70 1JA1A 5AT1A 1GGVA 4J03A 3DTVA 5FPKA 4HVAA 3S3TA 1DBRA 5EYPA 3GLFE 1X1EA 1GNVA 3JQPA 3Q5GA 5JQGB 4ABTA 3DFMA 1FXUA 2PS0A 1MTOA 4UM8B 5JAUA 1WZIA 3PRJA 1QV6A 2LUOA 3GJ4A 3AT1A 2PQMA 2CVOA 3K0FA 1QZXA 1LNZA 3OJ0A 3LD9A 4XUCA 2C7QA 1HR0B 2EP8A 1SOMA 3UGQA 3LVFO 1A5SB 3ND7A 4UZSA 3E9CA 4ZU3A 4ZI7A 4EI8A 3I5YA 4DLAA 3RRZA 2PZAA 2XA1A 2WM9B 1JYFA 5HK8A 4QQFA 4ZAVA 1QV9A 3UV7A 1CDDA 4HNUA 1E1RD 4PRKA 5KIAA 2OHFA 1Q74A 1NXTA 1S5PA 1JHRA 2YOGA 1J4AA 3AP1A 1X1QA 4Y2VA 1N2SA 1BXKA 2FVXA 3DLAA 5I4IA 2QPTA 2AOUB 3GIWA 2E5FA 4BLVA 4DC0A 1WA5A 4KWEA 3DZFA 4U3JB 1TZMA 2YFQA 5IFLA 4DSZA 4IX9A 5LD2B 3CXRA 5KWJA 4RY8A 1JDBB 3DVSX 1ECBA 4EY3A 3ZIDA 5FR1A 4B3MB 3ZWYA 5JO9A 3T5BA 4GRAA 3ER8A 13PKA 2RGYA 3KPJA 1CS0B 3LUDA 3LT0A 3DT6A 1EUCA 2XD9A 3PLRA 4QT4A 3BFKA 5IJWA 1O54A 4J4HA 3PUZA 1XVUA 3W3AA 2YXEA 1ZIPA 4JK3A 2AR9A 2FPIB 3B6KA 4JENA 5HF5A 3F5QA 2IS1A 3I09A 2IVFA 1YJBA 4YMWA 1O2DA 4G67A 4AB1A 4JB3A 1VL2A 3JZMA 1F0NA 2VAPA 3DNFA 3V1UA 2C9OA 4NWIA 2BFDA 4QM6A 3HZOA 3OIWA 4Z49A 1U31A 3HWX1 4HQLA 2GXUA 3NHPA 2A67A 3SJCA 1KFKB 4D8TA 1NX9A 1TAQA 2VEDA 3P0FA 1GAEO 1GPDG 4V02A 4GUAA 3VR1A 2W2QA 4KFCA 3TG8A 4EB6B 2JH8A 1ZITA 4B74A 5GZ3A 5A02A 3EHEA 1M54A 1UOQA 3AW9A 4JLBA 4HY3A 1JRLA 1M1XB 4GOND 1PJ8A 5EIXA 4PLFA 3WGIA 2WKRA 1HYGA 4ZVTA 2OCIA 3ZHYA 4H1UA 5KYYA 2AJBA 2HJRA 4RF3A 2ZTSA 4ES6A 1CIVA 3OZEA 1YZUA 4JT9A 4N3NA 4EB0A 2VH5R 1XD2B 3WTCA 1WSAA 2QLTA 2OCDA 4UHCA 2RARA 2CNLA 3ER6A 1VIAA 1XZEA 2JRCA 3HPQA 2I9KA 2FAXA 1YBVA 4DMLA 1TC1A 4YUVA 3DBOB 3E3AA 1VE3A 2HRDA 2XF8A 2JZOA 2FPKA 4TQAA 1GILA 4CU2A 5I48A 3QFFA 3VX3A 2C4HA 2VAVA 1HZZA 3GV0A 2K2QB 3IP6A 3L7LA 4Q6BA 1FS6A 1JTEA 3FCUB 4IILA 3ABRB 3M4XA 2EWMA 3R9IA 3PNKA 3TRKA 1LSJA 5AK0A 4PX2A 2KPOA 3L7KA 4ENVA 5JAOA 3FE2A 3U7HB 2ID4A 1BCRA 1PWEA 3FDZA 3I6IA 4R54A 1G21E 2ATIA 5B3JA 2BDUA 4HNRA 5KOJB 1F2UB 5CVVA 4TMXA 1CQPA 1LU9A 4QUEA 2OORC 3C70A 5FFFA 4TVBA 1E64A 4C7XA 4H2DA 1UEJA 2FPWA 2Q0SA 3T41A 2DB3A 2G7ZA 1TQ2A 3K0CC 3O8LA 1AKYA 4UPVA 4I08A 2YZGA 3RLIA 4E09A 4CEIA 1FP1D 3VGJA 3IIMA 3DPSA 5JXWA 1URPA 3E1SA 2JCGA 3DVQX 2NZ2A 1PJBA 3P96A 4LMPA 4PYOA 1L8QA 4YJ3B 3K9FC 4R40A 4IX1A 1LF0A 1ZOPA 3KXKA 3UJPA 4Q66C 4C07A 5HMLA 2VWHA 1E94E 3JU3A 3NHUA 4QU5A 2H3EA 1B00A 5DLPA 4UMEA 5ILOA 3AQIA 1YZGA 2XQFA 1XBTA 4CV2A 3DQZA 1H3NA 4EY5A 3L04A 3SYKA 3UAWA 2IQIA 4BKQA 4I2NA 3H87A 4BEWA 1N2CA 3RRYA 3BT7A 3MXTA 5FI5A 1VGQA 3GEGA 3GO4A 4R7GA 4K2AA 3IUQA 3PWTA 4G9GA 1E3EA 3IUMA 4BJ1A 3EXHC 1S7CA 3N0VA 3KKZA 3O0DA 2PSSA 3ZNQA 3THYB 4GD3Q 4TM8A 1RLOA 4AKGA 1ZN9A 2HLPA 3T5PA 3ETHA 1EVZA 2QTVB 3MTQA 1W30A 4QG3A 2O2DA 1H2YA 5LP6A 2RIRA 1MHTA 2WV9A 1CR1A 2OBLA 4A03A 3UA3A 4G4GA 1E7WA 1YGPA 3G8YA 5B58T 4EEXA 2I34A 3U3DA 1U7DA 1PQ4A 1JDSA 3PD1A 2P5TB 1SXIA 4MWEA 3FWKA 5HF8A 2E48A 2AHRA 2MSNA 1PBNA 2H16A 4MA5A 3UUEA 1PTJC 1I33A 1S3FA 2IXBA 1XE3A 4C87A 1I3MA 1U8YA 2GI4A 1N77A 5EZYB 2XJ9A 1PKXA 1ZEMA 2QR2A 4XIFA 5LQJA 3G13A 3JY6A 4X6LA 4G5RA 4MUFA 4FFLA 3HKCB 2GZSA 5JSHA 4TRRA 1NAIA 1GCAA 3KAPA 2JLZA 3WWYA 3AI2A 1XF9A 4CF6A 3BULA 3TLJA 4C2TA 2FZ5A 2AV6A 3FGOA 2CXXA 1JHOA 1NR7A 1VLVA 5AKEA 1GG5A 3L82B 4MIEA 5AK5A 5DHAA 3SDSA 1UAAA 5GJVC 4G65A 1KI1A 1YR9A 2Z2XA 1UBTS 1ZC4A 2GCOA 3HP1A 5C8YA 1E3TA 5A4AA 1VLLA 5LPNA 1BWRA 2HRBA 2ONKA 4LZNA 4WDRA 5T3UA 4CIXA 2AN5A 1UJCA 4ENRA 1KVQA 3K6RA 5LA6B 2J08A 3D6UA 3QI7A 5I7HA 3GVIA 3N6RA 2VJMB 3ZGZA 3KVNA 2IPLA 4FFMA 3IT1A 3SF0A 1W5TA 5G0SA 1WKVA 1NP3A 1NPTO 3TZEA 2YV2A 5B64A 3VYTB 2R5NA 3ETJA 2O7RA 3SZGA 1FRNA 3T4UA 5IF9A 3E9QA 4QYSA 4MIKA 3F1LA 2BGMA 4KPUA 5DWDA 3TAHA 4EJ2A 3NHJA 4HP8A 2BFCB 3SLRA 2P0EA 3H19A 3ANSA 4I8IA 3B1YA 4OP3A 1QRAA 4MZDA 1GTSA 1Y3HA 4MV6A 1ND5A 4H3SA 3VOTA 2YDYA 3NUGA 5J63A 1ZK2A 3FMOB 3W9UA 4RTLA 1KDPA 1TM5E 3HUUA 2VDUE 3HCPA 4J1TC 1FTGA 4P92A 4LDRA 3FOAA 1S2DA 1I6KA 3CUSA 2J45A 4RAQA 4LA4A 1UQRA 4FZRA 4MSUA 4YQEA 2Q5LA 2R25B 1ZVQA 4ZRMA 1RRFA 1M6EX 3V4SA 2PUEA 1NNUA 4K9QA 4RVCA 2JA1A 4WZAB 1CUEA 3TSZA 1YO6A 3LXRA 4WZBE 4W7HA 4RNCA 1KRXA 1YV9A 2O8BA 4U9IS 1C0IA 2BZSA 1Y4UA 5GGYA 2GDJA 2YHUA 4Y2HA 4COKA 2C7RA 2ZE6A 5HM6A 4CWAA 1USGA 1C7ZA 5B6JA 1Q21A 1K6EA 1RXSA 4YCSA 1A9RA 1JG2A 1FNCA 1MIOB 1S3IA 1O58A 4XGIA 4A91A 4ZCTA 2BFEA 3LQQA 4LJ6A 5GVSA 1XYYA 2Z3ZA 4UFPA 1DKPA 1NLYA 2AKYA 3CLRD 3D2LA 1U11A 2P77A 3PDIA 3Q10A 2C7VA 4U2BA 4WCVA 2QZ9A 2NTVA 3AY3A 5FA6A 1W0CA 5AKKA 3U13A 3QELA 3RARA 4Q9NA 3THSA 1WE2A 3PJRA 3LK7A 1J33A 4TRMA 1H69A 2JVIA 3MWDB 3ZDRA 5F9MA 1OFHA 2C04A 5DFAA 2HWUA 2A0WA 1OMOA 3A6FA 3P2YA 3VSCA 5BOVA 1W88A 4B6EA 2ZUEA 1CZOA 1V6SA 3DC7A 3OC0A 2VP0A 2WWHA 2ZRQA 4NU5A 3P9NA 3PEYA 1J0CA 1PZMA 1AF4A 1T2CA 1DEXA 2F67A 2J4CA 4QUKA 1AQIA 2Y68A 3IHKA 1KZ9A 1IBSA 2RI6A 5A4MS 3IE1A 2AN9A 4U0KA 3SQNA 4D5GA 4E21A 1GT6A 4PBSA 1F9EA 3TDMA 5CH5A 4ETIA 3SWWA 5J1SB 5KYUA 1PYDA 1NFQA 1RJDA 4E12A 1U63A 2X7XA 4O08A 1TJYA 1UDAA 1Q92A 4MP3A 1XFAA 3DUWA 2VSFA 4ESVA 1MOPA 3GAMA 2FZGA 5E6UB 3WIOA 2QGNA 1R4NA 1U0JA 2IYRA 4KXNA 2XVAA 1UDRA 3DONA 1NULA 1SCKA 1WHTB 3IAAA 3OT1B 2J9GA 1K63A 5BN1A 5A3QA 1VBFA 4POOA 1EB9A 3U7RA 2ZYDA 4CIWA 1N6LA 1A95A 2Q1YA 3DTVB 4OAQA 4RGBA 4WECA 4DWWA 1E9BA 3HGTA 1CZRA 1NW5A 2B4RO 2ZJFA 3RIEA 4Z7OB 3ADDA 2WI8A 5EXEA 2C88A 1C0LA 3BHIA 1JF8A 1POWA 5G3YA 1QGDA 3T06B 3KSZO 3TLBA 2WF7A 1TYZA 3FYCA 2Y1GA 3F9IA 2YXDA 4YUXA 3BEDA 3K1AA 1HE4A 2FFHA 4R8LA 1TUEA 4BP3A 2WIAA 2VYFA 1C4OA 5TPZD 2OM6A 4DNOA 3PYLA 4UUAA 3FB1A 1O03A 2GZHA 2I2AA 1AMOA 4P8RA 1QCDA 3WZ2A 5J40A 2C3OA 3LYUA 4OXQA 4WK4B 3ENNA 1ZCBA 1JECA 3Q7PA 4FGLA 1GU7A 1E2LA 1RPTA 2ZR8A 3Q7TA 4O2RA 4P2BA 1O6FA 5EIHA 5F2KA 3TR5A 3UJCA 1YRQA 3R75A 2O23A 3UGKA 3IURA 1R5BA 3V4FA 4NFSA 3NU1A 1Z2NX 3ZU2A 4ZEOA 4DUYB 3ZE9A 4OHRA 3CZCA 5DM0A 4JP1A 1DJPA 4EPRA 2NVOA 4XVCA 2NU8A 3JZAA 1HG0A 4XX1A 3CVYA 5JH7F 4E03A 2ZZMA 1XQWA 2R1UA 1W6UA 3IERA 3TIGA 3QVSA 4NOMA 3UC5A 1BROA 1XVAA 2GVDC 2VP9A 2RHWA 4P98A 4RADA 4ENUA 5A3JA 1GM5A 5E3HA 4LX8A 1X38A 1VLHA 1XRLA 1WY5A 1KZYC 2A4KA 3EC2A 4FT2A 1LQUA 3ZVKA 3A1FA 3PB3A 5DYNA 3QLVC 2C1XA 1TPYA 4KO8A 3M6IA 1ISIA 1ZA1A 2Q8NA 3DDHA 3IAM6 1UFRA 4IJKA 1JKIA 4ZI5A 1NZJA 1P6XA 5PNTA 2ATEA 3KJNA 4G1MB 2HIGA 4TPKA 4BEBA 5CA1F 5LB2A 4DUGD 4HCJA 4ACAA 4HBGA 4KGDA 1A97A 2JHAA 2A1UB 2CSUA 1G9SA 1UXHA 2HK6A 2QD3A 4Q24A 2ZFUA 4CL3A 5BNZA 4IXDA 5BV1A 2GN9A 4M1TA 1VP3A 1RAEA 3QUCA 5KTSA 3JSXA 1JR3A 4BJ3A 1G8YA 4LFAB 3Q9SA 5EIAA 3MSCA 1YC2A 3WKCA 2APJA 3CMMA 4ZZ0A 5E3IA 2NGRA 4CM3A 2C5BA 4B2LA 1SXJE 4KXUA 4P0TA 5IKEA 3TGLA 3QEAZ 4N0EA 3PT9A 4EW6A 5IDQA 2LWIA 3L4EA 1BX0A 1KGSA 1QK3A 3DB2A 1CUXA 3Q41A 3RFXA 3WJ7A 3R3WA 1HRDA 2BAGA 4AO7A 5A7FA 1CUFA 3TQFA 1OTHA 3N2GB 2WAYA 3CLUC 4EUFA 3W5UA 3VYSB 2CHEA 3WNVA 1T3HA 4W9NA 1YFKA 1C7RA 3MLBA 3OMLA 2WHPA 1NN5A 3LC0A 4PAOA 4XCQA 3SM3A 4R68A 1FFGA 4MINA 5A04A 3DMGA 4XFDA 3G89A 3NUZA 1DRVA 3BWYA 1GL7A 2P9FA 4IZOA 2EX1A 3UHOA 5GV7A 1BXRB 2R2AA 3TB6A 4ARBA 3N8DA 2XMBA 4Q34A 1EFCA 1XDWA 4G0VA 2CFSA 2WIJA 4P3OA 3IBFA 4ZT4A 4MULA 1QYVA 4DA4A 1NONA 1R9NA 2QLNA 4WFIA 3S99A 1C8KA 5KOJA 2EG5A 1NVVR 2OAP1 4RCYA 4BFCA 2G4VA 1MMFB 1O4WA 3WWEA 3CNLA 2PTHA 3LFTA 4R9RA 4XVHA 4WKCA 5KNBH 3O8QA 1Q2UA 2DPMA 1N6KA 5FTNA 2ET6A 2ROQA 3RVBA 4U7FA 3WKDA 4DR5B 1ONPA 3OA0A 4KRXA 5EG5A 4CG3A 2PZGA 3L1JA 1V47A 2AA3A 3EIQA 4RDIA 3B2QA 5DM2A 2BKVA 3OCUA 3PEVA 4Q82A 3CLVA 4ZVSA 4KZPA 3NDBB 4YJ3A 3CKYA 1L4HA 4HDSB 4X93A 1MEEA 3GLVA 3PDJA 4S1OA 1T5IA 1FX0B 4MRVA 4X7RA 4LDPA 5JBNA 4MO9A 3TQHA 1N33B 2EBWA 1RYZA 1T91A 3PUXA 4KO1S 4G1FA 3P94A 3REFA 5TQJA 2YOFA 3F67A 1PR4A 1V11A 1PT7A 2HSZA 2EYUA 3JR3A 3NWEA 5DBGA 1U3VA 2ODTX 2V5AA 3DW1X 1TZBA 3WGGA 4NX2A 3V42A 3ZLBA 3AIMA 2XEXA 2R8BA 4L22A 1ACJA 3KV1A 5DU2A 3A37A 1NJGA 3GVPA 1PI3A 2EX0A 4RVFA 2O6LA 3TLGB 5BQ3A 4RXTA 5K4AA 1X1RA 1KVUA 1QAOA 2NNLD 1G3RA 3ECSA 3JQAD 3NJ4A 1IM2A 1UP4A 3AU8A 2PS9A 3OMWA 3O0TA 1W85A 4HMQA 2WYOA 4J3FA 3WS7A 2XY4A 1ZPDA 4CQMB 2WJYA 4EP1A 2YV5A 1ODTC 2ONCA 1FDSA 2X8BA 5JLAA 2YS6A 2R85A 4WQMA 3WWCA 1ZRHA 2NLOA 1FP4B 3DBRB 3KYDB 1A7JA 4MKFA 4P3NA 5K03A 3EF1A 3L02A 2C2GA 3N2EA 4B45A 4BASA 1GTVA 4TROA 1T0PA 4A0HA 4KODA 2QN6A 3BMXA 3I2FA 3CRW1 2ZSDA 3E9RA 3EGXA 5CVJA 4ZQIA 5DXFA 1X80A 1DOZA 3WMGA 3N75A 1LWNA 4XRGA 2B92A 3I37X 2V6GA 3AMVA 3HCNA 1AHNA 1OVMA 4FHEA 4K46A 4KFRA 4QRIA 3WLMA 4JY7A 4B3XA 3FKSD 1ZINA 5CT8A 5JVDF 1BZYA 2ADMA 3LUGA 1CY8A 3D3WB 1G9XA 2AK2A 3RHZA 3RG2A 2P6OA 3KZXA 2I6XA 2Y1LA 3C48A 4PLTA 4S0XA 3RDPA 5IC4A 3NWOA 3NHSA 4YCAA 4YLGA 1EE1A 4MR9B 4MUXA 5FEUA 5ICMA 4IHQA 5A7GA 2OZLB 4I1VA 4EMBA 1WY7A 4FPXA 1RBQA 4JN6B 1WBJB 3HMKA 5BV0A 1RRPA 2G82A 5J59A 4FHZA 1IYZA 9LDBA 1XZPA 3AUAA 2XI4A 2WSBA 4BP8A 3PNPA 3EXIB 4WY5A 1KJ8A 3CN9A 4DPMA 2O8CB 1DXYA 4IDOA 1GYRA 3UXEA 3PKIA 3TINA 4WLUA 4DREA 4II7A 2FUEA 3K94A 3WGOA 4KP7A 1HKHA 4WLOA 1CZNA 3MYRA 4P7KA 3KB8A 1GCOA 1OZ0A 3CG4A 2BR3A 4JCCA 1XHLA 4MV3A 3VXKA 4DILA 5BR8B 2CL6X 1IHYA 1M9NA 1G7TA 2O7SA 4JUDX 5IXYA 3CX8A 2K87A 1CY7A 4QKQA 1JHXA 2JEYA 5T6MA 2ATVA 1TZCA 4BV9A 5FA8A 1DBIA 3ORYA 1B6GA 3E9MA 3BWDD 3I9FA 4P5PA 2HR1A 5EKXA 1KRWA 3RRXA 2QNRA 3EWSA 2B36A 3WMRA 5JQGA 2FK8A 5EMNA 3IDOA 5DI3A 2X8WA 1HM5A 4OYRA 5B4TA 2BFOA 3WYEA 1THZA 1W1IA 3M2PA 4YN3A 5B3KA 5E8RA 3KWFA 3OX3A 1RRGA 1TLFA 4PX5A 3QYAA 4LFBB 3JARA 1FU4A 3PHJA 1ZGZA 1V5WA 2PUFA 4UM5A 3L6OO 3T9BA 3CHYA 4OY3A 2EHDA 1SN7A 3DMFA 2WSYB 1SD2A 1YS4A 5K3BA 4DMHA 2XUAA 4GYJA 5EJGA 3GEMA 3PITA 1BYIA 2Q2QA 1E5DA 1EP2B 2WDZA 4LXUA 1L1FA 4AF8A 2VNJA 4QFDA 1JVSA 1D6SA 1NRJB 2V7UA 4W5WA 3I61A 5EMJA 4C7OB 4GI3A 1YA8A 1KO8A 1FUEA 2L82A 2C7PA 3G79A 1V1RA 1S01A 3KQSA 4NCXA 1D07A 4HNGA 4CLRA 1WOMA 1GV0A 2CBXA 2GBCA 4U2EA 3EEOA 4CUZA 1V8OA 5C34B 4J91A 1IG0A 4LE0A 3H65A 1XXLA 2DSNA 3H5VA 3AR9A 4GOMD 3MBKA 3PL5A 3QGMA 4JP8A 4R8KA 2YY6A 3E7XA 4H1VA 4TXHA 3FMGA 3ICQB 1WEKA 1Q19A 5G4KA 2FP4A 2WU8A 2ISCA 3F7NA 2V6IA 4A8HA 3E3MA 2BCJQ 1N6PA 2P11A 2W58A 3D7KA 3DNMA 3AY7A 3OTIA 4KLNA 1KYXA 3AKZA 2J3QA 3ADOA 1ILEA 2HA7A 1WUTA 5EEHA 4MARA 1XMIA 2GPTA 3CT6A 3GP5A 3IUNA 4KQMA 1YHNA 4NPAA 5E1MA 5EJEA 4O2BA 4YDSA 2WSMA 4AM8A 1U3WA 1DAFA 1ESCA 3DM5A 5KSPA 4REQB 2SHKA 1KYQA 3QJGA 4ARZB 1FDWA 3SIRA 1SULA 2I2BA 1KY4A 3ZGXA 1P7YA 1PV4A 3C6QA 5K3EA 1F6BA 5ESWA 2NTNA 1E1RA 1ECFA 2NT4A 2UUPA 5ESRA 1LSUA 1AIPA 1W8IA 1A5AB 3N0XA 3OLXA 1PR3A 4X1YB 1Y63A 3EBOA 5EZSA 3LQYA 1JHYA 4XJTA 2X0DA 3UTCA 2Z6VA 5HBRA 4BNHA 1M2OA 2ZATA 1DRWA 2YWRA 4KUEA 1ENZA 1MGPA 2CW5A 4DBVO 1EQUA 4YV7A 2DFDA 3NPAA 4L4YA 2VDJA 3VKVA 4DLNA 4BMSA 3QMWA 4P36A 5HKOA 3CPHA 3FPGA 1RDFA 2EATA 3BXOA 5I9TA 2B1RA 2Z04A 1AKRA 1JSLA 3HPRA 1LDBA 3ICCA 3IPYA 3N2IA 3NM6B 1W0JD 5ABPA 4C88A 4R1MA 2PEYA 2PN1A 2Z1DA 1TM2A 1K6MA 3MWEB 2VJLA 4G5QA 3LYLA 3IRVA 2VI5A 1T1RA 5FWXA 4DSUA 2OHXA 1VXOA 3GDWA 5KTOA 3I9KA 2XTZA 3BJRA 2COUA 2Z1MA 3ETNA 3OJXA 4MVJM 1ISSA 1WJGA 4OFZA 4NMMA 2PRSA 2IXEA 1RWNA 1L7BA 3CE9A 5K3AA 2ECOA 4AC9A 5BP7A 1LZKA 3C39A 2VTBA 1SFRA 3M6WA 4LHYA 3YASA 1RLJA 4MAAA 2FRDC 3WYCA 1RS0A 1O1YA 2R7MA 1MFZA 3IP9A 4PXSA 3AHCA 4JITA 2RHJA 4MMXB 5MN6A 3B3AA 5B1IA 4ZKEA 2FHPA 1KIAA 1JNXX 4LZWA 4Y9UA 3A10A 3TLZA 5ALZA 1NBEA 4ID9A 1QP0A 3GRKA 3E3OA 4EARA 1IQRA 1ISPA 1JW9B 2FZVA 3DOUA 1R6TA 3N3AC 3AB3A 3IIKA 4E5KA 1GRNA 4OU4A 4NCBA 3VYRB 5JV5A 4NCIA 5EIWA 5BORA 3B6JA 4NL4H 1F4LA 4JI2B 3CNEA 3T0GA 3WL5A 4G1BA 1V1MB 4K9PA 4PIMA 4Z1OA 1MB0A 2JFPA 4QA9A 1WZ2A 1L5WA 2O3SA 4RTQA 3HQ4O 2CNWA 4KXXA 3BE8A 4M53A 3EMBA 4OL0A 2TYSB 4F4CA 1JAIA 1IBCA 2AFHE 4BMXA 4DEVA 5C0OE 3EG9B 4QDXA 2YHIA 2WFLB 1JE0A 2OV6A 4OM7A 4V0MA 2M6RA 1O0CA 4MW9A 4CM1A 5IN5A 4US2R 2OOKA 2P5YA 4U00A 3R9XB 4HYQA 1XTVA 4EPTA 3R40A 2JIBA 3RSHA 2D1YA 1QNLA 2HMSA 2XUOA 3O5AA 1I9GA 2AOWA 1N6IA 3HJGA 2OYSA 4ZARA 1KO7A 1RWXA 1WZEA 2CL7X 2IOHA 5LYJA 4IWNA 4ZGBA 4OXNA 1I6LA 2GLXA 3D0QA 3G8CA 2X77A 1U8TA 3CBGA 4HB4A 5K0SA 2ZULA 3O75A 3OZTA 4AZ0B 4K6KA 4JS0A 3AERB 4HQNA 3WOHA 3GDFA 2PFSA 2ZE8A 5F52A 5LA6F 2R65A 3VHLB 3X2EA 1X8JA 4FR0A 5L3VA 3NXSA 2XIQA 2XKAA 1FJ2A 5CB4A 5B3JC 5JRDS 3HR7A 5IS2A 3DM9B 3WDKA 1Y6GA 2QI9C 4HI0E 3PPWA 4OHUA 2JFZA 1SC4A 2QN2A 1P33A 5EIBD 4DLRA 2KYRA 5CITA 3D2BA 1YVUA 3I92A 3ZGVA 3KZMA 4OLBA 3KKNA 4TQUS 2QIOA 3TTYA 3C5WP 1T9CA 5JQWA 3AHDA 3LT4A 2IH2A 4X8MA 2NQ2C 4XOIA 3W8RA 3NC0C 1FTYA 2GVZC 2HGSA 3FYUA 2XNDA 4FQ5A 4JL6A 4N9WA 3C74A 3OECA 4OFXA 3P5BA 4XDYA 2QBYB 2CUZA 2F48A 1WVGA 1XRJA 5EJ8A 1E1YA 5ERXA 3GMDA 3QOXA 5EMKA 3DO8A 2O4CA 2VYQA 5AM5A 4BLWA 4MWSA 4CF3A 1XRQA 2Y27A 5BY2A 1Q5PA 4BO3A 1CP2A 2JIRA 5CCBA 3T3OA 3L1VA 3O8CA 3UXHA 2UZ0A 5GINE 4WA7A 1JILA 2QMZA 2FWMX 5JS1A 4K1XA 2QRVB 1XOIA 2JIPA 3C8UA 3O1JC 4JI0B 1XC7A 3NGXA 1DIGA 5ECYA 3A6LA 1VB5A 3ZXSA 5L3SA 2AKEA 1WUYA 3LHFA 4QO7A 4RW0A 5CH8A 3VU9A 4DIMA 1G3IA 3E9EA 3HLTA 3HCOA 3N5CA 3IR5A 5HW0A 1BDIA 4XYGA 4D0GA 4J76A 3W6PA 1V3VA 1O89A 2G72A 2G83A 2HJHA 3DDUA 4LRSB 4FZVA 4MPRA 4U8HA 4UJ3A 3HK2A 1KR5A 3VU3A 3PF8A 2CHGA 5F5LA 4YCLA 3STYA 1I51A 2VSYA 4MQBA 1H2FA 4OUDA 1FVHA 2XDWA 4RTSA 3OQOA 2F9FA 3DPUA 1IONA 2AFRA 4YCJA 1C8LA 4HGNA 3RS9A 1EX7A 1KMMA 2W90A 1Z0JA 3BMCB 3NHRA 5TMPA 1BE1A 2PKXA 2JG3A 3QKSB 2SKDA 4KN5A 1IQ0A 1EFRD 3K53A 4FFBA 3HHEA 2V1XA 3IT3A 4U6NA 5F7OA 1QGZA 3S2GA 2VP4A 3F4BA 2CDCA 1GU1A 3GZNA 3PXCX 2FXVA 4KV7A 5CK5A 4C6TA 1FS4A 1MIHA 3PIRA 4GO1A 4QSMA 4IL5A 4DMKA 3GCGA 1EK2A 3U56A 3OIVA 2CZCA 4Y8VA 2C2BA 2VSOA 1CQWA 1ODLA 3O8BA 4WBNA 4XWWA 3DBRA 3GWZA 4PN7A 3L7JA 3H11B 4FS3A 1AGRA 2ZRHA 1OWLA 3NBAA 4C4SA 4FGUA 4BFTA 4I55B 4F86A 3NPMA 4G01B 4BVBA 4ZYXA 3ZE0B 4NPHA 3UHFA 3WGZA 3USZA 4FDTA 4LVOA 4IDDA 4KO4S 4AKIA 4EGCB 4XSHA 4CM4A 3URMA 3U4AA 4GDFA 1UK6A 4JZYA 1EDDA 2Y77A 1C30B 3NKLA 4LX0A 4O5AA 3RT9A 3SSNA 2OKGA 4YRZA 3AHJA 3HVKA 1GG8A 1P0CA 2VATA 3MRSA 4JYMA 4UU8A 1QMPA 3KSDO 2PPLA 2Q28A 1D8TA 2GEFA 2YRFA 3G88A 1HQCA 3Q8XB 3NAQA 3B3FA 4L5YA 5ALKA 4UHKA 1VSUA 3UWOA 5FWYA 4IIFA 1LFDB 1XAHA 4G26A 1QRSA 4I3FA 3NBQA 2XQIA 4U2CA 3TLEA 5ITZB 5EXTA 3ICVA 2J5BA 3FH0A 1L1QA 2HY7A 2DETA 2H92A 3T1HB 1MX1A 5K05A 1V5GA 1IVYA 3TZQA 4DIBA 5KHOC 1FBTA 4ZAYA 2GNPA 4O4HA 3PXBA 5ICFA 2IEDA 3TFQA 1Z7YA 5KYXB 2J0UB 2OFXA 3EBPA 3QE0A 5HHTA 5DXAA 1GR0A 3PFCA 4P4UA 1VECA 2R97A 2LVBA 1MNQA 5EXDA 1N7HA 1HV8A 2DG2A 3BHNA 3EQ6A 3HKDA 3PRKE 3K5WA 3LLVA 4YP9A 3H6KA 1TC2A 2XAUA 3TFWA 2GJ8A 121PA 3QV2A 1UPAA 1RHQA 1N2JA 2H65A 3MGGA 1PJSA 1RWQA 3LO8A 2XKBA 1DFIA 3P7MA 1QVZA 2E0IA 1OXXK 2I29A 4PU0A 4R8RA 1RPNA 1OOEA 3H4VA 4RZ3A 3ORRA 4LPKA 1IE3A 1RAHA 1WU8A 4OXXA 4PYNA 3ZWKA 3BSYA 3TQRA 4PLGA 3G0CA 4CM8B 5H5JA 2FPGB 1O6ZA 4UTXA 4TUYA 1GDDA 3M6XA 4BX8A 4W5JA 1OTXA 1XDBA 3IOBA 5D7BA 3UAOA 2KBFA 1OWMA 1VE7A 4YFYA 1TMKA 1X70A 4IQ8A 3VFDA 1UKVY 1EHCA 2DTDA 1GN8A 2ATCA 3GT0A 3IQIX 3QE4A 4F12A 6AT1A 3DTVD 4EUNA 5CFNA 1YKGA 3NIGB 4HVTA 1NRIA 1E99A 2PFKA 3AJDA 1P91A 4CE6A 4Y2YA 1X2EA 1JHQA 1CYEA 2H52A 4PW0A 3V00A 1EZ4A 3CUUA 5TQ2B 4GLBA 2D2FA 1JHMA 1PGOA 4RF4A 2CDRA 1DAGA 2C5FA 3SQDA 1LD3A 3CRRA 1ZU5A 3DT8A 2XWQA 3OJWA 4NPCA 3QX3A 4YO7A 1CUCA 3RT7A 1T6BY 3DAOA 4F8JA 1HMYA 4MWDA 3ZJ4A 1MCZA 1Q84A 2VLBA 4NBSA 2Z5FA 1ZZGA 721PA 1E7SA 3AETB 4KDCA 2A0YA 2C1EA 3ELWA 4IQ0A 4BUJA 3CW9A 1MQAA 3DOFA 3KEGA 3OQJA 3TLXA 5A06A 5ELXA 3LY5A 2WHQA 3OJCA 3ZW8A 2VHXA 3KQMA 1IHPA 1PVVA 5JLJA 1HOTA 1WDKA 4KR2A 4V38A 1HDEA 1KEZA 3CEPB 3I2HA 1TJPB 5MGBA 2ISSD 2P2YA 3F6PA 5EHQA 4I81A 2HYDA 4D42A 1N34B 2PH3A 1GVNB 1OFVA 3PWKA 5L40A 5B7NA 3O03A 1NPDA 1NVVQ 3K72B 4B9EA 5FTLA 1DG9A 5TMBA 5E1DA 5KNBD 3KETA 4EKDA 2AN1A 2I03A 3EF3A 4DYVA 1DO2A 4HX2A 1D2AA 4FSDA 1CSEE 4MEBA 5F2NA 2YJNA 4DCOA 5IJXA 2ZT6A 3ZY4A 5LBIA 3VUEA 1K8YB 3RM3A 4L7VA 5BN3B 2E5WA 3IPRA 4IPTA 3B12A 3FZGA 1T1SA 3GH1A 5EP3A 1L7EA 3UWDA 3WGLA 4BQQA 4C14A 4NESA 5LNK1 3BXPA 1BN7A 2QM0A 1MOQA 2C78A 4IIJB 2P6UA 4NK4A 3WGQA 5BR1A 3PD7A 1Z06A 4MVYA 3I9V6 4ESEA 2X5NA 5JRZA 4P7GA 3F3MA 5AI5A 2NUBA 5AVQA 5KSWB 1QOPB 4EUSA 2E3JA 1N0UA 4DS3A 5KCZA 4WFJA 1CLEA 1CHDA 1KDTA 3NHZA 4U5QA 6ABPA 3MQ4A 4EGAA 5DASA 3CLSC 4O4JB 3ID6C 2Q3EA 3BQMB 4UZFA 4B3DA 2WHPB 3SHOA 4BMPB 1XAGA 1KK3A 1YB5A 1S9DA 3SS8A 2G88A 1Y7PA 2I8CA 4JJKA 3H5IA 2H2IA 5MHTA 1P4RA 1Y6RA 2PUCA 2J9FB 2J9YB 4X9XA 2R8RA 4RPCA 1U1CA 1P1IA 2PFGA 1RFGE 3AWIA 5I7SA 4LI0A 1BXRA 1ODJA 4A2PA 1BCRB 1QPBA 1RYBA 3N8HA 2J09A 1VZ2A 3H9EO 4GKBA 4GPAA 4XFKA 5GONF 3VNAA 4EI7A 1SBCA 1K27A 2VEOA 3EUFA 3PNLA 3GG9A 5H9VA 2JJMA 3OZSA 2GZMA 2WUGA 2ZXFA 4HDCA 3A1UA 4G5SA 9MHTA 4YMHA 1EX6A 3D8BA 3CLRC 5A7HA 1RAAA 4QG7A 4DM3A 4O1HA 3LWBA 3HRKA 5KMGB 1E0SA 4CODB 3UJDA 2QORA 3LLCA 3THRA 4GRIA 2JFVA 1E1LA 2WMOB 1H6DA 4HEA1 2EAUA 5TSDA 2YJ6A 1XN4A 4KXYA 3QEOA 1L1RA 1V37A 3RAJA 3JVEA 1KFJB 1TO1E 2G0TA 2ZYVX 1HE2A 1N6RA 3LSTA 2PUVA 3RRBA 1W46A 1H3FA 4EHFA 5EA2A 1L6IA 1K66A 1B8VA 1QB7A 1CC1S 1TVKB 4EO7A 2QMYA 2VDLB 1I4LD 1XZQA 3NGMA 3C6MA 4TSFA 2QX7A 1YRWA 1QFSA 2XT0A 3Q7SA 2F1OA 2YJ3A 3AJ8A 4EEZA 1D5CA 1FMFA 1L7RA 1P7VA 4GXRA 3NYRA 3VDMA 2ZANA 1XYVA 3RHSA 3T7RA 3AF4A 2EVWX 1I36A 2SKCA 3GRUA 1R37A 3VVLA 3ZV7A 4F0JA 4QFCA 1TU4A 2FW1A 3MHPA 3QUTA 5TV2A 3ZGOA 4CIVA 2PZJA 5K3FB 2CE2X 4C0HA 1FNBA 1ZM4A 4D4GA 2AWOA 3GPIA 2XBLA 1A5TA 3R6GA 3NP7A 5FO1A 3QVLA 4ZICA 4AK9A 1FYEA 4X63A 3H04A 2VLIA 1FUYB 1EG7A 1V4VA 2CJXA 3SU8A 3GEDA 4BCCA 5JO0A 4W5RA 4JVSB 4AJ9A 1Z07A 1MGOA 3LBHA 4Q3LA 3SE0A 5BWCA 2W2KA 4HZUB 2NVWA 5AESA 5CB4B 3ICOA 4LOIA 3CV3A 5IHXA 2IHBA 3IDQA 2F90A 4MVJE 3K30A 3AVOA 4MRAA 4PSDA 3C4VA 4KR9A 3UT5B 1NLZA 2WKPA 5I8ZA 3N87A 4P3PA 1PG5A 4IDFA 3RRJA 3MUNA 3Q6IA 2ZRPA 3ILYA 2IEIA 4LC1A 5CH3A 4BBPA 1SB9A 5B30A 2XT6A 2ZDHA 3K9NA 4OHWA 3VO8A 3K0HA 1LPMA 1FQWA 3ZKAA 3NHAA 1DE0A 3X44A 3AEXA 4ENQA 3EVZA 1DJNA 4LXQA 4WTOA 2PUGA 2QR5A 2VSQA 3DPIA 5DLYA 2YWFA 1VDMA 3I30X 3PFBA 2R6JA 3DT9A 3OJEA 3HCAA 3L1HA 5CTAA 1T26A 1XX6A 4TMYA 3T38A 2NVUB 2IEYA 2X8LA 1P4SA 2GERA 3V7UA 4OYHA 1SXGA 2XMQA 3GJZA 4WT7A 1J1IA 2V58A 1B0AA 2RBEA 4GX0A 1T0JB 3AR6A 1Y8AA 1CBUA 3OU2A 4B75A 2E6UX 5DGDA 2W6NA 3C97A 3ADCA 1VI6A 3CG0A 1OT5A 2R6GA 2EQAA 5DHSA 3RUAA 4IQGA 4D97A 3WMWA 1EESA 3VJLA 3H9BA 4TQ9A 4MYCA 1OZFA 1WXQA 3ZHXA 2PJDA 1Z5ZA 5TQ0B 2JIDA 3L6EA 1COWA 3SSMA 2A9JA 2PYZA 1BOOA 1QO9A 1VJRA 2GTHA 2ONJA 1YS9A 1E9SA 3IJ5A 2PNFA 3MFYA 4OUDB 5ALRA 5KCMA 5DI3B 3C6ZA 1U65A 3X0DA 4ZQEA 3HU5A 1V16B 2QPOA 2VH1A 4FKMA 1M2GA 5IT9A 2EZUA 1PGQA 2Q50A 1OWNA 2AI1A 3PBKA 3S2IA 4QU9A 2FWJA 3BOSA 4PCVA 3AI1A 4JEUA 4MYUA 2DE0X 2Q27A 3K35A 4I4TA 4Q9DA 2JJ1D 3F7MA 2I87A 2J07A 3JYNA 3E9YA 4MQ4A 1T3LA 1ODFA 5JSYA 1G6KA 2AE2A 2PZ8A 2E1RA 1N32B 4IMRA 1NNI1 1MU0A 2B98A 2ZQZA 2WNIA 4CKYA 1BE8A 3AUKA 3LYHA 4NTZA 4U5XA 2W9XA 4Z6KA 3CB4A 4ISCA 4GPEA 4B34A 2YICA 5C35A 3UBTA 4A8JB 3SC2B 2UVPA 4JYCA 3LRPA 1V1RB 3H18A 2C3UA 1A9YA 1XEAA 1J49A 2BJHA 5I4BA 2PBRA 1NVWQ 3JS5A 1ND6A 1A7UA 2QVGA 4M36A 2XBMA 1EFKA 3ZQUA 4RCVA 4LXHA 4YHHB 2OY0A 2VKQA 4GFDA 5F1PA 5HKAA 4DMRA 3MOGA 3QG1A 4AULA 4ZV7A 2MDTA 2FE4A 3FHTA 2DR3A 3T9DA 1U1IA 1G2QA 2CFRA 4QOEA 2QB5A 4K1LA 4QOHA 3D8RA 4YRGA 1MO2A 2R84A 5J2TA 2QW0X 1S3SA 1UBFA 3ROTA 5KJEA 4BLPA 1X42A 5ARCA 1L7OA 3O73A 4EQ6B 1A71A 2AC4A 3I2YX 3B70A 4YACA 4D2IA 621PA 1TFUA 2I4NA 4QGBA 2JFFA 1YAHA 2M2IA 2RG1A 3BDVA 4BFSA 4EB6A 3QUSA 1CUJA 4OTZA 4RKQA 2ZRJA