2XYGA

Caspase-3:cas329306
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title In Silico Identification and Crystal Structure Validation of Caspase-3 Inhibitors without a P1 Aspartic Acid Moiety.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2010-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xygA00
2CJYA 3GJSA 5IC6A 3V55A 3ITNA 4I1RA 4ZVOA 5IAKA 2XZTA 1K86A 5IANA 1RE1A 1SHJA 5K20A 4AWAA 3NR2A 1RHRA 4QUJA 1F9EA 4AWBA 2HBRA 3R5KA 4QU9A 2HBYA 1RWKA 1KMCA 4JQYA 4ZVUA 5I9TA 5IAGA 1QX3A 3V4LA 1QDUA 2QLBA 2QLFA 2CJXA 4NOJA 1IBCA 2C2ZA 2Y1LA 3DEHA 3EDQA 4EHFA 2CNLA 3DEKA 3KJNA 4QUAA 2C2KA 2H51A 1RWPA 5LUBA 2DKOA 1NMSA 3EDRA 2H54A 2H48A 4NBNA 1RWXA 5IASA 4QUHA 2J31A 3IBFA 4JR1A 4D3ZA 3DEJA 4N5DA 1QTNA 3PD0A 4JJ7A 3SIPA 3P4UA 3NKFA 1GFWA 1RWMA 3DEIA 4JJ8A 3H1PA 2J33A 2FP3A 2QL5A 4JJEA 3PD1A 5IAJA 3IBCA 4QU0A 4EHHA 2CNOA 4I1PA 4QUEA 4NOKA 4ZVRA 5JFTA 4ZVPA 1I4OA 3S8EA 4NOLA 3R7BA 3QNWA 1I51A 3R7SA 2FQQA 4EHNA 4QU5A 1PAUA 4D3YA 2XZDA 1GQFA 2XYGA 2XYPA 4N7MA 2C1EA 3SIRA 1RHQA 4EHAA 3H0EA 2C2MA 2CNNA 3PCXA 5LU8A 1ICEA 1SC3A 1NW9B 4PRYA 4FEAA 1PYOA 3D6FA 3P45A 4HVAA 3E4CA 4DCPA 5IBCA 3V4OA 3S70A 4QTYA 3OD5A 2H5JA 3KJQA 2H65A 4HQRA 3GJQA 3R6LA 3R7NA 1SHLA 3BIJA 2AR9A 1M72A 4D3XA 4JQZA 4QUIA 4AW9A 3UO8B 4QTXA 4EHDA 1RWWA 1F1JA 1SC1A 3RJMA 3UOAB 4QUGA 2H4WA 4DCJA 4N6OA 2CNKA 4NBLA 4ZVSA 4FGUA 2HBQA 5IARA 1CVRA 2J30A 4JR0A 2XYHA 3D6MA 4QULA 3V6MA 3GJTA 4IYRA 1NMEA 4N7JA 1RWVA 4ZVQA 4NBKA 1SC4A 5IAEA 1BMQA 1JXQA 4JB8A 4PRZA 4QUDA 5I9BA 5LUAA 4ZVTA 1CP3A 1RHJA 4IEFB 2H4YA 4N6NA 5IBPA 3V3KA 3H13A 2H5IA 2QL7A 3NS7A 4JR2A 5H0IA 1I3OA 2WDPA 2NN3C 5IC4A 1RWNA 2CDRA 4FDLA 4FXOA 3D6HA 1K88A 2FUNB 2QLJA 3H11A 4EHLA 4EHKA 5LU9A 3GJRA 3V6LA 2C2OA 4DCOA 5IBRA 4QUBA 4HQ0A 4LSZA 4EJFA 2Y0BA 4PS1A 3R6GA 2P2CA 3K7EA 1NMQA 1RHUA 3KJFA 5IABA 4N6GA 4QU8A 2HBZA 2QL9A 3R5JA 2K7ZA 2J32A 4NOMA 1RHMA 4M9RA 1RHKA 3H11B 1I4EB 4PS0A 1RWOA
chains in the Genus database with same CATH superfamily
3UTDA 3VR4A 2FPGA 3KZNA 3DZIA 3F46A 2JATA 3ITNA 4J0DA 4HRYA 4QC2A 3FNQA 4D6PA 3ZZMA 4OQ4A 2YOHA 1IU9A 1M2WA 2I1QA 3OPYB 4PPYA 4R9RA 5AHXA 4YWJA 3EXFB 5KZMB 1QBGA 4IFIA 1XQXA 3MAJA 5DLQC 2REOA 4ILKA 4X8LA 1S9DA 1SCUB 3JQPA 2GO1A 4ZT2A 2JLUA 2X3YA 4QJ3A 2FKNA 3KKPA 1NXTA 4E5UA 2O6HA 5JS7A 2PT5A 3WL5A 3K5IA 3E1SA 3NTLA 2H8GA 2CCKA 1KIMA 2O0HA 1T9HA 3M83A 3N05A 3V9PA 4K9RA 2OXRA 2IDZA 3C7KA 1G17A 4PQYA 2IV7A 3DAYA 1PR6A 4ARZA 3LP5A 5CB4B 1T4CB 3GVHA 3AY6A 1RJ9B 1H9CA 1WWKA 4IGAA 3UCFA 3C39A 4L76A 4M86A 1MMFB 3YASA 4WKNA 3CNNA 2AKAB 2QNBA 4WD3A 3WYAA 4JI8B 4TKUB 4F9EA 2JGMA 1XQYA 4JITA 3NP9A 1FTWA 4P31A 2WSSA 2ADFA 4DIKA 4YB8A 1TE2A 2N3ZA 3H86A 4NV0A 1KAQA 2G1PA 4Y18A 3HCWA 1JU9A 1QBKC 3BK2A 3G1WA 4HSGA 1Y5RA 4D9HA 1PJ3A 2GNOA 5A4FS 5KJFA 2BZ1A 3R3SA 5EQJB 2X9VA 3T5BA 3AKDA 4KQWA 3L0BA 5CXSA 2EEZA 1J33A 2H18A 1LY1A 3QU9A 4HDSA 2GZSA 1DX6A 2C9ZA 3BX1A 4M7PA 5J59A 5BWCA 2R8XA 3CW8X 4JGIA 4CNQA 2H7VA 3IAEA 3VAAA 1EGVB 1K4KA 3CO5A 5HGXA 4X62B 2RH4A 3A10A 5DOVA 4AUEA 1KY3A 2O8FB 5IWAB 3JYLA 2G4CA 3ENVA 2QE7D 2VHQA 2XPCA 4I9HA 4M7RA 3RJZA 4WX2B 3ZVRA 3ZCTA 1SELA 2PZEA 1Y8RA 2EU8A 3KSZO 4EHDA 1GU1A 1LTHR 3LQRA 5JTUA 3D8TA 3TLEA 4QWWA 3L8DA 2MR5A 4B7AA 1ISFA 3QF7A 2OD9A 4AJNA 2A0YA 5GOTA 1E96A 4M0LA 4B7XA 2OGZA 3BRWD 4DWVA 2WA1A 4C1NA 5DNUA 5B2FA 2CL7X 1FXUA 4PRZA 2VCHA 3H9GA 3SIXA 4ZVTA 2NWQA 2HPZA 3H04A 3ND5A 4RIIA 1RLJA 3LQFA 5HUHA 4A2CA 5I4IA 2B1GA 3LUKA 4IWXA 1CRPA 2JAPA 3GCGA 3U4CA 1ECGA 2ZJ0A 2VXYA 4K46A 5DBEX 3VX4A 7MDHA 1QANA 3W4KA 1VSTA 3TD9A 5IAOA 2XE8A 1CQJB 1JYEA 4YH1A 1NT4A 5AJUA 4UAUA 1VRWA 3E9QA 3I09A 3TLYA 4CF7A 2VTVA 4GLOA 2HFJA 1P9OA 4UFNA 4D57A 4M53A 1T1JA 1QTIA 1H6AA 4Y0AA 1XKTA 2VG8A 5L6MB 3K70B 2WSYB 1E2EA 3H5VA 4EPVA 2XAUA 4ECEA 2C77A 2ROQA 2CXXA 4MX8A 4D0GA 4EPWA 4HGNA 1HRDA 1N8TA 3TMYA 2WTMA 1UFRA 1AB6A 1DCTA 1OJ7A 4D25A 3B6ZA 5ILOA 1Q5PA 2PT9A 1W30A 3UPDA 4MYUA 1KPHA 3BH7A 1U3GA 2HMUA 4MWTA 5BNZA 1MRZA 1OYOA 2AZDA 4FFNA 4YREA 2Q1YA 3D0RA 3WZMA 2HA6A 1SZDA 3A9RA 2J9ZB 4MPDA 3B8EA 3KZOA 4RPHA 1PV2A 3OWOA 3VI4B 2CMDA 4MYSA 2D1YA 3DO6A 2B99A 3AEXA 2GF9A 3KSRA 2VJQA 4RX1A 1TZ2A 1BROA 2X5XA 2P9EA 4JELA 1X2EA 2FPPA 3OZGA 1VG9B 3TBKA 3QU2A 1N2CB 2BCEA 1CFJA 4EKDA 2PLFA 4UHEA 4QRIA 4AUNA 4HGOA 3MS2A 3V7FA 5LL6P 1SKBA 2D8AA 9ATCA 2PWYA 2A1UA 4FMCF 4NZZA 5D6NA 4Z0HO 421PA 4DC1A 1MGOA 5JPCA 4S0XA 3TW8B 4HFMA 4WJLA 4ZCRA 2A2ZA 3CC8A 1C7QA 2Q7OE 2D5IA 1XZCA 1E1MA 3AHGA 4KN9S 4UNNA 3FVWA 5F3RA 3T5AA 1FFYA 2FRXA 1X1SA 2QYOA 3ESXA 4ZHQB 1XNQB 1FFCA 1T24A 4YPOA 3PQCA 3BHMA 4ANFA 5JFGA 4JC8A 1L4KA 3EJ6A 1PGNA 1F51E 4Z2YA 1XYVA 2J5KA 5CEEA 1KU6A 5K6AC 2QGNA 1C0LA 2GN0A 4TWJA 3RS0A 2YQZA 1HC7A 4DRZA 3TVYA 5ADWA 5HUJA 1IUNA 1PZNA 5AR1A 2OHXA 2ZB4A 1VA5A 1S2LA 3RB8A 1KIFA 8AT1A 4GPD1 4BBZA 1NI4B 1RLTA 2ZRNA 4KDRA 5FCDA 4OHXA 4FWTA 3E53A 1U5BB 1ISIA 3TIXB 5JXIA 5EC8A 3IP1A 4HJXA 3OI7A 1DTEA 2FETA 4PLVA 3QJYA 3BQNB 3WGUA 3EGCA 4RS3A 2B8JA 3I30X 2G72A 1TJNA 3AEYA 5DNVA 1I3MA 2ODNA 3MOIA 5KNDH 2GHIA 3M6UA 1DO2A 1Y4DE 3Q5DA 3Q7QA 5ARBA 5KNCH 3OJ0A 1TM4E 2PMKA 3I72A 3ZX4A 1NQVA 5FI0B 5C51B 1JG7A 2FQXA 3I53A 3GMSA 1H2FA 1TFUA 2ZWVA 3QU5A 4IZHA 4R9NA 2XEDA 4BJ3A 1JLLB 4RA9A 4UE2A 3OESA 1UFVA 2E5FA 5A4JA 1YZFA 1T6YA 3IXMA 4HQNA 4JR2A 3TZBA 3U4HA 3AKEA 3V42A 5FWXB 2E4ZA 4QGFA 4K6OA 3PXDA 3TDKA 2XB2A 3ZI7A 4HX2A 4MV9A 5E2IA 1QWOA 2I3BA 2NM0A 5K1ZA 4C22A 4WLOA 2OYRA 3TQOA 1I2DA 1V48A 5TPZA 2RBEA 1CIJA 1G291 5B1SA 3CYFA 3V4RA 1R8QA 3BPSA 2H63A 2SBTA 3IVRA 1M6VA 5A62A 3WFJA 2W4QA 3B7WA 3SJ7A 4BZQA 4ZV4A 3ZS8A 4KH1A 1YI1A 1V16A 3KFXA 5CCDA 4C20A 3EGIA 2IXAA 2ZE8A 4HI0E 5B58T 2PSDA 5ERGB 4EA7A 2IW3A 1VE3A 5K20A 1E3WA 1P2FA 2XYQA 3IS3A 1I4EB 5AVOA 3RK4A 1IE3A 2VC2B 3EE6A 4HFRA 4D3FA 4F4IA 3GJ8A 4E30A 1YS7A 1WPRA 3F5FA 2XDWA 3EDMA 4PCLA 3TBFA 1Y42X 3H5WA 1H93A 3DCIA 2VOJA 1ECCA 1NMZA 4AJIA 5ECDA 5TMBA 2A58A 3KAQA 3P4XA 1KMCA 1J7JA 5ALLA 1L5LA 2XTAA 2Z5VA 2HJWA 5JEDA 2I3AA 5HUQA 5IMBA 1CRQA 1KEPA 1R0WA 4U3JA 2REBA 1TL7C 4MUXA 1FSZA 4Q39A 5HF9A 1N9KA 3S68A 3GFOA 5CFNA 1VKJA 2BIFA 3RO7A 5GIPE 1BQ4A 1WJGA 3NH6A 2F1OA 1JECA 2HLPA 2XUOA 3SHVA 1G8FA 2PVCA 4H4EA 3BHJA 3PQ3A 3CLUD 1D8TA 1LBEA 4H3VA 5EP4A 4B6SA 4C4TA 3MGGA 5IYZA 2B8WA 4LRWA 1QRDA 4IJKA 1QOQB 5AJXA 5DRYA 1ZH6A 2A9PA 3TQFA 1OXXK 1ZAYA 1G2OA 1P1KA 5KPJA 1E66A 4NBRA 3R7WA 1I7QB 4X6UA 2BFFA 1MW8X 3E3LA 4JODA 1CQXA 1XD8A 5TJ9A 1FDTA 1W44A 3QYJA 4K3UA 4PHTA 3G1TA 5BN3A 2GM5A 4II7A 4LE2A 5EP3A 1KFCB 1QO9A 3I83A 3HFGA 4ZYYA 1L5MA 3AHDA 4UU8A 4HC4A 3VNQA 2CZGA 5KWSA 4C7OB 5T4FA 1VJCA 5C7YA 2YZMA 2QGFA 3NBKA 1T25A 3QVWA 4CI9A 5FWXA 4F12A 1A2KC 5FEMA 1DIAA 2EKZA 4QYMA 3STVA 2AUTA 5JY1A 2IH2A 1ENZA 3QFRA 4EF4A 1VYTA 2WU3A 2H6EA 5F1PA 4UUNA 2YFKA 5IX8A 2AOTA 1BS1A 5ED0A 4D43A 4DSZA 3JW8A 1Q0HA 3V8VA 2DKFA 1IXYA 2XA1A 3EIXA 4E4TA 1UEIA 3WNCA 2ZUEA 4L5BA 2YS7A 2ZKLA 2QN8A 1SVNA 1ZL2A 1NR7A 3WL4A 1DTWA 1YZGA 2IYYA 1GPJA 4QL3A 1C1HA 1HSZA 2C1ZA 1JPNA 3A1WA 3ZKAA 1SM4A 1U2GA 2AW3A 2ZAMA 1ATIA 3JV7A 2ATIA 1GL6A 2PSJA 2A35A 2I4TA 4J1SA 4PO1A 4UATA 5DK6A 2GLUA 4XYBA 3WHPA 5DWDA 4N5NA 1MP0A 4D98A 4EG5A 4B6OA 4RKYA 3MJCA 2OBMA 5LBUA 1Q1EA 4D4LA 1JEOA 1P62B 2JI9A 1EWQA 4R51A 4P4SB 4INAA 4OJTA 3SC3A 4CQJA 1NBHA 1SO8A 5AVWA 1STOA 4C0LA 5BUCA 2H4HA 2PS3A 3M9WA 3HO8A 3T7DA 4CKEB 3DBRA 1I3OA 1YE8A 3RVLA 3U4IA 2XMQA 3R3ZA 3B82A 1Z7GA 4HQOA 2J9YB 3Q88A 5K4GA 2QY9A 4Y2SA 5CBPB 4HDKA 2QLJA 4RPGA 3KYCB 1IEVA 3OPVA 3FSRA 1H4SA 2HW8A 1XP5A 1TK3A 1G7SA 4WCFA 1QHSA 1SIWA 1JW9B 1PGPA 3BGOS 1PJBA 2EFEB 3CEMA 3Q3HA 3W2FA 4BZWA 1KZ1A 3WHLA 4QKQA 2HA5A 3BL5A 3CZ4A 3HPQA 1TKBA 2BFPA 1V9CA 1Q1GA 2YNMD 3L92A 4BO6A 1W4BA 2OLKA 3ZJYA 2WJYA 2XWQA 4YCMA 4AI6A 4I36A 3U7FB 1V6SA 3BCSA 3PE6A 2ZYGA 3JQGB 4UUQA 3GZ4A 5F1YA 3B9BA 4FD2A 5HOEA 2XRYA 2W6OA 4WXYB 4LYFA 1I0IA 4ZK2A 5LNK1 1FNSA 3ACCA 3R0VA 4LY3A 1QE5A 1AKQA 2EYQA 2HHAA 2X6TA 4WXMA 2AFHB 2GFQA 4L5AA 1VCNA 2C0QA 2QQFA 3G85A 1JLHA 3NHSA 4F6CA 1RT9A 2I2BA 2O20A 5JH7B 2V6JA 4CR7A 4XWAA 3VJLA 3ZYZA 4EITA 3LJKA 4L4ZA 1YKFA 1GKKA 2ZU6A 1L8QA 3JVEA 1QDUA 2F8MA 5TIIA 5C31A 1Y7PA 1RRMA 2UDPA 4V39A 2CVOA 3J7AC 2VNSA 3W8NA 4PHCA 3VJKA 4RF3A 1J70A 5KTNA 1GRCA 4TWZA 3R5XA 3KHSA 3OLVA 3ZY4A 1DX9A 3BJRA 4OLJA 3NCHA 1T3GA 4ND2A 4H7PA 2KYRA 4D0NA 4JJKA 4GE3A 5CG1A 3I9KA 1BEZA 4OXKA 1L6IA 2WT8A 4TXHA 3KWJA 3D1LA 2VJYA 1EH5A 1IULA 4DMGA 3KZXA 5IRCD 3DDWA 2ID4A 2RKOA 1DS6A 3ENZA 2O2JA 3ZWYA 1JPJA 1K5DA 3GGCA 4LXUA 4G6ZA 3LKVA 1Z4NA 4NE2A 4W7SA 5GONA 4YQEA 3CUUA 2R6CA 1L7EA 1FW8A 3GVPA 3UBTA 5F2OA 4A26A 3PQ2A 1SJ9A 4B34A 1IDN1 4F84A 1AMOA 1JQ5A 5DZSA 4YXWD 4HDMA 3SXPA 3TXXA 5BNTA 6AT1A 3ZBPA 1BCSB 1U3DA 4DBVO 4N3AA 4QDKA 1E20A 2PRKA 2B6HA 3AHFA 3HFRA 4MVJM 4YRPA 3UV3A 2WM3A 4BVKA 3RSOA 1VJ0A 2JA1A 1JEEA 2BD0A 2FYTA 2PRZA 4WNIA 4A0FA 2HKIA 4JB3A 4YO8A 1FFEA 1U3FA 1UC9A 3B1WA 1JPUA 3VU3A 1LRKA 3WMEA 2BONA 4BMNA 1OR8A 3VNRA 4Z2AA 1LC3A 1P1BA 3T7AA 3BWCA 3VO2A 3HUUA 4AKGA 3SR4A 1SBZA 3A31A 1GGNA 1CF2O 1I5OA 2ZRDA 4A0HA 5A02A 3CLRC 3B1VA 4REQB 3Q8XB 4LGYA 1CJMA 5HDQA 1F8YA 2WIDA 2Y3IA 3KTOA 4P5PA 1HT1E 4FCVA 3C3XA 3ZI4A 1XLTC 1VM6A 5K3OA 3FIUA 4OGKA 4ZCPA 3ONNA 2JFVA 2GJKA 1BDMA 4IIYA 1QCDA 4I4TF 10MHA 2XQJA 2FZLA 1D2MA 2DHRA 3B3QA 4GVLA 4OAQA 5DTRA 2FMUA 2P6MA 2OUKA 2V7BA 2XGMA 2QTVB 3K73O 1JI3A 3P0HA 2XT9A 4BP8A 1RAFA 1T8PA 1UDWA 3QE2A 4PQEA 4HAXA 5D5PA 4Z3OA 3EF3A 4PCUA 2YXLA 5L7YA 1C8LA 2PKWA 1DBIA 2YS6A 1XDWA 1VE9A 2ORYA 4XLLA 3DPUA 1RKQA 2QRZA 4G8BA 3ZDDA 2QTNA 2IH4A 1H9BA 4WZAE 4LDAA 3D8UA 2XVAA 3JD1A 3HVKA 1E2HA 1ZI8A 3IERA 1QIKA 4M9SA 4OBBA 1V41E 4BVGA 3BB4A 2O57A 3KP1A 2XWPA 5CGZA 3VSCA 4RFVA 1DDIA 4EJ0A 3LLCA 1I8TA 3RFUA 2CXNA 3KXKA 3LLUA 3GZTB 1G8SA 2A0WA 2BSQA 1W6RA 1M10A 1SCUA 1H94A 4DYDA 4EPRA 1PV4A 2IYNA 4K8RB 2IUYA 4CL8A 4ALMA 5ESDA 3NW9A 2UVQA 1TUIA 2DG2A 1JIVA 4O2BF 2NVWA 4PZPA 2G6TA 3TOCA 3PPWA 2PIDA 3HTXA 5CPFA 1OHHD 2O7VA 4JL6A 1V8BA 4TMKA 3ZTYA 4DAOA 2OR3A 4OP2A 3VNAA 2Q5IA 4M36A 2Z30A 4QQNA 4NWIA 2QENA 3RBZA 2BEVB 4JLKA 3UHJA 2EWVA 1TMKA 1U0JA 5JW6A 5YASA 1KL7A 3DLBA 3GLVA 5J9FA 1Z15A 5G1PA 1FVHA 2Q9BA 3MJSA 4BLWA 2EZ4A 3EGEA 4M3NA 3OJXA 3OU6A 3CW9A 1E77A 4DCTA 3TQIA 4LY9A 3K2BA 3CTPA 3L0CA 2JFPA 3VKHA 1KP2A 4MCAA 3QJGA 3USZA 2VQ3A 4IW3B 3WNVA 1C3EA 3QWHA 4BMOB 4CT0A 2YZGA 2WUFA 3KLBA 4BNYA 2Q5OA 1NVFA 4KWIA 2PGAA 4EYEA 1MVNA 4N47A 4BVBA 1C7RA 2OD2A 1SB9A 2BJWA 3A1TA 2JVKA 1CY7A 3LSYA 4V0QA 4KO1S 5ALOA 3REGA 3HXTA 4OAOA 1CW2B 3JQ7B 4U5QA 4ESVA 2GM3A 2DSTA 4YALA 4KNYA 5EIHA 4DB2A 1PR2A 1U0NA 3U61B 3KCNA 4IO0A 2ZI9A 2B36A 4MEJA 5EXDA 3RASA 3KJZA 1N92A 4MI3A 4F4JA 2ZS9A 4QFCA 3UA4A 1BDJA 1J06A 1G21E 3WGJA 3WB0A 4C0XA 1W5AA 1XD2A 5JHGB 4LWQA 3CO0S 3DF7A 4HEA1 5C2JB 4RAQA 4RMJA 2P75A 4A8TA 2W2LD 5IVPA 2O7SA 3JXEA 2BBOA 3KSUA 2P5SA 1X1DA 3DWIA 5AW5A 1QJ4A 1KE1A 4OHBA 3H65A 3TS1A 4XVUA 4UDXX 4N6NA 1T1GA 4PLTA 2V7UA 5EHZA 1G5HA 1ZY2A 4CN8A 5LJIA 1W4RA 1YSCA 2BKEA 2FWIA 1SCIA 3F49S 5A4KA 2AN4A 4UM9B 1P0FA 2XXBA 5C8XA 5K3CA 1VIAA 1UC4B 2I9KA 4ZAFA 2QVXX 3KB1A 1OBVA 1TGVA 4AIIA 4C78A 2FA9A 1C2YA 3K5HA 1L1FA 3WJ7A 1Z25A 2YV4A 5I48A 5ISMA 4HEHA 1EWTA 1KPIA 3ISTA 3KM0A 3W8RA 2YL2A 1OWLA 2F1IA 3K53A 1ODIA 2XOEA 3CF2A 3IMKA 5EZ6B 3WGYA 1SKYE 1TKAA 2Z4SA 3LF1A 4UCXA 1QF7A 4FCTA 5M34A 1EB9A 1RAEA 1Z6TA 1M5RA 1GPAA 5G0TA 4E94A 2DHCA 2YZKA 4O1MA 4P34A 2HPVA 2J6BA 2J32A 2JFOA 4TL9A 4TSFD 1CD5A 2CXHA 4WXPA 3RT7A 1VI6A 3BGDA 1MQSA 2R1TB 3A6DA 1U6JA 3BQ9A 4PC1A 1J5XA 4N3NA 4TYQA 5TQ2A 4ENVA 2VSFA 4DLZA 4OHYA 2ATXA 1EK6A 1V4VA 3STTA 2E7ZA 4A5OA 4BO5A 4TZTA 4HTFA 4PICA 3C3DA 4RY9A 3MJRA 3EGXB 1LLFA 4BPRA 4N3CA 3K6SB 1OIWA 5KB3A 5I9TA 1Z6PA 2Q1UA 4KVZA 4ZQIA 4MIKA 1OYVA 1MDBA 2AG5A 4NOJA 4Z8XA 4P4LA 2HQBA 1P29A 4AKSA 4O59O 3PNLA 4RSMA 3UYLA 4PSVA 5AUNB 5BRNA 5LLSA 3OSZA 2PGDA 1EJ6A 1XMIA 2F9FA 5LSAA 2GI4A 3SF0A 3CMCO 3L18A 1Y34E 2CN1A 5F7OA 1SA0B 3SDSA 1JXAA 2WJVA 1Y4SA 2RGAA 5E8JA 1KGDA 4ZDWA 4KVFA 4GC9A 4LRTB 2CLEB 5EZ5A 2YJ6A 1YTLA 3PCTA 3VPGA 2WC1A 3X1JA 2RHJA 1DAPA 4C3ZA 1KTIA 4DRXA 2GCGA 4JLSA 4UHHA 2OXFA 3DL0A 2YY6A 3FHLA 4I1SA 4TLMB 3OETA 1BDIA 3PXUA 3JVIA 2KBFA 1N2GA 4HWPA 4R8MA 3G79A 1EK2A 5KYGA 2IUFA 2OWEA 5FKJA 2FU5C 1CJSA 1RYEA 2AR0A 4D45A 5BVHA 2JAUA 3SJUA 3OPYA 4UNIA 6REQA 1K8YB 3LI2A 3S5JA 3I01M 1MOSA 3IQXA 3K0CA 5F73A 4HNUA 2GZ2A 2JIZA 3TRIA 1CRWG 1V0JA 2ZU0C 4FHCA 4QDOA 5JTTA 3CONA 1ONPA 5HJ5A 3DULA 1ZQ1A 4M87A 1LPMA 2A3NA 2C5HA 1JI0A 2GGSA 4FYVA 1Z28A 5E6SA 4BRWA 1EM8B 2P30A 4NYMR 5EXSA 4YPFA 4ED9A 2GERA 3D4LA 5EOVA 1WZUA 5JRZA 2B1IA 2AXNA 4TUYF 5BXQC 2M1XA 4JZYA 1NJ6A 5DU2A 3V6MA 2QQ0A 1LC0A 2CLFB 3FZEA 3OM8A 4LTNA 1Y6JA 2F3RA 2PWBA 2JAOA 1OWNA 2H1RA 1K9SA 2XVYA 2XR1A 5HIJA 4DRXB 2HIMA 1Z29A 4TVBA 3PFWO 3NS7A 3OKFA 4RE5A 2VH2A 3V1NA 1T3TA 1FNNA 2JAWA 3E9YA 1BWRA 3CF4A 4RDCA 3D3WB 2QU7A 5AH0A 3UWOA 3VC2A 3KRTA 1N2HA 1W49A 1WV0A 1UADA 3NX4A 2XRZA 4UMDA 3S4YA 3VOSA 3AVWA 5AVJA 5C18A 2OHJA 1UJCA 1G2IA 3B8HA 2GCEA 3CG0A 4QUBA 1WXWA 3QYAA 5E2BA 4CCYA 4ID3A 2Y67A 4R5HA 2Q1WA 5BOVA 2WZCA 2Z08A 2X9LA 3GRRA 4BO1A 4DJ5X 1HK7A 3B1XA 4Q3NA 4AULA 1XEXB 2VOEA 4OP3A 3PX3A 3S28A 4QT4A 3GWGA 4HNVA 3BUSA 1B00A 3SP1A 4J43A 5JASA 2VQSA 3TRFA 2WYHA 3H5IA 4YECA 1AH2A 2BAGA 2YOGA 2GH1A 4V2UA 3ZWPA 3OZ7A 2HSWA 1MTOA 4MYTA 2UVPA 1B41A 4JYBA 2V55B 3OM9A 2IBMA 4FK8A 4D9KA 3CWCA 1SBNE 5DT9A 5KNCD 4Y6OA 4GZMA 2QX4A 3AXSA 5EIXA 4EM6A 2OENG 4YACA 3QEOA 2XWJI 3NG1A 3M49A 1HDZA 1AO0A 2DUMA 5JYBA 1A9PA 1QYWA 1J24A 4BCDA 4LGVA 2GXAA 2EG5A 4OX9Y 3U48A 1N8KA 2C7GA 2NO7A 1XZFA 3SQMA 1OXSC 4OVKA 4B3XA 1IWPB 2WHPA 2OVBA 2DR0A 4C30A 5AW3A 2PS0A 1U4SA 3FUWA 4UW9A 3BZUA 3HSYA 4JC5A 4MVJE 3KQSA 2O5RA 1Q11A 2Y99A 3LFTA 2VYND 3HJGA 2FW9A 3T41A 3WKEA 5TS3A 1V6AA 1ZD8A 2W71A 4ND6A 4HB0A 3ZEIA 4A8HA 2RGRA 1YWGO 4JBGA 1V3TA 2JFHA 3EGDA 2MTBA 3DEIA 1CUJA 5EJIA 4DIFA 2QL5A 2CXOA 1C7JA 1NW4A 3TLGB 1HY3A 1P4AA 1J2TA 1LSOA 1KQOA 1P77A 3QKTA 4IY1A 1P2DA 1W85A 3E82A 1A8PA 3MC1A 3VPFA 3GCDA 4HXEB 4WK0B 3UICA 3IDZA 5NLLA 4X6YA 7REQB 1NMXA 1R6AA 4LF8B 2G9ZA 1FL9A 2YKGA 1T36B 2EW8A 1CR2A 1JR2A 1RBMA 3EGXA 1SUSA 2KQUA 4ZT5A 3WLQA 3DSRA 5ICMA 4L16A 3IB3A 3VNSA 2IY9A 3PSHA 5DM60 5K2MA 3D8HA 4N0PA 3W7VA 5LZ2A 1V8FA 4WFIA 4HDCA 2KB0A 3ZCUA 2NU6B 2AWOA 4G56A 5ICCA 3AETA 1S4MA 1DAFA 4MWGA 3S1AA 3FXAA 3K1AA 4ZZIA 2FXVA 2XJ4A 1PHRA 3EW9A 2X3UA 5LDDC 4M89A 2VKTA 3GLGB 2BRUA 4ND4A 3V7WA 1T4GA 3OHMA 1Q15A 2XYHA 2QRGA 4IZ6A 4FYWA 3TCKA 3AWIA 3PL1A 4HS9A 5JQGA 4MDFA 3S3TA 1NR1A 2UVPB 1KC1A 5LUAA 4PZUA 2BFBB 2O3SA 4RJKA 5I4CA 2BUBA 1KAHA 3WMRA 4IF6A 2XCLA 4CGYA 1OOEA 1NIJA 1UM9A 2PGNA 4ZDKA 1QDLB 3WRYC 1FP1D 2HWUA 2GPAA 2B98A 4RL4A 4R1OA 2BE9A 4C14A 4E4RA 2R00C 2D5CA 2NO4A 3IQFA 3WRWA 1NWHA 1NRIA 3ONFA 3OZFA 2D0IA 5CEJA 3QV1A 3IJEB 4O8ZA 1KZ6A 3H2YA 1MC8A 5HZHA 5DYYA 4BX8A 9GPBA 2BHSA 4LSWA 4AWXA 1AKWA 4DCCA 3F5SA 1X74A 4YCCA 2QNIA 4A8JA 2P9BA 3WNQA 4E07A 4QM6A 4DILA 3LE8A 5AW0A 4BNTA 1XD2B 2HNAA 4TYPA 3UQZA 1Q1BA 1R1DA 3ZZUA 1ENOA 1KFBB 2AN5A 4MKZA 2QXTA 3U5ZB 1JR3E 4NATA 3HBLA 2XVXA 1J2JA 3TJZA 1IN7A 1TZBA 5HQTA 2INGX 2IKSA 2HGZA 3RIHA 2QAGA 5EMNA 2C88A 4LKOA 4BGIA 4KB5A 1H05A 1XAIA 3N2IA 3O2QB 2RI1A 1L7NA 4V0RA 4BMXA 2W6ZA 1CZUA 3A7EA 3FPEA 1W19A 2NT3A 1TIKA 2NU9B 4MB0A 1G9XA 4AJLA 3JQAA 2I71A 4BC1A 2HZ7A 7YASA 2R9VA 3MT7A 3IUEA 4QGBA 3H4MA 3OTHA 3WYFA 5A5FA 1J5EB 3M33A 3L0SA 2E37A 1TMOA 1HFKA 1NKTA 3IR7A 3JSXA 1FS6A 5DNWA 4NEQA 1D2GA 2H1IA 2ID7A 3UYKA 5FDFA 2WYIA 2HMSA 1M8GA 5KOHA 1JP7A 4RC9A 1NL3A 1BHJA 1J97A 3FKQA 1AKVA 1KA9H 2CDAA 4LCEA 3LCCA 2D6FA 4M83A 4R2XA 3VAZA 3GC6A 1R4MA 5AHRA 1DWUA 3EX7C 3OT4A 3QX3A 3D5QA 3KJHA 5BV7A 3PDCA 4MRRA 2M6KA 4RK6A 5AW2A 1YAHA 2FW7A 3RSZA 2O59A 2VTBB 4G4JA 4CLEA 2CNOA 2C54A 4M55A 4QUEA 3TH5A 2H2FA 1P2TA 2Y2UA 3S8EA 3ICCA 3FLMA 2BFEB 3SC2B 1LPNA 4G0YA 5HTOA 3RRBA 1KI8A 1R4NA 1N3YA 3CKYA 4RKRA 5LQAA 5LU8A 3ERCA 4PC2A 1II8B 3HKBA 3GVXA 1C1XA 3I0MA 5EYPA 1UJ6A 1UZMA 4FINA 2YJNA 4FYJA 4FDAA 1E2QA 3FVVA 1F38A 1UKVY 2MMCA 3G0BA 4LZOA 1YCHA 5AKYA 3KOWA 1NXWA 4J07A 5D3MB 3A6LA 1Z22A 2Q2VA 3VR0A 1JR3D 1QZTA 4QTUB 2CV1A 1ZJYA 3IYLW 1NNLA 2AI3A 3FG9A 1D4FA 1GT6A 2A57A 3UOAB 3WHIA 5KWVA 2R3SA 2AOVA 3H8VA 4HBGA 4IIBA 3U31A 2O2DA 4DC9A 3F1KA 3C16C 1U8TA 2XUPA 4GE0A 3WTBA 4BEBA 5LOVA 1EFPB 3QBDA 3REFA 3W1WA 2GLTA 2QGZA 3X0DA 1XLVA 4WW0A 1AZLA 1E1YA 1WX1A 1Z0IA 3DWFA 4AYWA 2FPSA 1PJ4A 4J75A 1YZNA 1MOQA 3WB1A 2WLTA 4UE6A 4DUYB 1Y89A 1B1AA 2IZ0A 3RKUA 2XNDD 1ZOSA 4JROA 4KR0A 1RS0A 1QS0B 1BTOA 1P2BA 2XKBA 3CLSD 3KDAA 1E8DA 2HRCA 3D3WA 5F2KA 3SYMA 4BU0A 5CT4A 4ITUA 3K94A 4YJ2A 1J09A 1QKJA 3V1LA 5JZSA 2WKQA 1PWEA 1Z74A 3E03A 1CJVC 4RO0A 4XSHA 3SXUA 4KITB 3HK2A 2RGUA 1U8FO 3N6RA 2BSAA 2GVZC 4FOTA 4LJ6A 4DV3B 4MRSA 3ZD9A 1YD7A 4TLAA 3TFQA 5LQKA 1OJLA 4HS4A 4QJ4A 5A0FA 3TW8A 3KTAB 5DULA 1EFDN 2G5PA 4YNBA 1NA5A 4RH0A 4LZNA 4ZI3A 2BM0A 4PXSA 4NXNB 1IN6A 4KFCA 3K1JA 1E0SA 3AFNA 5BVGA 1E9SA 3KVYA 5C9ZA 2P6NA 3HJFA 3KLNA 1VG0B 2BISA 4B4OA 3DD5A 3M6WA 3HRHA 2IXTA 3FIJA 1YL5A 2V9CA 1EG7A 4JEMA 1JHAA 3BWEA 1TA4A 2OCDA 4ISBA 5B4TA 1TTTA 5DTIA 4RPLA 3IBYA 1Z56C 4MP8A 1FJ2A 3JATB 3WK5A 3U1BA 1F0PA 1T1IA 1ST3A 4RTPA 3RJ9A 2YXNA 5DX8A 3Q9UA 3FOAA 4PFSA 1XMVA 4X8HA 1JG3A 3R0QA 5KSOA 5B64A 3NTQA 4TTJA 5K0SA 2R84A 2WWGA 4QBFA 3RYIB 2Z8XA 2VBCA 3CQ9A 4J4HA 4EBBA 5E8RA 2H4FA 5LXTA 2ZSKA 3PEVA 4XGNA 1MV8A 1WF3A 4FYMA 5CYFA 4YJGA 1OQAA 3TLXA 4WERA 5T41A 2A5FA 4PSKA 1K8RA 2HRQA 2JBAA 4MMZB 1NV8A 2HL6A 2PV7A 2QRMA 4PBTA 1EB8A 2Y77A 2Z43A 2ZDHA 1RQ2A 3CT4A 3Q6NA 1OB5A 2AIRA 3S2GA 3NVKI 3ZV5A 2WOJA 5TV2A 1MXHA 4ARCA 2E1RA 5CA0A 2IHNA 2Q6OA 3BGIA 4LJLA 3CRMA 1JJ7A 2XOXA 3MILA 4DIDA 1VPVA 1DIHA 2QK4A 3K8OE 3LVRE 3O2JA 1A8UA 4YHBA 2X2PA 3TNJA 3V4VB 5JV5A 3OTWA 3ANLA 2GPBA 3Q7RA 1P6XA 1RMQA 3S29A 2IBTA 3ENKA 4P22A 1E59A 3IDFA 3L93A 5ENDA 1YUMA 3I3SR 1PUJA 1MT0A 4AN1A 4EDFA 5SYNA 5B3KA 3FOFC 1R9JA 2WWYA 5I4KA 5FBKA 1TTQB 1BZYA 4W7HA 1NVGA 2XMCA 1H1TA 4JCCA 4CUZA 3RQSA 2PDAA 1T9CA 3WDLA 5TT0A 4EUKA 1W46A 2R6DA 4KPYA 2O4UX 1NE2A 4IFTA 2NSJA 4XWKA 1X1BA 4DNOA 1CIPA 2F1JA 5EJ8A 4YDSA 3OO1A 4ZQCB 1SOWA 2G88A 4S1NA 3UUFA 1DRJA 1EPUA 2Z6QA 3TN7A 2C5BA 4KGXA 4PSDA 3C41J 3VH3A 3HADA 2VH5R 4UMEA 4F4UA 3KQUA 3F4KA 1HNXB 2FEXA 5BW5A 4MV6A 5J58A 4G63A 1VLJA 2BELA 4LVOA 3ZNQA 5U9CA 2D5BA 3EFHA 1J99A 3T4UA 1VJRA 4JUAA 3K8ZA 1QVRA 4JB8A 5JNVA 6REQB 2IK8A 1ZVMA 3SN6A 3ASVA 2EX1A 4HRVA 5T8KC 3V34A 3TI9A 4GBMA 1IH8A 1OBCA 1CJKC 3I0ZA 3IPXA 1FFXA 2QM3A 4NH4A 1C4OA 2J3QA 4OQDA 2GHRA 5U4QA 3WI7A 2YN0A 1EJ0A 1RRGA 1W85B 3EQ9A 1B2LA 1VL1A 1QFXA 2EFHB 3AP1A 2FVXA 4RVCA 3A4TA 4CU2A 4R98A 1NX9A 3L1UA 3GOHA 3P9IA 4FT2A 3GJRA 4FEYA 5JATA 1SEPA 1T4DA 4ZGWA 1GTG1 5GAJA 2LKDA 4B85A 2I8AA 4MPPA 3TQSA 4DCUA 4B46A 1PJ8A 4AVYA 4N7RA 2P2CA 3Q40A 3K7EA 2O7QA 1NY6A 4I3FA 1PEAA 4FB5A 3SHWA 1RLOA 3HNOA 3OH8A 4UULA 5HS4A 5EJ4A 1KEZA 4IIDA 4V0KA 3EC1A 3IOYA 1WHTA 1K4YA 2EKBA 1TYBE 2VN8A 3T3GA 3MTEA 5KTSA 3OY7A 1IEWA 3OOJA 3FRIA 1KAEA 1JDUA 1P0MA 3GROA 4NF2A 4TYNA 1KVSA 1U2SA 4KU4A 1OPRA 2C7PA 4LMAA 2HGSA 3CEPB 1KK0A 3A9UA 4QUKA 1T8RA 3PC2A 3EEBA 4REQA 3NBFA 2PFGA 2CVHA 1GAJA 5KTKA 4WLVA 2Q4TA 3WL3A 1LFAA 1O57A 2IEGA 5ILQA 2UXDB 3IB6A 4LZPA 4RNDB 3QKSA 4KE9A 4RV9A 2E48A 2CJXA 1GGKA 2CYAA 4QNNA 4U7GA 2PFSA 2Y4OA 1BMTA 4KQXA 5I01A 2DSNA 4JP1A 4KAFA 2QU8A 3AESA 4DSTA 1KSFX 4RSHA 1ESDA 3D7SA 4JSTA 5DWQA 5EJ9A 3AVYA 1O6BA 3X1ZA 4KQ2A 1ODJA 2PKXA 3KVNA 3N53A 3NALA 3ZY6A 2GTPA 3GV0A 3L1HA 1TADA 2CF6A 5KYTA 2BFFB 3LCUA 1CV2A 2IC5A 1YR2A 3WRXC 2YV2A 3QMVA 1YNOA 4NI5A 5B7QA 3MWJA 1Q20A 1WSBA 5JQGB 4OQLA 2DETA 5SZIA 4JX9A 5CJJA 1REQB 2IEZA 4KRYA 1BVUA 2CZCA 2YNMC 3QBJA 1RWMA 5G2OA 6ABPA 1M1NB 3I62A 3TBHA 2X13A 3MUFA 3EQ2A 4C76A 4DLPA 1ZR2A 3ZZNA 3VU9A 1Z5UA 3B7PA 1FLVA 2CFTA 1K8QA 4C0KA 1YZQA 1L7AA 1NR5A 3PWSA 4NKRA 4FSXA 5K3FA 5EWMA 2JG3A 4FEGA 1RKUA 2YWJA 3MJHA 3U39A 9ABPA 4NDAA 3ZUGA 4JI3B 4IV8A 4DRYA 2J3HA 3DOFA 4C7BA 2IRWA 1E9VA 2OC4A 5CDYA 1EWVA 2PGXA 1M67A 2C9MA 5GINE 1V8DA 3Q2OA 4WESA 1QZ3A 3OIVA 5K0BA 4JUIA 1RJEA 2JJ8A 1SVIA 2QNRA 1QHHA 3K0BA 3CSDA 4JLDA 5AI6A 2W0SA 2YC4C 2O2XA 2TMDA 3AFHA 3IUJA 1PT7A 1TJ4A 4PNEA 3KXIA 4G9BA 4ZAXA 2OV4A 3RFCA 4U4AA 3EEOA 1IHDA 4DABA 1PR4A 2VZLA 4QNMA 2LVBA 3QMMA 5A1JA 4MIOA 3BXOA 1W5BA 2Q6KA 3FNFA 3RFFA 1A7AA 1Q1QA 3KZVA 3LX5A 3AO0B 1VP3A 1EYZA 4QIHA 1Z5VA 3N2NA 3UMSA 1ND5A 2DFDA 1MB2A 2QT0A 2Y1WA 1LDYA 3JWJA 4C7MA 4L5YA 2PUEA 4LBYA 3WICA 3WGTA 1NUUA 3GNLA 2ONJA 1G3RA 1OVMA 2BC9A 2XNDA 3HYSA 3LC0A 4R68A 1KF0A 5FPTA 1KJIA 2GCOA 1LDGA 1ZIYA 4ZU1X 3UC5A 1H2EA 4TGLA 1JAZA 1H22A 1FMTA 2R6ZA 7MHTA 1MVOA 3AJAA 4F5WA 1E3QA 2Z9DA 3V8RA 2ZBQA 1CF4A 2RKWA 3L82B 1BFKA 1DUSA 4JLPA 1ELOA 1ZCAA 4OMDA 4URUR 5K0LA 1LK0A 1ILWA 1TZCA 2F48A 2OZKA 3LRTA 5EIWA 1LA2A 3NV9A 3B5EA 1UQTA 4B6JA 4JAVC 1ORHA 2FFQA 3G9XA 4HGRA 4MGIR 3MHTA 3U4GA 2YY7A 1YCDA 2VJPA 4BNKA 5FWYB 1WTCA 2Q4RA 2YXBA 1GYRA 1XMXA 1QYCA 3GRVA 4Q6BA 1C14A 2X5NA 1HTBA 2C5EA 3L7CA 1QGYA 3OFSA 4MJ7A 3UCXA 1KEEA 2YRWA 4D82A 5I3ZA 1QH9A 1U0SY 2BPOA 1L4BA 5IAKA 1ZINA 3IR5A 2DPHA 5C8ZA 2OSBA 4Y9RA 2FEAA 4BO7A 3PIDA 3PXXA 3O93A 1IOWA 1EFCA 1P19A 1RHRA 3RIMA 4BNGA 4C4ZA 2VO1A 1K3TA 5DT2A 4B79A 1ZPDA 1BE6A 3K0CC 3Q10A 3TPCA 1KNQA 3BBLA 3KB6A 3NORA 3O3NB 4KL8S 2Q41A 4KI7A 1U8AA 2VI5A 1ODSA 4ZI2A 5BN1A 3I5AA 2XB4A 1PQPA 2ZUUA 3EDQA 4GMGA 4LNHA 4UUBA 3I5YA 1PK8A 3LMKA 3NYRA 3BQMB 4HYQA 5SY6A 5EJ6A 1UFKA 5C46F 1N6KA 1B7GO 2HMAA 2WF7A 3KDSE 4TMVA 2EERA 3WL6A 2NXCA 2ZVJA 2WD9A 3N2EA 4LJAA 5C1BA 2X9GA 1RM5A 1Y3CE 3MBOA 4MROA 3DMFA 3DCNA 4TXLA 3SYTA 1F3OA 2HSJA 3GFRA 3TQRA 4MARA 3OCVA 3UMFA 2X42A 4JVSB 4EKNB 2DE0X 3PGLA 4DQDA 3GIWA 2PRIA 2OBFA 1F2DA 1II8A 3HKBB 3KXPA 4FQ5A 4P0TA 3X2EA 3HKDA 3JAWA 2JJYA 3TLBA 2JHGA 4A0SA 4IICA 4FR0A 4U2KA 3R44A 4ER5A 4PAOA 5KMGB 1AU9A 2VYVD 4IZOA 2H7XA 1ZSYA 3ML1A 4YJKA 4OI4A 4ROTA 2EYUA 1DKNA 1XRPA 3PLRA 4MA4A 1JLKA 2BM1A 4JENA 1KMHA 5ITWA 4F1JA 4W9NC 3BXHA 1H8EA 1JR4A 2J41A 3DGFC 4XARA 4B3BA 5HKAA 2HA3A 3Q0EA 5DHRA 4RZSA 1R4MB 3JPWA 3T1OA 1BRTA 3H87A 4YJ3A 2W2LA 3AVXA 1OILA 2EZ8A 1VHQA 3LBNA 1X0XA 4DNFA 5L3ZA 1U0EA 4GP9A 2BBWA 4ALLA 3OY2A 3QMWA 2Q4BA 3FSJX 1SOAA 4AP6A 2EJTA 3IP7A 2VP3A 2R6AA 3U7EB 4R1SA 1AHPA 1BOFA 4BXOB 4LF9B 3F4BA 3MK31 1YJ8A 3SPXA 1S3SA 3IURA 4N0MA 4RETA 1Z7YA 4F04A 4RIEA 4L78A 3CGWA 2ZJZA 2O1EA 3HBJA 4TTTS 5AW7A 3LQYA 1YAJA 4FW9A 4HRXA 2Z2JA 1L5RA 5CNKA 1HMYA 4LOJA 1SCJA 1EVZA 3ICOA 5F76A 4BLOA 3ZDAA 1G0OA 2PKCA 1A71A 1Z5WA 1FLDA 1HLFA 3GWZA 2W43A 4L08A 1CUZA 3O4GA 2ZTUA 4PX2A 5K0EA 2PS9A 2XZPA 2W90A 2C83A 3O8NA 4HFJA 5DOZA 4DBLE 5HPYB 4LEIA 4NMWA 2I4OA 2WIGA 1CDOA 3KE8A 2Z6VA 1GPNA 3K96A 4S24A 4BKMA 4KUHA 1PWHA 4ARZB 5HKKA 5A6VA 3LXRA 3HPRA 3G0IA 3HUEA 2EQAA 3H2IA 4IKPA 3CJRA 4AMGA 4HG2A 1QHIA 1F4VA 4G85A 1NX6A 2MINA 1C7ZA 2YR0A 3GRAA 1Y9JA 3MINB 5EKSA 1GSOA 1E5LA 5GJVC 4BGEA 4BDSA 3GXOA 4FOLA 1TO1E 4H7JA 5I7WA 4MITA 2JEYA 5C4IA 2ISCA 3OURA 4JLAA 5DNEA 5DXAA 3F74A 3FZYA 3R0JA 4B7CA 1EE1A 1Y7IA 4K87A 2KM1A 3OJCA 4MIEA 1E3MA 1JIKA 1PGOA 3FCEA 4EVSA 3DZCA 3EDOA 3AH8A 2WPDD 3W34A 1Z4QA 4ROSA 3ROXA 4JBYA 4CEIA 3FRJA 2OM2A 1K4MA 3IE0A 1NJSA 4F4DA 1YZUA 4PZDA 2C8VA 2BI7A 2W37A 3KL4A 3L49A 5TDHA 2A92A 2EOAA 4UNPA 3D4BA 1DBWA 1KGSA 3CUSA 4OYRA 2FJPA 3PFFA 4UBJA 4JUBA 4DFDA 4AKHA 1DRWA 1WB6A 3QY0A 4OHWA 3VSDA 1VBFA 1ML4A 2IDKA 1F17A 1U5BA 3EZLA 2CBGA 5JFOA 2GAFA 2ZE7A 1XNHA 4L28A 4EY6A 4XQCA 3E5NA 3OZVA 2R44A 3OCYA 2PL1A 2OHOA 1KJZA 4OL9A 3SI7A 3LPCA 2FMIA 1UXKA 4L7QA 4DLSA 1EUDB 2HQ1A 3ED1A 4PTZA 3A4YA 3DM9B 4HGQA 3I2HA 5GJBA 5A1TA 5ALIA 3QEMB 4KPUA 4K2AA 4EX7A 5JJIA 4TYWA 1PL8A 1WUYA 3H75A 1XN4A 1T36A 2FCAA 5DEIA 5TF4A 2ZUVA 2AHOA 3R7BA 4C29A 2YCLA 3LQKA 2P4UA 4XRRA 1UEXC 4RJTA 3ZK7A 7AT1A 1MW9X 1NJ8A 4HB3A 2J3MA 1J25A 1GPUA 2A9FA 2V6BA 3FKSA 2V3CC 4N03A 4GYJA 2AGVA 1XTUA 2LXNA 4L2IA 3RKSA 3PI7A 3UB3A 3A9CA 2VK4A 2RGYA 3BIXA 2GEJA 4B8ZA 1T3HA 2VQEB 1VJDA 5K0TA 1U1EA 4K6KA 3I1IA 2JJ1A 2P4EA 4DBLC 3X44A 4E5KA 3O3OB 3WDMA 4AY6A 1A9YA 1J2YA 3X1MA 2WINI 1FS5A 1L4YA 3TZHA 4Y6QA 3LHKA 4C87A 3DTYA 3BJEA 5ALEA 3ZTTA 1SQ0A 3FJ1A 3GRPA 5ILGA 4TS1A 1B2RA 4FE4A 1PJZA 1VMIA 2AMVA 3ORRA 3CVUA 4RY0A 3DV0B 1H3NA 3W2EA 1HF3A 2GBLA 1XGKA 2LUOA 2CLDX 2B20A 4AY2A 5E4TA 3OOEA 1V1MA 2P9CA 2X4IA 3IP3A 2W70A 5BNWA 4PZ9A 1WXIA 5JH7F 4L6CA 3V1TC 4NBVA 3PQDA 3OECA 2C3MA 3ADOA 1Y9EA 2G9VA 3NMUF 3PPXA 3UJDA 2O8FA 1OPXA 3FMOB 3H2JA 3LCVB 2Q3FA 1AK1A 1R0BA 2POCA 3PYXA 4NHEA 3W06A 3H1TA 2WT4A 1FTQA 2CMHA 3TW0A 5KCMA 5JDIA 3EVNA 4XYEA 4FS8A 3OLXA 2NG1A 2EXXA 1IZZA 3VR6D 3GLFA 1X86B 2CGEA 2Q0QA 4F9GA 5KWIA 3QXHA 3DAOA 4MEBA 4J8PA 2BHRA 4KR3A 3F6YA 2FHSA 3HCBA 2OXEA 5BURA 1SQ6A 1J2UA 4EPTA 2VF4X 1UDAA 2V6FA 4EMUA 5JXJA 3VBEA 1Z47A 1Z0KA 3NUQA 1YBFA 1CE8B 4G1BA 4DYVA 2HCTA 2QMZA 1RPNA 1Y33E 4MVWA 5HE9A 1NUAA 2DH5A 1LZLA 4QAJA 2WSIA 1THZA 1DTSA 3I04M 4XCXA 2IX9A 4QSHA 5ARDA 1R4AA 5T4EA 4X6XA 3V1KA 1QO0D 1SIOA 2QTBA 2E87A 1M2VA 2IIBA 4Q12A 4Z4FA 3W9BA 4G97A 4H0FA 1H5QA 3U44A 1Q44A 2WT9A 4KIFA 4CCSA 4KSYA 3BICA 3S1SA 2XQGA 1S1CA 4OMCA 1IB6A 4RJLA 4ZYWA 1PFYA 4RESA 3Q8WA 4XR4A 5CB0A 1PG5A 1IEQA 4C4OA 5T4BA 1V7ZA 3I23A 5AOCA 2RARA 3UJCA 1CTQA 5JD4A 3NTUA 4FKZA 4KAXA 1WXGA 5BMVB 5B1YA 2K2QB 1PL6A 4L1KA 1KI4A 2L82A 2FN7A 3HP1A 4NBNA 4CMCA 2RMKA 5CP8A 1FJGB 2J31A 5C53B 1V45E 1YMVA 1XWFA 4HUQB 4J03A 1AOXA 4AN0A 4EA8A 4UZFA 1QPZA 2GUWA 5IM4A 4DBZA 4NU8X 3WLTA 5DYTA 1ZM9A 3VTZA 1SWWA 2PYDA 3FDXA 4I3HA 4A0QA 5K99A 2AYXA 1Z6GA 3O8QB 4P4UA 4CODB 4JASB 1PS9A 1PK9A 4LV6A 1D6SA 1KK1A 1SCBA 3ZHVA 3D3JA 3E9ZA 3VA7A 4TKUA 5ICEA 2ZB2A 4HKTA 3UXYA 2W4MA 1DAGA 3DR3A 4PGAA 2PD6A 3F9IA 4LK2A 4UQOA 4BMPB 3DOOA 5AJZA 1SC3A 1U99A 2GHTA 3HA5A 3MWFA 3CKLA 5CU7A 3RVBA 3T1NA 4E46A 4XD7A 2PXAA 3S81A 1W34A 1Q2XA 4KX5A 2GK3A 5E1MA 1SRRA 1WZEA 1KP9A 3R7NA 1HZJA 2FSHA 3SR0A 4ND8B 5BMOA 2FJ0A 1OV6A 2HNBA 1K6JA 1A96A 4WLUA 1BD4A 1MO3A 2HU2A 1M72A 2D0PB 3N0XA 2VA8A 1PJ2A 4D3XA 5A0TA 2C3UA 2O0KA 1W4CA 1XTKA 3OCXA 4OQNA 1YE3A 1QCZA 1WKBA 3WL8A 1GLVA 2EJUA 2G0NA 4GRAA 4HAZA 4UAJA 3UGJA 4RY8A 1DJLA 4YA6A 1CEYA 3FPCA 4XUCA 4M99A 1KEEB 2C5SA 5BUQA 1BGVA 5FNVF 1N32B 1QOPB 3W79A 1K7CA 3TD2A 1DFIA 4N7JA 2FGKA 4QOFA 3LO5A 2IQ5A 4JHLA 1AC5A 4K3VA 4TOIA 1LFDB 5FTKA 5KEIA 3FPLA 2AE1A 4GPIB 2UYGA 4DKJA 2PO5A 3RSQA 3H1AA 1MR3F 5CNMA 3VHXA 4JUDX 3BJZA 3FY4A 1BMDA 4GBJA 4M0EA 1IG3A 2ERXA 3LK7A 1VBKA 1I1HA 5HFNA 4MULA 4YROA 4D4JA 2BGNA 4I1VA 3O31A 1PR5A 2NADA 5TT1A 1SOVA 3IEPA 4QOSA 5AVUA 5MDHA 1RJGA 1HGXA 3PDUA 3MSCA 1NF3A 4MQEA 2GEKA 1CPYA 1GNQA 2HK6A 2QTFA 4HQ0A 4CUKA 4F2GA 5AHOA 1OGJA 1DAOA 4NAHA 1GNVA 3PDWA 1S3IA 3RYCA 4WKPA 4LZWA 3F2VA 3AI1A 4PV7A 3E7XA 1N5JA 1S2OA 4I1UA 4OJQA 3E2IA 1H23A 3L79A 5DVZA 4XUGB 5J2UF 1QP7A 3OIFA 4M9UA 2LTAA 2V3WA 3IKMB 1L3IA 1WCWA 3KWFA 3RTBA 3U4AA 4ZDJA 1C0EA 2XF8A 2YMMA 1USIA 2ZRQA 1A8IA 1C7FA 1GPKA 1HKHA 2O2CA 4BO9A 2OHIA 3JQFA 5EEHA 5IT4A 5HYVA 4OXXA 4C7KA 2G76A 2PZJA 2ZJ7A 4LBZA 1AKUA 1V9SA 3P0JA 4X3PA 1O97C 2CUNA 1NN1A 1QOZA 5IAGA 1LF5A 3PVCA 5KYXB 1UPAA 1HO3A 3SM9A 5FTMA 1M6YA 1OAKA 1PTJC 2RBGA 5CVEA 4NU6A 1BE0A 1KH1A 2FSGA 4X1IB 1XI2A 2B5WA 5FBWB 5SV2A 2A1IA 3MCVA 2NXJA 2ASVA 3IPAA 3WKBA 2IWHA 1W36C 1NQXA 1E3WB 4RXUA 3SVTA 1YOBA 3RW9A 3WGQA 4CFZA 3W05A 2BFCA 4EY8A 4CCWA 3IOEA 1G7CA 3TGLA 2WF6A 4FDUA 1T8SA 3Q98A 1X6VA 1YHYA 4MR9B 5DBOA 1M2OA 4YMLA 3DYIA 4PM4A 5T3YA 2J0SA 3MS4A 1TRKA 1YB1A 3NHBA 3JAKA 3WYCA 4W8GA 2IELA 1T5BA 1TQDA 3WLRA 3R7DA 4B47A 4B3IA 1DFGA 2WIBA 2V0CA 3OICA 1FA9A 1S3FA 1SUBA 2I99A 2W6PA 2WB4A 3O4HA 3NUGA 4Z8YA 1UMBA 2AXPA 2VKQA 3K9CA 4ZAGA 4BNLA 1Q0TA 1AF4A 1ZZEA 4J49A 2QUJA 4OXIA 3TZQA 4P7FA 2IZ1A 1XJ0A 3G7UA 1SMKA 1F48A 1P9WA 4GLBA 1RQNA 4FGKA 4MV5A 4AMVA 2NXNA 1YQTA 5CVDA 4YRKA 2ZI4A 2PXHA 3K8QA 1I6WA 2ZBDA 5FAXA 1IJFA 1MEEA 2GYVA 4ZVVA 1ADFA 4PHHA 1GQRA 4HSEA 1QU2A 5J1TB 3L7LA 2YYYA 3ESDA 3FR7A 1V5IA 1AIPA 3ON5A 1FU4A 1JQEA 4LV8B 1K7FB 4N4AA 721PA 2CD9A 5ELMA 2XUQA 2CXQA 3QKSB 2I6UA 2WTUA 4Q7MB 3E22B 5GV7A 5EA2A 2DH6A 2DERA 1KMNA 1LSSA 1SB8A 2ODQA 2C5AA 2W9XA 1OKKA 3ND9A 4DV1B 1DLIA 2LDBA 3SZRA 3WV5A 1TB4A 3F2IA 4TWRA 3FYUB 3SFTA 1JFTA 4G07A 4N6OA 1T1SA 3A1VA 3AR2A 3GK3A 2PMEA 4PC6A 3MUEA 4ZXPA 4BMCA 5CB8A 3LVFO 4RNCA 2D13A 4MW0A 1NI4A 1MJGA 3CNBA 3F6PA 3H3JA 4X1KA 1AUXA 5L3QB 2TS1A 5TB5A 1T0IA 1WQ3A 3DEZA 3NHLA 4H1HA 9LDTA 3EXG2 1KRHA 1N9GA 5J1SB 4BNHA 3ET5A 1YFKA 3BMQB 1R5BA 4IS2A 4M46A 5J4VA 4W82A 4TWBA 1HZZA 2FP4A 4Q3DA 1GA4A 3RG2A 1SVLA 4RZHA 2F8TA 4GBED 3DNPA 1SIUA 5TS2A 2OGSA 4IDCA 1XA0A 5IK2A 3DFFA 4JJFA 2OXIA 4H16A 4BV2A 4LC9A 1UWVA 4D4HA 1EKXA 3DFIA 2D59A 3PWKA 2EQ5A 3HB7A 1E1LA 1P7VA 2NV6A 3TLGA 3AW8A 3QXCA 3Q9SA 1UPTA 2BLLA 2C2OA 2VZEA 4P84A 5LPNA 4KLZA 2IBSA 1I3LA 1UP6A 2PM8A 4EUNA 1PJLA 1CDDA 3K9WA 1DELA 4L02A 1JQJC 4AX4A 1OBOA 2G06A 5THKA 2A1UB 5A5DA 2ORVA 2KMLA 1E1CA 2HBZA 3BRQA 5IJ9A 3AL2A 2XBMA 2R5WA 1WCXA 1TJPB 1UF9A 4MPTA 2B5OA 4H6VA 2WP8J 5A9SA 2OV6A 2V7WA 3DOIA 1GHTA 3U7QA 4DV2B 4LJYA 3DHVA 3Q72A 3THRA 3HR7A 2R8OA 2O2HA 1NJFA 1DDOA 2VVTA 2F3UA 2I6GA 3QEKA 4TUYB 4UTRA 1U2RA 2ADOA 3JQ9A 4QPCA 5CVTA 1WZIA 1KVTA 1H69A 3SR3A 5ADUS 5KNDD 2Q3LA 2XUHA 1CNEA 1JYFA 3C6ZA 3DE3X 3FE2A 5TLSA 1PZGA 4IFBA 5A4MS 4K5QA 4AUKA 2X1MA 2QLFA 3HGQA 4GQAA 4OB7A 3ESZA 2B6NA 2I76A 1L4EA 2L42A 5J23A 2WHEA 1XN1A 1YDMA 2NU6A 2XHZA 4UEQA 4XKJA 2ZJ2A 5KKCA 4MH0R 2BR4A 4O5OA 3WYNA 3BT7A 1HLDA 4CUJA 5H3CA 3DYVA 3K20A 5JU6A 2NSLA 5CA1F 2OLEA 2W00A 4LC0A 4M22A 1MCZA 4RL6A 3UKOA 1RPTA 4GG1A 3I61A 3H8WA 5IULC 3RG8A 3Q3GE 5DH9A 5LYJF 4FFPA 3X43A 4CTJA 5JANA 4C4PA 1HEYA 4B3MB 2IEBA 2X8JA 3U3JA 1DBRA 1D8AA 521PA 3INGA 4C6TA 4NAUA 1ZW6A 4GKVA 5T5QA 4I4CA 3RVKA 3K4HA 4PYKA 2ZXUA 2PBFA 3OZCA 4MO9A 2X5JO 1Z18A 4GM0A 1EUZA 4NULA 5FX2A 1C9DB 1PF7E 3ASUA 2X7JA 1BGWA 4H3KB 2QV0A 3UFBA 1E9RA 1N34B 2CL0X 5KNCA 1KJJA 1L2TA 1SOMA 2NYRA 4M1OA 3K9QO 3OFNA 3LGAA 3A1EA 4D3SA 1T4CA 5LQJA 3CF0A 4FX5A 3MCAA 1E2GA 1OX4B 2CFOA 2IS1A 2QPOA 1E0AA 1PNTA 1JBKA 3MYYA 2H5JA 4NU5A 2B7CA 3NONA 5AVQA 1Z4PX 2JVJA 2YJGA 3KEMA 4H4DA 2ZYRA 3PYMA 3KEGA 4OHFA 5EVJA 1JALA 4MJLA 2FG5A 3ONEA 2VWGA 5KVCA 3ROEA 1P7CA 5HRAA 1V1RB 3RS4A 1WM1A 4P3NA 4UC0A 3FLBA 2D62A 1AT1A 1YBMA 1AA6A 4L6AA 1J20A 3GMTA 2IZ7A 5ALKA 1U4OA 3W6OA 5A0VA 3AB3A 3KPUA 3W4IA 2R65A 3C14C 4RMGA 1JHVA 1ULUA 5JALA 3HC7A 5LD2B 4QULA 1ZGGA 2V6GA 3FBGA 1VI2A 2G1AA 2EHDA 3HBAA 1YZHA 5EKXA 3NHWA 1VOTA 2FEWB 4FGLA 3UXEA 3AYXB 3ZE0B 4JHXA 3RS3A 4R16A 1WMEA 2GD1O 5JH7A 2Q5LA 3DZFA 4IEFB 2H4YA 3E9EA 2XSZD 2HXYA 4EYQA 3AR8A 2D1FA 5L8VA 3EZYA 4ZC1A 1UJMA 3O83A 1DKRA 4L8YA 1DBPA 1M1YB 5EJ2A 5ALVA 2BYTA 1T2CA 4E5VA 4POAA 1TM2A 4D9EA 2X8BA 1NURA 3O74A 2NPFA 3SMVA 4TV9A 4DC0A 5CD9A 4EW3A 4FFMA 1TYAE 4OQMA 4Y2RA 3DLTA 4U6NA 2G17A 3AR5A 3VOAA 2EJBA 4L3WA 1C1DB 1DMRA 1YI0A 1R4ZA 4WASA 2PMBA 3BIOA 4M1WA 5BT9A 1QHGA 1YL7A 3BE8A 4P7BA 3LRXA 1UJNA 2VAXA 4K86A 4NEGA 4WK6A 3HCRA 1T0PA 1U94A 16PKA 1XQWA 2VUIB 4GKAA 4XIJA 2CF5A 1WA5A 1XP8A 5CLIA 4ES6A 5AK4A 4R1QA 1N3BA 1IUKA 1H3FA 1TVMA 1VCOA 2RC6A 3BMNA 3LUHA 4U2BA 1RQPA 1Y7LA 4KFRA 4M9ZA 4NAVA 5TJHA 1NVKA 3AONB 1QB8A 1U0HC 2ZJAA 4EOGA 4TS4A 3ET4A 1IPHA 2YIDA 3LT5A 2R7KA 4P0QB 5L4NA 5JI2E 5FPYA 3NLLA 2C94A 4I14A 4F3RA 3RSHA 3Q3VA 2CJFA 1OUMA 1XZJA 2QMUA 2VPYA 4UOZA 4ZIRA 3W1EA 2REQA 2E6KA 2JJ1D 4MUAA 2OHHA 3WJAA 4ZANA 4UFPA 5IVHA 2H7CA 1DAMA 5HZGA 4KMOA 4LHWA 4RZXA 3Q9LA 4IQGA 8MHTA 1RJFA 4LX0A 3HABA 2JGDB 4X54A 4XQEA 1HWYA 4L9AA 5F1KA 5G1OA 3UEOA 2ZUSA 2Q62A 4BL5A 3FMGA 2B34A 4HRAA 3ZWKA 1W0JA 5JXGA 1J2EA 2YFYA 1BN6A 2H8KA 3OF2A 1KZ4A 4JBHA 4KIWA 4OATA 1DFHA 3BTUA 2HK9A 4GQIA 5BN5B 2NUTA 3T7KA 3UAZA 2NU7A 1U2EA 5FFFA 5P8WA 2HJ9A 5CD1A 2ZAIA 2PWAA 4QFDA 1U9IA 3GEHA 1AGNA 4J6EA 1LQUA 1RYFA 1YB2A 1B0ZA 5FOSA 3FFAA 2GTHA 3H5OA 3ME5A 3U7HB 1RKXA 3A1FA 4JP2A 3N2LA 4KEAA 1EZ1A 2O54A 2P0EA 1N0UA 4Y6SA 3ZG6A 1JWAB 4FEAA 2Y68A 4DGSA 2AFVA 1R6VA 4LI0A 3HO6A 1PFWA 2HZBA 3M6VA 5E7QA 5JZ9A 2YXDA 2R4UA 2UZ0A 1U7ZA 3E61A 5L6LB 2HCRA 1T2EA 1Y37A 1ZNWA 2J85A 4P5EA 3QFFA 2EGUA 1UAGA 2GK7A 2BEUB 2NTJA 2DHDA 1CB7A 4MO2A 2IP4A 4NARA 4X95A 5LC1A 5HXAA 4B4UA 1EX1A 1KVUA 2AOWA 2EIHA 2BHNA 4X3OA 4WKCA 1KK2A 2JKVA 1HDCA 5CDGA 2E21A 3D6UA 3S1LA 4GOKA 4HTFB 4MTCA 4D99A 3B12A 3JD2A 3WFZA 3ZIUA 1D1QA 5E38A 4BE7B 3O9ZA 2W7TA 3IMEA 1JXOA 2AOUB 2CB9A 3HG7A 3R3VA 5I8PA 1E32A 4Y1GA 3V3KA 1MIOB 1W52X 1XXHA 5CW1A 2XKJE 3ORYA 1YONA 3QPWA 4EVIA 1L4UA 4KR9A 3TQHA 2BMJA 3CLTD 3L01A 3Q4GA 3R3XA 4K9DA 4RADA 3UNXA 1PZFA 2I80A 2IL1A 5DSXA 1ZH4A 2JEOA 1JVNA 1NNSA 4BKRA 2W8BB 3R3JA 1EU1A 3DTTA 4EHKA 2GN9A 4O4LA 4D3DA 4GW3A 2JGLA 2YYSA 2YX1A 3EGDB 1WIWA 4NE7A 4FFSA 1GU0A 1FMLA 2A86A 4X1KB 1KR5A 3FZNA 4Z3DA 3FKJA 5TGZA 4ZAZA 1YOVA 4WVFA 2HWKA 4BECA 3LPLA 4KFUA 1W0JD 1UQUA 1WUIS 3GP3A 4N6GA 4Y1EA 3KTAA 1M1XB 1ZKDA 1MB0A 3C85A 1Z6XA 3S2IA 4HGPA 1ZGBA 3QEJA 1HE2A 1DQYA 3ESRA 3L7IA 3OZUA 3H11B 4FYPA 1XNRB 1RWOA 4DLBA 3ZDQA 1PWYE 2PMDA 4WJKB 4G89A 1E3IA 5KPDA 3EDYA 1FUUA 4G9GA 1NYTA 821PA 2FR1A 2P2NA 4GEGA 3DMRA 3IP5A 3HFSA 1VHJA 2BL4A 5BSVA 1Y9AA 1S4QA 3A6GA 2A5DA 3NM5A 1ZJZA 4WLEA 1W35A 4MDYA 3AFMA 3ZWNA 3WGKA 3HCDA 3ZWVA 4IDHA 3UAVA 5HE8A 3AKCA 3ZDZB 4N5IX 4Y0VA 1YUBA 1G16A 3AIIA 3MW8A 1Z4MA 4B81A 1QO0A 1VA4A 2CE7A 4EB6B 4LK3A 3E8MA 4FMDB 5DTEA 3PHCA 1ZCFA 3IILA 4Z4EA 2OZEA 1NXSA 3U7RA 3LUAA 1L5SA 2IVFA 1K0UA 2HA0A 3EQ7A 1IZ9A 2X41A 4PTYA 2PU5A 3MELA 2VSYA 2YZ2A 1FQJA 1KYQA 2X58A 1B8VA 1U5CA 3CKKA 4NYJR 4P98A 2YMQA 2ZUCA 3V48A 8ADHA 3UPTA 1LXCA 1D6NA 1DC8A 4ZT3A 3EC2A 3BAZA 2XUJA 2AFHE 4W5OA 2CNBA 3GFTA 4KE7A 2BGTA 2Y0EA 2QZJA 3CZRA 3IV7A 2OVFA 3MERA 3T35A 3T95A 3FTCA 3U81A 1N1MA 1I51A 1SPXA 3P1JA 2BBSA 4OX9B 1P4HA 3IQDB 3K5WA 3Q2IA 1I24A 5DI9A 4UZSA 4DQ0A 2IH5A 2G7ZA 1VLVA 2FW6A 1K1EA 2J87A 1NW5A 4ZKEA 1TM5E 4M54A 2CKMA 3C6KA 2O4CA 2Z4RA 3BEOA 3I6IA 3MGBA 3O90A 2WHXA 5B6PA 1IY2A 1PUXA 1V1MB 3ZOKA 4B73A 3D43A 3I2KA 3O0TA 1MOPA 2YIJA 1ZCBA 2QZZA 4R8SA 1QYDA 3COWA 3OOSA 1NFQA 4JQZA 1T6ZA 1ZH0A 2EDAA 1YBVA 5SYMA 3W2GA 2IS4A 1LWOA 3UO8B 1F0YA 1WB4A 4QTXA 3GFBA 3LC7O 4ENQA 3F5DA 3IHWA 1UC5B 3ZGNA 3PPIA 5AOVA 3G2PA 1YJAA 3N2ZB 1ZMXA 3THWA 1CVRA 1I4WA 1SUPA 4EHBA 1TEHA 4DF3A 4KFTA 4ZDIA 1TVCA 4TUYA 5E4YA 2HR1A 1QONA 2DWQA 2Y2VA 3PQFA 4OY3A 4OYHA 2VT7A 3CH4B 4QUDA 3UUEA 5TQVA 2I34A 4Q00A 4OGWA 5HQ3B 3DDHA 2BGKA 3W5SA 1T1EA 2QQEA 2H5IA 3F5MA 4WBNA 1SBTA 2GKGA 2GN6A 4ND1A 5IC4A 1QX4A 5KTPA 5ALPA 1QKIA 1M66A 4UHKA 4XASA 2QN2A 5FULA 5BPHA 1K89A 2RB5A 5DHSA 2WMYA 2BTQB 2Q45A 3C5HA 4JVOA 3TEJA 3UKJA 1SKUA 1GKIA 1QIEA 3EAQA 4IIUA 1FDUA 4MRMA 4Q1BA 2DFLA 1VJTA 1E3EA 3PDIA 2ODAA 5BR1A 2PYIA 3OQBA 4NJEB 4U7HA 1C3XA 3ONWA 3BWDD 3FYDA 3VTFA 3LBYA 1JZSA 1WMDA 3M6XA 3IKLA 4IIJA 5JSHA 2PX5A 4UAGA 3NIFB 1IBKB 1KY4A 3GJSA 4A10A 4AS2A 4MDEA 5G3YA 4C0SA 1P0IA 2BKLA 2ZBGA 2WR8A 4OXYA 4WLNA 4QFMA 3IJRA 4F46A 1VDZA 2H1HA 1TO6A 5E9WA 1YR7A 4G1VA 3FHJA 3JYNA 2BGRA 3GHYA 4I6EA 4OO3A 3TOXA 1MHTA 2Z3VA 1V3VA 4FSHA 3OPQA 2FN4A 3ZZ1A 2BKAA 2ZS8A 1OX6A 1QRTA 4NS4A 1ZAKA 3HKCB 3NB0A 3RYFB 5GADl 2IT1A 4Q66C 1TC2A 2R1TA 3G2HA 4ZJPA 3WSWA 2BDUA 4BX9A 1GFSA 1MZVA 2Y0DA 4IIFA 4ZRDA 1JH9A 3L1IA 1B8UA 4CGZA 3A9VA 2I1VB 4IDAA 2D5AA 2R25B 3WP0A 1ZI9A 4YCBA 2GZHA 2HA2A 4JR1A 1L3CA 3BWMA 1AN0A 3AEKB 1IXSB 2EZ9A 2NQ8A 3OFKA 3ZU5A 2MHCA 2QMQA 3UAYA 1NJ5A 2QG4A 1J0BA 3PT5A 5F3WB 3U4QA 4HVTA 1MGPA 3B85A 1Z8NA 4Y2XA 3F90A 1FTYA 2D7JA 1PNVA 4LYAA 4NCAA 1M7GA 4ZVPA 3SEZA 2AI2A 4EARA 2ZR0A 2F4VB 1KI3A 1N2XA 3GFGA 1Q22A 2A0UA 4IS3A 4C2UA 3B6EA 4FDTA 3ZBTA 3DXZA 1NY5A 3CPSA 3DJYA 2J4FA 4QELA 2XLBA 1WSDA 1EHCA 3E9CA 2XCUA 1DJPA 4DMUB 2O2IA 1XA3A 4L0QA 1M2VB 1X14A 1YS4A 2Q3JA 3H18A 1YU6A 1KO4A 4XWYA 5K0NA 3TSOA 3UUWA 2P77A 1W0CA 2LBPA 1E99A 2YJ4A 2QLMA 3SXJA 1XDZA 2DHEA 5JBNA 4YI5A 3NWBA 1QUEA 1R6TA 2V7XA 3T5DA 4MHTA 1XV5A 1VHDA 4FJ1A 3HKEB 3LBFA 4BXOA 2GPWA 3CFYA 5HDBB 1RMTA 1YQQA 2DGDA 1EDEA 4FYKA 1NW3A 1M6EX 3MPUA 4IG9A 3DDNA 2DX7A 3R8CA 1BDBA 2I55A 3TNLA 4M8NE 2PK3A 3PXEA 1I36A 3I2GA 3DMTC 4ZT7A 1R27A 1ZGCA 2FGJA 2VBGA 4KZPA 5JMOA 2EFJA 4Z49A 3CGGA 1P2GA 3FWKA 1VE7A 3IIEA 2DQ4A 1CIVA 2XNCA 1M8KA 5FT9A 3KETA 4QPZA 1L7QA 1U6IA 3NEAA 2GILA 1ND6A 4B5KA 1CQWA 1HA3A 3U7JA 2X23A 2NP7A 2L17A 1H6CA 1ZIOA 4OA5A 5TY0A 3DP7A 4ZN6A 4A1OA 2N1MA 1OI7A 2KLHA 3R75A 2CDRA 4FDLA 4G2NA 2VAPA 2RHOA 4KFSA 4OM7A 1R2QA 1RI3A 1YRHA 3L7JA 3KX2A 3QRWA 2ZJYA 4HDSB 3FTFA 2B0JA 4M88A 3JAWB 3FAZA 5LU9A 3CZMA 1ZN9A 2R1VB 3ZKWA 1X7GA 3T7EA 1EK5A 1P1CA 4JN6B 2HLDD 4BV3A 4ZEVA 3LWDA 4TXJA 2JHFA 3FOBA 1JDSA 3L02A 2PEZA 3ZIAD 1TPZA 2CVZA 2VEDA 3DNMA 4GLFA 4M76B 2CLSA 3R3WA 4QOEA 2B9EA 4CIBA 4AN4A 2DQKA 3ZU3A 3EC7A 1FJXA 3EXAA 4TRMA 1UXHA 2PXCA 3WQQA 2BV3A 1RJ9A 4PR3A 1ABEA 4R7ZA 3ZCQA 2PEYA 3Q8KA 1V37A 4N8SA 4HVLA 4B3SB 2ZJBA 5DIZA 1AHNA 4GP6A 3MOGA 1JQBA 1T2AA 3QE0A 3IOMA 3KSDO 4XLZA 3PNPA 5FTJA 3ZV7A 3DM5A 5K8LA 2AKYA 4OAPA 3NR2A 4FT4A 2YMLA 4X7RA 2ZIVB 5KVAA 5A05A 3ETCA 3R5SA 2XT6A 2WIKA 5KNBA 1ITZA 2ZSIA 2V5UA 3AC0A 3GN2A 4Z51A 3JR7A 1TJ5A 3HU2A 1GEGA 3HH8A 4NH0A 4YRBA 1FPMA 3BGSA 4LJ5A 3NYIA 4L9WA 3TK1A 4D9GA 1SZJG 4JY7A 2ZJFA 3VKGA 1VKNA 3WS7A 5A9TA 4A7PA 2XDQA 3W5BA 2P3LA 2WG2A 4ZT4A 5G4KA 1DWPA 1XX6A 3STYA 2X6RA 1ENYA 4I9NA 4IGFA 4E70A 1ZN8A 3FGNA 4MRMB 1ONNA 1E2UA 1XRQA 4NCXA 5AKKA 3ZPXA 4H3SA 1NVXQ 1WCIB 2HU5A 3LL4A 3LQ4A 4R1PA 3EVCA 1NDHA 3GELA 1I13A 4L22A 5GV8A 1LJ8A 3KD2A 4NE9A 5CYOA 2DCMA 4XB6B 3KQHA 1VG8A 1XF9A 2NGRA 4I99A 3VZPA 4KWTA 4XOIA 3V33A 1NLUA 1SD1A 2RGBA 4X5OA 3ZUPA 3GFPA 3N76A 2W6QA 1NPTO 2LR0A 1BGXT 1QXSA 3MS7A 1MEOA 4H7IA 5HTKA 3T15A 4BLRA 2HK8A 1KQGA 2BMVA 1W96A 1XELA 3IP9A 3EPJA 1WB9A 1E2IA 3QYFA 3W5VA 3EVZA 4IQ4A 2A0FA 2VH1A 3ADCA 3NAMA 1LPOA 3Q9NA 3H0EA 4AYXA 3OJWA 2Q3CA 2Q0HA 5D51S 1FNDA 5B36A 3RK1A 1TZMA 2J5RA 4F6RA 3UCEA 4DVGA 2FX5A 4ENPA 2ONZA 4LJ8A 4AECA 3H5RA 5GMOA 3FSGA 4LMPA 2FSPA 3M6MD 3QLUC 4NY1A 2EP7A 5FJIA 3I2YX 1US8B 2FE1A 3HZRA 4H2DA 1H2ZA 1CUVA 3TSAA 3KHTA 4M8IA 1S3GA 3AP2A 2CFCA 5CDSA 4OMFG 3BH6A 1WHSA 5CHEA 4LCJA 3C5CA 1E1RD 1MV5A 4GICA 3R9IA 1CLUA 1TECE 2VNKA 4GX5A 4EYSA 4H31A 4KPFC 2ZSBA 2I8LA 3IVMA 4U1RA 1TUEA 4CEHA 3E58A 4HN4B 4GUDA 5M04A 2V4MA 4NCJA 3CXRA 2FHPA 1JHUA 3FYCA 3JQBA 4RAOA 4HWGA 3DZKA 3ZH9B 1KYIA 2ZCUA 3WLAA 1E9EA 1M34B 3I12A 1J56A 4E1BA 4WTOA 5DGXA 1G1MA 5H02A 1UH5A 3UWPA 2FN9A 2JAHA 4KDCA 3QTLA 1OFUA 3BTSA 1NN5A 3M34A 4AF8A 4RENA 1XZHA 2FF7A 1M6VB 4WFQA 2I3DA 3V8EA 4CIWA 3HM9A 3NWEA 4JYPA 1LDEA 3OZBA 1Y8CA 4FHEA 3O6VA 4LS3A 2DLDA 2W2QA 4NFLA 2OCIA 5LDGA 4FMCB 3GPIA 1E4VA 3NASA 2FN3A 2C58A 1M0TA 1UZLA 3B9QA 4DNQA 2J08A 2YIVX 1CUWA 4E2ZA 1O5TA 3QVUA 4JNKA 3CN7A 5SYAA 3CR7A 1UKBA 4DR7B 1RCFA 1N5IA 4WN3A 1H5NA 5KTOA 3R6WA 1VFPA 3OQJA 3I9JA 4CQMB 1MG5A 2VHZA 3AUTA 3O3CA 2O3TA 4RPCA 5B57C 4JI4B 3KQQA 4MOWA 2FG6C 5JROA 4PHFA 5LQMA 4HF7A 3HO1A 2VDWB 4R1NA 5DWVA 2HXGA 5G0WA 4EQ6A 1LPAB 2P2LA 2H08A 3QFSA 4IJUA 4FNOA 1O8CA 1VKZA 4Q9IA 3D64A 2PANA 4Y1RA 3M9LA 3PC3A 4KXNA 3WAKA 5KU1A 5BV2P 3O4RA 3SBXA 4Z1MD 2ICAA 2ZRCA 1E2BA 3IPYA 1YOVB 1CETA 4F3TA 5LQUA 4DSNA 1HTWA 2BKUA 4PE5B 2FPRA 1W93A 3B1YA 1L8AA 5CIWA 4EFMA 4U7TB 5IJ9B 5LKRA 2R5NA 3ABSB 4QLAA 5GWXA 1EG2A 4FLFA 4RU1A 4XIGS 4DPLA 4YRZA 3HDGA 4N5HX 1VSQA 1UPCA 2IYRA 1NLMA 3DZHA 2C9YA 2DJIA 1HG0A 4KOAA 5TRTA 1DWQA 1E2DA 4NG5A 1II9A 5JR3A 1KI2A 1ZD2P 1SK8A 2CHGA 3NKLA 3WLMA 1FB5A 2J3DA 2ZLBA 3BULA 4JJEA 4ML3A 2OA0A 3RS5A 2OZVA 1NTOA 3KFLA 1EFVB 4URXR 5JFTA 3GCXA 1GA1A 1C4XA 1IVYA 1MB4A 4DE5A 1A95A 1U8ZA 2JL1A 2WSMA 3O7MA 3L3BA 3O73A 1Y3AA 4O25A 1KS2A 1TIBA 2HCJB 4RZUA 4O0LA 4XX1A 1IHPA 5EE5B 1YVRA 4MVJF 1HBJA 1X9HA 1IOVA 1UM8A 1OYWA 2E49A 4G4SO 4LJ7A 2BBTA 1RRPA 2OE2A 4TS3A 1ZRNA 4TV9F 2Q7DA 2PLAA 3QKRB 4H1WA 1K6IA 4YQZA 3ZCPA 3OPXA 3OT5A 3LDUA 3GDHA 4OTZA 4CDGA 1EFUA 4MA0A 5IYZF 4KO8A 2OP1A 2OLJA 2QR3A 3NPMA 1Q7EA 4DAEA 1XXHE 5K5EA 5CVUA 2JLZA 3C1UA 1GUYA 2IHUA 2QM7A 3LZ6A 3IO5A 4CTKA 4K9PA 4LISA 5E1OA 3FYTA 1VMAA 1EWKA 2XD4A 3FTPA 7GPBA 1XCLA 4NPCA 4EKIA 2EWMA 4TTIA 1PLLA 3EUWA 4N54A 1EI9A 2CKDA 2OCBA 1DAHA 2YHBA 3FWPA 2GWRA 5JNUA 5GIOE 4J1QA 3CTMA 5FUXA 1NC1A 1RZUA 1XYYA 2G82A 4WK4B 3U0BA 5JHHB 3U16A 4WI1A 1PE0A 4YDHB 3U3DA 3PRJA 3ZHQA 1JG4A 3NCTA 3AHIA 1QLHA 4U00A 1CC1S 1EVKA 2PGLA 1CERA 3ZX5A 2UVDA 3P7MA 4BZXA 4MP6A 1AGXA 4QXRA 3T9AA 2PT7A 4H17A 3QOYA 1Z0DA 5AJWA 2IWRA 2Q1TA 3ELYA 4OHZA 2NO1A 2Z83A 4RACA 4LVUA 3UMJA 2ABWA 3WDSA 1EAMA 3BMCB 5FBQB 4QVGA 3SIWA 4FB4A 2QORA 5IYZB 1QQ7A 1V5GA 1FDIA 1L3BA 1OC2A 1Q3TA 3C45A 2G40A 1KAGA 1M8FA 4M0FA 4HNAA 3BREA 2IZ6A 4NV1A 4RWZA 4DG8A 1I5EA 4IVPA 1WULS 4KE6A 2BEWB 4IHJB 3WB2A 2QB5A 1LZKA 4Q82A 4DPKA 3STHA 4QUJA 4MW6A 2H06A 2Q3HA 4I1OA 3M5CA 4A23A 4C0JA 4W5JA 3QWBA 3ROPA 5DNAA 1QHNA 1YQ9A 3H99A 4PFJA 4DXAA 3B6KA 4M4SA 1Z88A 1BU5A 1P1FA 3MWLA 3OZTA 2ATEA 2XMPA 3C48A 3EJWA 2EZUA 1AKTA 3H5LA 3I5MA 1JYSA 3G02A 3QTBA 2AA3A 1JHOA 2NU7B 2XUDA 3DW1X 3LQQA 4PLHA 5HM8A 1D3AA 1H0KA 1I7DA 3PT9A 5LUBA 5JMTA 4M38A 1G3IA 4ZI7B 4E5SA 4MTLA 2QRHA 3LM8A 4J9UE 2FUEA 3T7RA 3ZXUB 4RJ2A 1J1ZA 3HS3A 3O8QA 5F7XA 1EFRD 2JI8A 3AI7A 1MG0A 4J7CA 1NOJA 3A3KA 3GT7A 1K7YA