2YJ4A

Conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
250
structure length
248
Chain Sequence
LSLYEKMLHKGMIIKNSNVYEKIKEIDTIIFNKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIGVRGKISDKIIEVKKAENDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEYYSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNGVDISKNVADIILVSNDIGTLLGLIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-TRANSPORTING ATPASE
publication title Conformational Changes in the Catalytic Domain of the Cpx-ATPase Copb-B Upon Nucleotide Binding
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 74
structure length 248
sequence length 250
chains with identical sequence B
ec nomenclature ec 3.6.1.36: Transferred entry: 7.2.2.19.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2yj4A01
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 2yj4A02
3NUQA 5ALHA 3NANA 1L8OA 1ZD3A 4F71A 5AVTA 2B0CA 3EF0A 1NF2A 2B82A 1Y8AA 3PCTA 1YDFA 3L8FA 2G08A 3OCVA 3B8EA 2FUCA 1S8OA 1Z4PX 4QQFA 3WKAA 3ZVNA 2ODAA 3I76A 4UAVA 2B1RA 4UMFA 2DQSA 4O8CA 3U7FB 2MU1A 2YJ3A 3DDHA 5AKZA 4BEVA 3R09A 1TA0A 3DNPA 5ALGA 5FP0A 1Z4QA 4Y2PA 2ARFA 3R9KA 5JJBA 4KNVA 5AK3A 3TLMA 3L8EA 4FYPA 2B8EA 1U7OA 4I9GA 1QQ5A 4Y2TA 5ALYA 5ALRA 4DCCA 4HAIA 1SWVA 2FI1A 2RAVA 2GFHA 5ALKA 5AKHA 3FGOA 3AR8A 5AVUA 1VJ5A 3AR9A 2OYCA 2OA0A 2PKEA 2WHEA 3K1ZA 5AM4A 1YMQA 4KNWA 3U7EB 2IA5A 3QLEA 4BX3A 2R8XA 5IS2A 3N1UA 1ZS9A 3SMVA 2ZOSA 3IJ5A 3OCUA 3CNHA 4J03A 4Y2VA 4BX2A 4OCZA 3KZXA 4AP9A 1WZCA 4Y2UA 3A1EA 2OBBA 3SD7A 2WF8A 2Q5EA 5ALMA 4ZEVA 2P69A 3ED5A 3QU2A 1N9KA 2FPXA 3FPBA 1U7PA 2Q4RA 3DAOA 1EK2A 2RBKA 2A29A 2X4DA 4AS3A 1L8LA 3ONNA 2C8KA 5ALJA 4KX5A 5AVZA 1MO7A 4HYTA 3ET5A 1F5SA 3NRJA 5AW4A 2CFTA 3WK4A 4YCMA 4E88A 3QU7A 2YJ4A 2CFRA 2FUEA 3U7HB 4NV0A 3I6BA 1Z4KA 2YY6A 1VJRA 4EEKA 1AQ6A 5AI5A 1Z4NA 3A3YA 1CR6A 4FE3A 3W5CA 4UMVA 4Y2QA 2ZG6A 2W11A 2YFYA 5AESA 3MPOA 5ALOA 5AW1A 3FM9A 3P96A 2R8EA 4PNHA 5AW8A 2I7DA 2NO5A 5A3RA 1YV9A 5ALVA 3RFUA 3R4CA 2YMMA 1L6RA 2D2VA 5AM0A 3A1DA 4YIHA 1LTQA 1CQZA 3RF6A 5AIAA 4MWOA 5AKYA 2YJ5A 1RLTA 1MH9A 3E58A 1SU4A 1ZRMA 4MUMA 3MC1A 5ALLA 2WF9A 4UU0A 1WR8A 1ZD5A 2C4NA 5AW7A 2G1AA 2ZBGA 1RMQA 3NASA 1L7NA 4Y2JA 1L7PA 4YCLA 3BA6A 5AKXA 3QU4A 4ZEWA 4J2TA 5AW0A 3FZQA 5AM2A 3ESQA 3ZU6A 3OCZA 5AVQA 5ALUA 4HGRA 1T5TA 4BNDB 3KC2A 5AM3A 3OCXA 2HOQA 2I54A 3L7YA 1KYTA 3QX7A 2GHQA 2PQ0A 3W5DA 2YMQA 4NABA 2VKQA 2P27A 2JAWA 3KDPA 3FPSA 5ALNA 4DW8A 3SKXA 4C4SA 3GYGA 1XVIA 2HCFA 1Z5UA 3BWVA 3OCWA 2NYVA 3AR6A 2AMYA 2YBDA 1RMTA 3QUTA 4EX6A 3WK6A 2R8ZA 5AKLA 1O03A 2WF6A 5E0OA 3KBBA 2C8LA 2AGVA 2I33A 3I1YA 3ZX5A 4EX7A 3L0BA 5AW3A 3UMBA 1XPJA 3ZW7A 1RKQA 2MSNA 2HEGA 2C88A 3L5KA 1ZD4A 5AI4A 3WKBA 1NRWA 3U7GA 4JDPA 4BEWA 2Q4TA 3N07A 1FEZA 1RQNA 5AVVA 1TJ4A 1O08A 2HF2A 2YN4A 2ZXEA 1ZJJA 3WKCA 2A00A 5AM1A 2PR7A 3ZX4A 4HGOA 5AHXA 4YCNA 2IOHA 4UW9A 5AVRA 4EZEA 5ALWA 3PGLA 3ZWKA 1S2OA 4UAUA 1RPZA 4HGQA 3AR5A 4NFLA 4BKMA 4IFTA 2G06A 4XPZA 3WGUA 1Z5GA 3WKEA 3KOOA 2EAUA 5AI0A 4UARA 2W43A 4UMEA 1L7OA 3CZ4A 2G07A 4KX3A 5ALIA 2GO7A 1QH9A 1EK1A 2O9JA 1X42A 5ALDA 3WK8A 1YNSA 1YJ5A 4GXTA 4BYGA 5T41A 3B9RA 4BX0A 4OFZA 1JUDA 4DWOA 4BBJA 1L7MA 3HYCA 3EPRA 2ZBFA 2FPWA 3QXGA 4I9FA 4Y3UA 3UMGA 4AS2A 2EATA 4UMDA 3MN1A 3PGVA 3IB6A 4KYTA 3EF1A 3L1VA 3W5BA 4RESA 3QYPA 5AKIA 1RC8A 2ZBEA 3ZWDA 1Q91A 3QGMA 3M9LA 5AVWA 1T9ZA 4EELA 3WGVA 3WK5A 3L1UA 4YIKA 5ALFA 2P9JA 2QLTA 2WF7A 5AM5A 3L0CA 3NIWA 1XP5A 1SVJA 1YS9A 2FPRA 3B9BA 2WF5A 1SWWA 2NO4A 2YJ6A 5AK4A 3D6JA 3QUCA 5AVSA 3N8GA 1Z88A 2G0AA 1NNLA 5ALEA 5ALPA 3U13A 1U2SA 3UM9A 3WKDA 1RKVA 3L8GA 3AR2A 1Q3IA 1ZOLA 3M1YA 3EWIA 4NWIA 3SHQA 3ZVMA 3ESRA 1RLMA 3FVVA 4KN8A 2BDUA 2HO4A 5AVXA 1PW5A 4F72A 1Z4OA 3ZUPA 4H1WA 2B1QA 1QQ6A 4CF4A 4YH1A 3ZVLA 4G63A 4Y2RA 2JARA 4ZEXA 1J97A 2BY4A 5AW6A 3L0YA 1TJ3A 5AK6A 2QYHA 4C4RA 3E81A 3HLTA 5AI8A 4GIBA 4BNDA 3W5AA 2P11A 5AKJA 3E84A 2R8YA 3QNMA 4OD0A 4Y2YA 4C4TA 2HSZA 4HGNA 2AH5A 5ALZA 3A1CA 4CF3A 3ZTYA 3N28A 2OM6A 4NAVA 4UM7A 2IOFA 2HF7A 2WM8A 4B6JA 3GWIA 2YMPA 3MMZA 1RMYA 2HHLA 5ALTA 4XOUA 2BDEA 2YMLA 3OPXA 2B8JA 1LVHA 3U26A 4CF5A 4HGPA 4EENA 3NALA 3ZTWA 1QQ7A 1MO8A 3ET4A 3AR7A 5AKGA 2B30A 2HX1A 3SLRA 4QJBA 3AR3A 2RB5A 3N5KA 2GMWA 1Z4JA 4XQ0A 1WPGA 2JGAA 2FDRA 1ZRNA 2HDOA 1WVIA 1ZD2P 2HI0A 2G80A 2ZBDA 4YGYA 3WK7A 3OTQA 2FEAA 3QUQA 2IYEA 2JAUA 2W4MA 2CN1A 2C9MA 5A3SA 4G9BA 1U02A 5ALXA 5A3QA 2I55A 3VAYA 1TE2A 3SKYA 2AUTA 3KD3A 5ALSA 1U2TA 3QUBA 4L6CA 2FPUA 3QU5A 4UATA 3PDWA 3I28A 2CFSA 5AVYA 5AW9A 3WK9A 3S6JA 3NAMA 2GHTA 3J7TA 4CNQA 4UM5A 2IOFK 4UU1A 1K1EA 1QYIA 1RLOA 4RETA 4L57A 4L6AA 3ZI4A 1RDFA 5ALQA 3AR4A 2RARA 2WFAA 3L8HA 3OCYA 2G09A 2JAOA 3U19A 1T5SA 2EARA 1Z4IA 4OHFA 5AW2A 4UASA 1RQLA 5IT0A 3E8MA 3SF0A 1RRCA 5AW5A 4IG4A 5AIBA 1TJ5A 1VFPA 3F9RA 1IWOA 5AKEA 2FPSA 4Y2XA 5AI9A 4CE6A 5AI6A 1N8NA 4Y2SA 4DFDA 3QU9A 2O2XA 5AKKA 2I34A 5AK5A 1Z4MA 1Z4LA 2KMXA 5IT4A 5AICA 2KMVA 3DV9A 3UMCA 4JB3A 1RKUA 1U7QA 2I6XA 1Q92A 4FFDA 4XE5A 1J8DA 3IRUA
chains in the Genus database with same CATH superfamily
3F5FA 5D8DA 2YZNA 1NXVA 1WHSA 2OHIA 3D0QA 4OOFA 2VHYA 5AVTA 1HE5A 2FWNA 2HNKA 3PCTA 2SCUB 1XLVA 5KSYA 2H16A 5EKUA 4UTZA 3AO0B 3BMNA 5BW4A 3B1KA 2QNBA 1ZVQA 2DLDA 1RJDA 1TGYA 1HLPA 4PGMA 2G9VA 3W3AA 3T5MA 1GV1A 1N3BA 1IEQA 2UAGA 5ETJA 3NFYA 3VV2A 3EW7A 5CLLA 2HA7A 2Z8YA 2QMHA 3TEMA 1YA4A 1Z9BA 1W34A 3C70A 3I3SR 5EQFA 3VPHA 1KYIA 3KOWA 1MOPA 3W5UA 1IWPB 4EKYA 3I62A 3U17A 4KBGA 2P9FA 4BWYA 3SC6A 3IP5A 3S68A 1O94A 2ZJ0A 4YECA 3GRZA 1UT6A 3O75A 2VTVA 3OO0A 5LXTF 2G70A 4DCTA 2PX0A 1Z6YA 4FD3A 4WCDA 1S96A 1TB4A 3VNAA 2ZTHA 4PO9A 4Q47A 4C2BA 4XWOA 1YFJA 2B8EA 2QU8A 3J81A 1NBWB 2PMDA 4XFKA 3T35A 1UZMA 1VE1A 3DUFA 4M86A 1N8TA 4OQZA 1UT5A 2HQOA 4H7FA 4WDRA 2UZ3A 3OZBA 3U40A 1F06A 1OZAA 3ZS8A 2QJTA 1YK1A 5I3ZA 3FRJA 1L5FA 1ONNA 4ZVUA 3UCFA 1K86A 2IXTA 3DEJA 1S2LA 1M73E 2FFAA 3D5QA 4X3PA 3DOEA 2ZQYA 4DA4A 4ZV7A 2ZUDA 5TY0A 3ZWAA 1JHOA 4L08A 3H8SA 5TPZA 4OCZA 3ZE9A 2GWRA 4OXXA 2QPAA 3F71A 3S0JA 1C50A 4Y1FA 1WIWA 2QM8A 5K0EA 2C00A 2B1GA 3PHHA 5IN4A 3U48A 2KBEA 3DHNA 1WCIB 3L6DA 4ENSA 2W6MA 2Q2QA 2AHOA 2GSDA 4RY2A 5C7OO 5FUYA 3X1DA 2EZ9A 2CF6A 2F2TA 2W42A 1DBRA 1E64A 1MQ8B 1FP2A 1N9KA 4Z4GA 2FPXA 4MKIA 1J8MF 2PRSA 3GCDA 4IS2A 3F90A 2XNDA 1CUSA 2D06A 3DAOA 3EQ8A 4M53A 2AWNA 2B1JA 2CJPA 1SIWA 4I4LA 3P9PA 1RBMA 3K2BA 4QOFA 4PQYA 3HL4A 2I3DA 4Q1FA 10MHA 2COUA 3QKTA 4F9GA 5LP6F 2XTJA 4BVKA 2MJLA 3R74A 1BQ3A 1XEAA 3I6BA 3TQTA 1Q7GA 2F1HA 4PLYA 1V43A 5F2NA 1SB9A 4RWEA 3VTZA 2ATVA 4JJ7A 2JLBA 4ID9A 5ED0A 1SHLA 4B3CA 2BH2A 4GBMA 2J31A 4GWKA 1B8UA 2FQWA 4ER7A 1UKEA 2ON6A 4OQ4A 1XD8A 5E4TA 5EWJA 4WFJA 3D6MA 1I3MA 3LL4A 3AOEA 2EOAA 1PS0A 1YFZA 4JENA 4UVGA 3RV3A 3VR6H 5JS7A 4XD2A 3P2IA 4N0QA 1ZJWA 5AHKA 4UUMA 2I7DA 2XDQA 2C97A 2QQEA 3SIPA 4F4CA 2XCSB 2CFOA 2QIPA 1JV2B 3EC2A 2HK7A 2EKLA 1KRHA 1DTWA 1M74A 5SZIA 4CIXA 3IVAA 2H1RA 2I1WA 2OFWA 1PZGA 3JATB 4QQKA 3DP7A 4DGQA 4I66A 1E5LA 1C7IA 2QY9A 1GPLA 4KFCA 1PBTA 4DPKA 3NUGA 1P9WA 1S9DA 3I5XA 2GAJA 2VHQA 1OMOA 2FZEA 3FGZA 4A8PA 5LC1A 1WR8A 3NOVA 2C4NA 1G3UA 5AW7A 1H2XA 1OASA 3GUHA 3U4AA 5JS1A 1MQ9A 2FMIA 4WHMA 2VQ6A 3L4KA 2CNLA 8GPBA 4CUKA 2W37A 4URXR 4YJHA 4LJLA 3IAEA 4TS1A 2OWDA 3I5UA 1L5LA 3PPXA 4DZTA 8LDHA 2RBEA 3IP9A 4CVNA 4KFUA 3PYLA 2IY8A 3GIWA 1X92A 3OTIA 3GEDA 4R8RA 4KLRA 4U2EA 5L3RA 4TWAA 3R7WA 2ROQA 1TYBE 2P9EA 3ETNA 1GA4A 1A04A 1NBMD 2JGJA 3AEXA 3CLRD 3G0BA 4ID3A 3LCCA 3SHVA 2E85A 1KQGA 2HUPA 5TXGA 2G76A 3QX7A 4D3DA 1FYEA 3KX2A 1WV1A 1W1UA 5C52B 3KKQA 1DT5A 3ZDRA 5TQ0A 1ICEA 2BEUB 3KTOA 3LWNA 4XYBA 2B8WA 2HJSA 4FILA 5E7QA 5TGDA 3O84A 4H0CA 4C7XA 3EOAI 4N6OA 1BWPA 4WVLA 4CDMA 4DCOA 2C07A 5LBIA 2C29D 4I4NA 2VJCA 2B98A 3ICWA 1V8OA 4FLFA 3NWOA 2VPZA 4UAGA 4DANA 1H42A 4DDMA 4DV6B 3HXQA 4EGCB 1AKTA 1YBAA 1PR5A 1SUSA 2D4HA 2DFNA 2QVXX 3D8RA 3AH8A 4RAOA 4W6ZA 4ZP1A 2R00C 1QRSA 1XB2A 2ATEA 5K6AA 4Q3AA 1E2BA 1HZJA 2OHOA 1RYYA 3HEMA 3T9AA 5CAEA 4YDQA 3KHUA 1RE1A 3WHIA 1O6FA 1ZZEA 3FOWA 1ZNWA 1I7DA 1P2TA 4M88A 5B1YA 3L4BC 2UUPA 3G5AA 3UK2A 3ZGYA 2HLDA 1PJ8A 4MCHA 1ENOA 3O83A 3ZK8A 2XQIA 2HA0A 4QUHA 3FUXA 1JAXA 1WDLA 3NNSA 4EFLA 3FCXA 5D6NA 1CY8A 1IY2A 3CLSC 5A71A 2JZCA 3L5KA 3ZS9A 5L6LB 2XUHA 3LPMA 5C7YA 2FZCA 1I1QB 3H8JA 1E79A 1QH0A 4FC6A 2JATA 3PQDA 2HU8A 2P35A 3SBEA 4JXJA 1OFUX 3KU4A 3UJ6A 1S1MA 3TJRA 3NLLA 3I58A 1QIHA 1I3OA 2ADFA 1J06A 4RMHA 1RQNA 4RF2A 1ONPA 1Q1ZA 1RWVA 3CB4A 1YUBA 1PS9A 1QQTA 4O4IB 4Z9FA 4FXOA 2WY2D 2BW0A 3WGTA 3T1OA 3UMYA 3BT7A 1NVXQ 1AQUA 2Q5IA 4IRXA 2J33A 4MCAA 2DYKA 5HRUA 3AF3A 3AF2A 2LCQA 2C42A 1GARA 4L95C 2AYXA 2C3PA 4X6LA 2ZT8A 4CCSA 1G8FA 4FT2A 4EJ6A 2W2KA 1S2OA 4DIKA 5DBHX 3O8OA 3ZGOA 4NE2A 3R2JA 4Q4DA 5B1HA 2OE2A 2QPLA 3Q7SA 3F96A 1U28C 1G5FA 1X7GA 4HLUC 3IERA 3UF0A 2ZCUA 3W8FA 5KC8A 5M7EA 3ROEA 4DCMA 3ZDAA 4TTSA 3THYB 2EAUA 3WNBA 1KSJA 1XHFA 3GFFA 3UB3A 5KQSA 4Y18A 4L8YA 1R1DA 3BMOB 5JSYA 2A67A 5K8VA 5CT5A 1L5OA 5GONA 3CJTA 2P2CA 1DLJA 1WUIS 2B7LA 3ORSA 2WU3A 721PA 4ZCSA 1KC3A 3WGLA 4ZRNA 5LLSA 1AQYA 1VIVA 1Y37A 4GPEA 3SIXA 3VBEA 2E4AA 3X1JA 4D9GA 3M4NA 2NU9B 2YC4C 1ZZGA 3ILHA 4A2QA 1UBJS 3MXOA 3ZCUA 3I5YA 3HXLA 4X65B 5DYIA 3N8HA 4AJHA 4DLYA 3RODA 1VPVA 3OOJA 4LJRA 4YRTA 4NICA 4D02A 3AIMA 4FHZA 1Z2CA 3TRKA 1SXJD 4IHJF 1HE1C 4HQRA 4RYLA 3V7WA 3COZA 1R4NA 5EUCA 5DLQC 1X0XA 2Z2IA 5G0SA 1QGED 3CUEF 3WRWA 4AS2A 4DR2B 1YC2A 2FR1A 2GH1A 4AJNA 3P97A 1SC3A 3NWEA 2NU7B 2BJVA 2KLHA 3ADBA 3LUGA 2YIMA 3TLCA 3BL6A 1DAPA 5FWAA 5J47A 2PK3A 1TUGA 2Z9DA 1Q7CA 2H3EA 4Q7LA 1YKSA 2V0NA 4MUBA 1I1HA 3BDAA 1ZCBA 4R2IA 2JI6A 3KVRA 4FFLA 4W8OA 5B58T 1CQIA 4ZDJA 1T9CA 3GGCA 3DOJA 3PF8A 3IEUA 2IYNA 3L1UA 4ZKDA 1IN7A 4MVJE 4OQMA 3HBJA 2AOUB 3MCAA 2V1UA 1G5IA 2HWUA 1YQGA 5AYVA 1YF3A 2ZSDA 5IBQA 4IGIA 4DBVO 4P7GA 4DREA 3V1TC 3AU8A 2J7PD 4DAOA 4RPCA 2NO4A 4NEHB 2EX4A 1OZ0A 4CTMA 4MKXA 3QEOA 1HEYA 1CCWA 4L8FA 2X7XA 3YASA 4G09A 4TTJA 1ZGGA 4KQMA 4D82A 4RIGA 5I7RA 3PGJA 3VPAA 4EYGA 3G88A 5FAXA 4CU2A 5JJ5A 5F4BA 3V7NA 3K6KA 4WKCA 1E92A 3IEPA 3L8GA 4LECA 4UEQA 3CLUD 4V2IA 4WSOA 5LYJA 4C9BA 4YO7A 1GTJ1 2JGKA 4C0BA 4QEDA 4UHHA 1CR4A 2FG6C 1SVUA 3A05A 3MGBA 1RKXA 1DJOA 3OMXA 1PKEA 1DWUA 1P7WA 3CH7A 4V0MA 4AG3A 1PR0A 1WMDA 1KFEB 2HO4A 3TPCA 1DBSA 2BFFB 1NMEA 4F72A 5CURA 1JG7A 2JC3A 2JHCA 2QRPA 4X71A 4ECEA 3LF1A 4X1YA 3H75A 2JJQA 4QOHA 2ZITA 4EH1A 5LR6A 1ODLA 3WISA 2CMGA 2AF4C 2ZSUA 4QPPA 1GR0A 3CEHA 3IDOA 5J4HA 2E4UA 2G9ZA 2EYQA 1PEYA 5CTJA 1R9MA 4OH7A 2H17A 3ULKA 4JD5A 4E51A 3R7LA 3HYNA 1N0HA 1VIYA 3RAEC 4CCAA 4PRYA 5KDDA 2BMEA 2G6BA 3N8IA 1UJ5A 5I9TA 5G1OA 1N75A 3KK0A 3EFEA 4GOKA 1M9NA 3GH3A 2AJDA 2O8EA 2HJHA 1G291 1H93A 2H1SA 1Y3BE 5TB5A 1RWXA 1XIVA 4HJXA 4OD0A 3RYHA 4RF3A 1U3TA 4JUAA 3WP0A 5HJEA 1DHTA 2XF2A 1DIBA 4BLUA 1UIMA 4KPUA 3PGMA 2L19A 4UAJA 2CXOA 3SDZA 2BGLA 3TTUA 3RFXA 4BMYA 3C48A 4ZWNA 3SZUA 1NBMA 4DV0B 1M83A 2OGSA 4TVKA 4MIEA 1KEWA 2I4LA 1W5TA 3A32A 3ENNA 1E2FA 1GGMA 1RMYA 2IPXA 3DOIA 3G6WA 4HB0A 4TV8B 5K9ZA 3LQFA 4FR0A 5EXDA 1MO3A 2A86A 4U7JA 4DIDA 1E9BA 1ORRA 5DYYA 4IHJB 4A6XA 2C4MA 4DXDA 1MGOA 1W1WA 3ZLUA 1QTNA 2HZBA 1KYVA 3WQRA 3QYJA 3EIFA 4QRIA 1O89A 3ZTWA 4AO6A 2OSVA 1G59A 3M89A 4YV2A 1DAMA 3DH0A 4R8MA 1CRWG 4PYQA 1CEEA 5KVSA 2PXAA 1T2VA 3GAAA 2B30A 3K0AB 3WWPA 3AR3A 1F8FA 1DC4A 5MF6A 3FFAA 3I64A 2HJWA 1FRNA 4KSYA 2B3TA 5FWXA 1J5EB 3ZCRA 4CQJA 4BQOA 1N3LA 2F59A 4D2IA 5EJMA 4OI2A 5JAIA 3OTQA 5FADA 1K7YA 4OLAA 1C80A 2J85A 4DG9A 2W4MA 2ZE8A 4G2TA 1W75A 3HCCA 1CP3A 1QORA 1RRGA 3BGSA 2VTKA 4FONA 4G0UA 1XFDA 3G59A 1Y33E 1E9CA 5K0GA 4EMSA 1J2RA 1FNNA 2ZCVA 1T6YA 2A88A 1NQUA 3PTZA 1N7HA 3E3MA 2JH9A 1I32A 1QO7A 4KVZA 1WA5A 4KWHA 2AX3A 4BZPA 3G1UA 5AVYA 3D4LA 1M76A 2V3VA 1EM8B 1PT7A 4GP9A 4JA2A 3PITA 3DWFA 1DQRA 4MRNA 3A14A 4TS9A 5SY4A 4PSKA 2IWRA 3VJLA 1C0PA 2GHTA 3ABOB 3SG0A 4BLWA 5J3JA 2IOFK 1A5SB 4XPIB 1KVTA 1ULUA 3MWLA 1G5HA 4IGAA 2ES4A 3KUUA 2X0JA 1XZBA 3FB4A 4EW1A 1K4YA 3OT4A 1A2OA 4TXJA 5H4HA 1VJTA 1BS2A 4HLDA 4MWDA 1NP3A 5ALQA 1Y5RA 5B7NA 5DWDA 3G9UA 3ER6A 1YT5A 4O8ZA 5L3SA 3E3NA 4I4TF 3PD7A 1QBKC 3PDIB 1A76A 2DECA 2FU5C 1R66A 2ID9A 4RVDA 3T7SA 2V59A 5ITVA 1P5RA 1XKQA 4I3GA 1KJJA 5I51A 3MCTA 5LA6A 3CUYA 4M3NA 3HSKA 1NNI1 1Y42X 1JFFA 2CNDA 2ZJ2A 1CZRA 1UPAA 4LGYA 2DLCX 3ORHA 3S2FA 3QPCA 3LQ2A 1DUSA 3WMGA 4N76A 3BPSA 2AOTA 4KYIB 4QTXA 1P39A 1TIBA 2O52A 4UU8A 4S0ZA 3TIVA 3CZRA 6PFKA 1AV6A 2J5BA 3QU9A 2G77B 4HQ6A 5AK5A 1KYZA 3RH0A 3RFTA 1OBFO 2KMXA 4JLPA 4B3XA 3UV6A 2KHZA 1AA6A 4FSXA 3CF6R 5JY6A 1ECPA 5JJKA 4A91A 1QHEA 2FK8A 4TZ0A 4RMIA 6REQB 2EGHA 1M34A 4Q4JB 1Z08A 3KCNA 4WZAE 1HYHA 1KZ4A 3DBVO 2N47A 1O87A 3OLZA 3R5TA 4RJLA 1LDGA 5K0LA 4L73A 3A4IA 4EMBA 3TW8A 5B6IA 1EM8A 3KD2A 4I1VA 1I5RA 4FGZA 3HV2A 3TSAA 1M7HA 2JIBA 4NMXB 2G08A 1NI4B 2CMDA 3LX4A 1JDBB 1OU0A 4HNGA 4YRPA 1HNZB 4Q9LA 4ZVSA 4R5HA 2Z8ZA 2GNPA 3CX7A 1FNMA 3UHFA 1TEHA 3R6TA 4ZYYA 2AX4A 4I36A 4RNCA 4EPTA 3ZDFA 4J90A 2Y1FA 1S2IA 2Q3MA 3ST7A 4HMQA 2OVBA 3FFWA 4LY3A 4DLBA 1GEEA 1GSHA 4U1RA 2F9FA 1V35A 1YZTA 4U6SA 3UT5A 1W8DA 1SRQA 2IP4A 3RSQA 4AXBA 2AD1A 4M1MA 1RZRA 5IK2D 4BEVA 3EPPA 3AKEA 3N3BC 5CYFA 3OEED 4DQXA 4UEWA 1L4LA 2ZI9A 3OX2A 4LOKA 3WGIA 4L4XA 4NCXA 1XTUA 2VT3A 5ALGA 1D2AA 4ILEA 5IH3A 3UMRA 3CVXA 5ECWA 1RJFA 1TQHA 1RE0A 1XTKA 2IHNA 4EM6A 5ARDA 3QI7A 4CM8B 3DO8A 5AK3A 5LMNB 4MP3A 3A28A 1S2DA 4OUKX 1UDWA 2ZRAA 4I9GA 1JQ5A 3GMSA 5GP1A 2A6PA 1N6PA 1KK0A 3CEAA 3WL6A 4GMHA 3CUTA 1NW8A 3DVAB 5LZ8A 5C1PA 2FN7A 2D5LA 3FGOA 4NE9A 3ZJVA 1DJMA 1O96B 2NPFA 3BCRA 3H05A 3EA4A 2Q6KA 3CMCO 1G8YA 3GLRA 4CR8A 3GDWA 1UBRS 2AN3A 3CY6A 4TMXA 5DLPA 3TQQA 4YAIA 4YT4A 3LDFA 4V38A 1CZUA 1XGKA 2YICA 1GRCA 3FJYA 3HWRA 2BN4A 2R8XA 4J9VA 4WN9B 1WCXA 1OY1A 1C1DB 2DQKA 3NP7A 4NTZA 2LD4A 4KC0A 1NN5A 4KRGA 4NZ9A 4EPXA 5CDYA 2C0CA 2PXXA 3LT1A 2CUNA 2YVUA 4DSZA 1GCAA 4JI7B 1XZMA 4Y2UA 1W73A 1E61A 3SYMA 3KT0A 5K3BA 5HYVA 3ENWA 2QTGA 3VV3A 3QPUA 4IJ6A 1TM1E 5ARCA 1DJNA 3M81A 4JI8B 4YBRA 3DFUA 4MQ4A 4TTVA 4BFWA 5JU6A 3HN6A 4KIFA 2VZEA 2YTZA 1OLSB 2C04A 4RPGA 4DUGD 4EPYA 2OZVA 1ND5A 2GVNA 1OFTA 1TM3E 2GYYA 2UZIR 2E4WA 4RFSA 4XX0A 5CU7A 2BMJA 1Z74A 3AEQA 3LYHA 1NY5A 2IIQA 2IOYA 2NVWA 4G8DA 4B3BA 4AS3A 4IL5A 1CBUA 1EM6A 1NUUA 4CJXA 1JSZA 5LZ7A 4I50B 3MT8A 3NMUF 1MO7A 3K0KA 2VT2A 4V3CA 4XJTA 1VG1A 3ZIAD 5B2FA 4LK3A 2Q2NA 3W6OA 3R3SA 2JLCA 5IAKA 4TLBA 4C5CA 3L7OA 5G4LA 1WP4A 4NV0A 1E94E 4W1SA 1L8QA 1VJRA 3JQ7A 1RZRD 2YWJA 3HVUA 3JWEA 1V5EA 3QUAA 3D1LA 4HJRA 4HYYA 3F5QA 3M6AA 1B41A 3AP1A 4HFMA 3AM1A 4Y2QA 2YFYA 5D5HA 3TG8A 5THXA 4QXAA 1MAUA 1GVHA 1CUCA 2VP4A 2C5AA 3CRRA 3K8YA 3GFQA 4PNHA 3UJBA 4BJ5A 4HTFA 5FTMA 1QE0A 2KM1A 3FXAA 3K9HA 3KQYA 4MS3B 4L4RA 4MHSA 4P53A 4AKTA 4EGJA 1OGJA 1UQTA 4BTLA 3JZMA 1TLTA 2FMHA 2V7QA 1K7EB 1DL5A 3LM8A 5LZ5A 1ZVKA 2WJWA 3U3JA 4DUGA 3V4LA 1Q19A 1QZZA 3NFRA 3Q0EA 4FZ5A 4XCXA 3LA6A 3O3OB 1LTQA 1WXGA 3JX9A 4FYHA 4MWOA 4D41A 3HDHA 3L84A 4LPSA 3LECA 4OFBA 4QG7A 4C4AA 3OUUA 4ZT4A 4RSRA 5G0TA 3SN6A 2VUSA 2XBMA 5DMXA 1NMYA 2O54A 2B9EA 2BM9A 4LQDA 5JASA 1W0KA 3MTQA 3HGMA 3DMYA 4WACA 1Q20A 5FWYB 2DPXA 3V00A 1N78A 3GFRA 2ZBVA 3U4MA 1DLIA 1G2PA 1JXOA 5CW2A 1OWLA 5BSWA 1ISRA 1LPBB 1CF9A 3H4VA 2ZIVB 3HC7A 2Z04A 3GAFA 3L8YA 4TKVA 2PL5A 1BYUA 3A1NA 3N0WA 1QQBA 1ND6A 121PA 3NIBA 3K8OE 3OZRA 1YVUA 2OP1A 4JJEA 4LXXA 4QDXA 1E3WA 1OXBB 3DTVB 1JJIA 3QG1A 4U7FA 3W5IA 5FJIA 4P86A 3EF3A 4BQPA 1MOZA 4L07A 4IDEA 2XUJA 3OM9A 1G64A 3TI7A 1EFVB 3BKXA 4QSHA 3RC7A 3OE1A 2KI5A 4HSGA 4BIMA 4BOYA 4KDCA 1N32B 4WXEA 1ZHFA 1GCUA 5ENZA 4PX3A 3ZDZB 3R5KA 3OZAA 1UK8A 4IOKA 1P0FA 1NVWQ 3CKKA 4FFWA 1Q83A 3VGPA 1KS9A 5J59A 1GUFA 4B71A 4DTIA 5L51A 4GF5A 4NPHA 4R1PA 5KCZA 2EP5A 4MICA 4XUDA 4YYEA 2BKXA 4DR1B 1RP1A 4QVIA 4XGNA 2GNAA 2HDNB 4ON9A 1R4ZA 4I6GA 5AOBA 3X1KA 1GQYA 4AIIA 4MULA 5FWYA 5FA6A 3VU1A 1SVWA 2QZZA 3IUPA 4MPTA 3H11B 3MJCA 1ZD9A 3IPYA 3HUFA 2VATA 1P9NA 4HYEA 4MVJH 5CD1A 5FTKA 4D97A 4DNQA 1KDPA 1XSEA 4GYWA 2B3DA 2GEDA 3CLHA 5CH3A 6GPBA 3IP8A 3DLHA 3OF3A 5INTA 2QD5A 3K9NA 4G5OA 5EN4A 4LJ8A 3WB1A 1DT3A 1L5SA 1Q1QA 1RKQA 2HV8A 2JIPA 1UZUA 4KDRA 4X8LA 2OWEA 2YXDA 4OATA 1BD3A 1TO1E 3IEXA 3T8YA 2CDNA 1BEUB 4DWJA 3HGTA 1SOMA 3NHBA 1Q0HA 4H17A 2R62A 3NBQA 1MIHA 1YMUA 2YHBA 1K97A 4FGSA 1Q14A 4B7AA 4PBSA 1OAOC 2IEBA 2W70A 1JXAA 2CL5A 5IN5A 5KTTA 3UXYA 2I7CA 5FFMA 4BO8A 4RKQA 5CRIA 4LRQA 4B6SA 2HF2A 2PX4A 2A0YA 1U31A 5HQTA 4A23A 4TS4A 4MCJA 4HGOA 4BCDA 4N5NA 3RS2A 4AMBA 4NHEA 1BNCA 2DH6A 5CAEB 4YMHA 1DBVO 3ZWKA 2IPNA 1KYXA 2D3TA 4LV8B 2WNSA 1OBVA 1JS1X 4GPTA 4Y2HA 4JQZA 4ZDIA 2JFOA 2FZWA 4LQLA 2DUNA 1VPEA 2WMDA 3HKEB 3BC1A 5FOSA 1K8RA 2QTCA 5EESA 4DV3B 4R3UC 2W48A 4E33A 5FBHA 4ZC1A 1C3OB 2O2YA 4HEJA 4QOEA 4YHBA 1CT9A 1Q6ZA 3OP1A 3DMNA 3P9CA 2GASA 3PVZA 3AOEC 4JKYA 2ZB2A 5JCXA 5LOVA 3A58B 1K5PA 4H0NA 4KVFA 4OG2A 3P9IA 3BIWA 1XZ8A 2PFSA 2E7ZA 3PI6A 4DB4A 1MPTA 2R4QA 3IKLA 4G9EA 4M87A 4X7PA 3ZC3A 3QWIA 3O4FA 4G07A 5DFAA 5BWOA 4D9HA 2CV0A 2IYAA 2C82A 2J3JA 5T4BA 2I7VA 3PHIA 1MZPA 4A5OA 4ZFNA 1R15A 2PX2A 2XMGA 4H15A 2IFTA 1QCCA 1TDJA 4XH9B 1ZCFA 3EBPA 5K7SA 4CLRA 3CE6A 2M6SA 5AJYA 1P2DA 1OXMA 4B9AA 5C8ZA 1OI7A 2II6A 3CNEA 3F0TA 4I46A 2QF7A 5HCUA 2QD3A 4GP7A 3ZUGA 1PEDA 2HKIA 4G86A 1DIRA 4YJHB 4PX2A 3RYTC 2CFCA 1T0JB 3QLJA 5DP1A 1GNQA 2VF7A 1KIAA 2CK3D 3FWYA 3ETCA 2PX5A 1O6CA 3V1YA 1BE6A 1TM4E 3PJGA 4EJSC 3W5BA 1AZLA 5D3MB 4CIAA 4GEGA 1RQ7A 1OFIA 1DKPA 5REQA 5KYGA 3DBLB 5IH7A 2DFKB 1C8VB 3IAS6 2OZLB 1FU4A 1ZDMA 2DWOA 3ZE0B 3ZXIA 4HRVA 1NJ6A 3QMVA 2A9JA 1OV4A 3MGCA 4GSYA 4TS3A 5IHPA 1P74A 3B9BA 5JLJA 2WF5A 4DA8A 3BWBA 3S1AB 2V6GA 3UH0A 1A2KC 1ZIPA 2CL6X 2YH2A 3HPRA 2VCHA 1ODFA 3F5SA 5AK4A 1X86B 1ZIOA 2WUDA 1ZITA 2C5EA 3Q0IA 4N0PA 3GVIA 5ALPA 4E21A 4OX9Y 1R2QA 1T5LA 2X5KO 2I4OA 2FPPB 1P62B 4FFPA 4X91A 1GPJA 3AIOA 4F46A 1HNWB 3GHHA 4WERA 3HMKA 4KOEC 1TVKA 1SUBA 4PYOA 1Y3AA 3TUZC 1ZGAA 4YC7A 1B6SA 4QYIA 1R5NA 3TVDA 2OG1A 4E3ZA 4H08A 1NBEA 3IDSA 3ISJA 2H1CA 2GA9A 1VG9B 1TZKA 2REQA 3NV9A 1UMDB 4P5DA 1UAAA 2ZLBA 4AP5A 4YP6A 3GEBA 4JT2A 2YBEA 5F76A 2F9LA 1PNOA 3ENQA 1E59A 4FQ8A 3WGQA 5JD5A 3HN2A 2F00A 1Y3CE 3FCYA 4H7JA 3NTLA 2DHRA 4DL9A 4RY0A 2AFIE 4J8PA 3R76A 3W6PA 5IM4F 2IY9A 1J97A 1IDOA 5DNEA 3TK1A 5IAOA 3FPGA 3N5CA 2ZJBA 3I2GA 1Y5MA 5AK6A 2BJWA 1M6YA 1H3EA 2Z58A 2QYSA 2CVZA 5BR1A 1UEJA 3RTEA 5U9CA 1MRZA 4PGFA 1CS0A 3E84A 4OJNA 4D4IA 1E2LA 3OA0A 4URUR 3BS4A 1BGXT 4NDAA 5FBZA 2ERXA 2WUWE 3I2JA 1EP3B 1ZEJA 1YB6A 3AVPA 4K9QA 1SCDA 4HDAA 1KVSA 4R1LA 4F8YA 1QDEA 3HUDA 2ODPA 4PPQA 3U1VA 3GFGA 3GRPA 2B8NA 3D2CA 5M34A 3ESZA 5EKXA 2ZVQX 2WM8A 4QNRA 1Y1QA 1JE1A 3A25A 2CCJA 4LSGA 3RJTA 3MMZA 5T7BA 4D7AA 3IE0A 4GR5A 2NYAA 3FVTA 2HDWA 5IULC 1E3MA 1D8AA 2RIRA 2VAWA 4K81B 4ZI5A 2YL2A 4LSWA 2NX2A 5IAGA 4QU9A 1YOVB 3COVA 1TD9A 1XVLA 1NBHA 2XQKA 1JDTA 3LCJA 4MVXA 2QMYA 4F6CA 1QU2A 1JTFA 1EPUA 1JGTA 3GVXA 1TF5A 3Q7PA 3T9CA 9ATCA 3B5IA 4F04A 1SVKA 1U7UA 4H77A 5J5VA 3WZLA 3W8EA 1OSNA 2QUZA 3KYDA 3H2ZA 3SWWA 1BFUA 3U9TA 1QFYA 1FXUA 2MINA 4X20B 1SHJA 3MWGA 4XQ0A 5T67A 4TRMA 1ZRNA 4PSVA 1OTYA 5CVTA 2B4QA 1WB4A 2GCIA 2RHDA 2ZQZA 3PUIA 3UB2A 3FOAA 4UUOA 3KSAC 1F3LA 1SBNE 4KXNA 2ZIUB 1OX6A 2EZUA 2GZAA 1T1JA 4Q4AB 1DU4A 2C9MA 4BX9A 4XA8A 5AXAA 3BJIC 1RAAA 4J7XA 2P2DA 1NYLA 2IE8A 3H9GA 5IUKC 5ALXA 1JDJA 5KJEA 3UHPA 3CPJB 3COSA 3RTCA 3VAYA 4FR2A 1E7WA 2ZWMA 1TE2A 1N6OA 3NEYA 3BMNB 4KQ1A 4RE6A 3USZA 4YJ2B 3F1LA 4EDHA 1AXGA 2ZRFA 1OGYA 2NUAB 5IC4A 5JRJA 3KOMA 2WMOB 3IO3A 3JCZA 1K5DA 5BPFA 4C3UA 4LOJA 1XFAA 3PU6A 2AJBA 3D3WA 4UCFA 4BO7A 4IHJA 3I61A 4LYJA 3DMTA 3K0BA 4QNMA 2BI7A 2QI9F 1KOLA 3AX6A 3TD6A 1G5PA 4RF4A 1HSZA 1N36B 3OCYA 1DEOA 2BTQB 2ZKIA 5C8VA 2JGIA 2CLEB 2JASA 1AGYA 4P4GA 4BNZA 1K0UA 5TF0A 3M3PA 3M4JA 3PK0A 1RRMA 3J7AC 1PR3A 1RQLA 1KVRA 3W6NA 4KDEA 4CETA 1QIKA 2X2PA 2ZS9A 3MAJA 1QIMA 5JZ9A 5TMPA 1RRCA 1F38A 1NKTA 4KKVA 5GONF 3RHSA 3V6LA 1M1YE 1KXJA 6LDHA 1CEYA 1A9XB 5J2UF 3H04A 3CZ9A 3STHA 3C3JA 4MS1B 1R37A 1IBMB 3AY7A 2J3IA 3KELA 2GI4A 3UJ9A 2RI6A 5D7BA 5TVGA 4MV5A 4EL5A 1GKLA 2RJ3A 1SO8A 3NJRA 3PJEA 4NE7A 5DDIP 1FC0A 4HN2A 4II3A 5EG5A 3V1MA 2PCLA 2FZ5A 3G17A 2XADA 2OAGA 4A92A 1ZMOA 2VAVA 2P6PA 4HH4A 3NHUA 1U8TA 5JS8A 4PAWA 5JYEA 1QLJA 3EUWA 4ZI3A 2HTEA 1KMHB 2ZIXB 1HKHA 2R1TB 4RABA 5KTKA 1KDRA 5DU2A 4YRKA 1LPMA 1UDAA 1L8OA 1ZD3A 3BSWA 3EVZA 1K5HA 3HJAA 3ZJ5A 3I30X 2B82A 2RD2A 4D6YA 1NYTA 3KL2A 3SHFA 3VHRA 5G0VA 5HBRA 3ZK7A 2RONA 4EABA 1YTUA 4H3HB 5K99A 3O7MA 3IXLA 4IVPA 4QQFA 3WC4A 3RGWS 2I71A 4JX8A 1BDIA 3BHNA 1XCPA 4N5LA 4CFSA 5JMWA 3H6GA 2QG4A 3ZTTA 1L7QA 4G8CA 4L6IA 5EQTA 1K2WA 3FR8A 2VEOA 2I9PA 4HRAA 4RM2A 3EDYA 3JWHA 4H4CA 1TEZA 4O8CA 4BKRA 4HY3A 4P4NA 4O25A 2AFVA 1EDDA 1C2TA 2YJ3A 4JUFA 2WFLB 4PZ0A 2QDKA 3QXXA 3DMTC 1W36B 5CFOA 1J4AA 1SQ5A 2HSDA 4Q1VA 5LP6C 3TNFA 1L7BA 5DJ5A 4W5OA 3PEVA 4HDRB 1KO5A 3E70C 5A0TA 4YMSA 2CUKA 1G21A 1LA2A 1PLLA 2N1BA 3HDQA 4TTAA 4XJVA 4JI5B 1D2NA 1Y4UA 3MS2A 1Z4QA 2PEYA 2X42A 3DZIA 3LRTA 2W6ZA 4ZIRA 3PRKE 1T2EA 1N5JA 4RZHA 3I9KA 2OP0A 3P2JA 2FLVA 1AA9A 1FX0B 3D8TA 4M9ZA 1R27A 5D1NA 3WLPA 1V45E 2X0RA 3UW3A 1CXZA 3ZJTA 3WA7A 1KDZA 1FX0A 4C6HA 4WZBE 3AR9A 1S3IA 3LY7A 4X97A 5EMKA 5KPDA 1QGUB 4KG7A 3KLNA 3PUWA 1U2ZA 4DRXB 2UZ1B 3IHLA 4TGLA 1Z6GA 1UOQA 2HXSA 1G42A 1I7PA 2VDVE 4L3WA 4O4LB 3HDYA 3NPAA 3TE6A 2C78A 4DV7B 3HR4A 1EBBA 4OAOA 4AF8A 4EG8A 4P92A 3T9FA 5JJCA 4EB8A 3HNRA 4PG4A 4PINA 4CLXA 5ICEA 1R0WA 4TTIA 1SOWA 3U0VA 2C95A 3MCWA 1WU8A 4B7XA 2Q1SA 3D6HA 4FUQA 4DY6A 5I9MA 4ZJPA 2HPZA 4YACA 1PWYE 4EGQA 3JR7A 3KPWA 3LCVB 2HQ1A 3NATA 1V25A 3EXFB 3T3OA 1PS8A 3GK3A 1H2ZA 3HRKA 1E20A 3V80A 4MJXA 3KTAB 5IT5A 3AFIA 3T38A 1U7PA 3LWZA 5IXYA 4C7KA 4EGSA 5CFNA 1HE2A 2IU4A 4EHLA 1L8LA 3RCBA 4RX1A 1D2RA 1FK8A 2C0PA 2R1VA 4UUAA 5J40A 1N92A 1N6HA 3C6ZA 2AHRA 1G7RA 4KXWA 4EIWA 4POAA 2VWPA 1Q5PA 1ZA1A 4K26A 4BO5A 4EG0A 4TMFA 1YKFA 3ZWBA 4Q18A 1X39A 2CFRA 1ISGA 2FUEA 3ND5A 4HFRA 1AGNA 2OK8A 4J75A 3H4IA 4N9WA 4G0ZA 2A9RA 2RGYA 1M6VA 4MQ6A 4MQLA 3MTEA 2OHVA 4QEZA 1XMVA 3IBCA 1AD2A 1QV9A 2P41A 3A3YA 3BWEA 3H5AA 4IVQA 1CRZA 3AHFA 1NPTO 3H17A 2CL0X 2ZI7A 4AICA 2CW5A 1Q77A 4E11A 1K7CA 1W8IA 4ZGBA 1EVJA 5AW1A 2BKLA 4RK7A 2YYYA 3TCNA 3P96A 4ZDKA 1NT4A 3W2IA 2P8SA 4ESVA 1A9XA 1HDCA 4LCJA 4R6XA 3VHLB 5FD8A 2PRYA 1YV9A 2WHRA 3KVVA 3LS2A 4J16A 4NBUA 2RKWA 4XQ9A 4Y6SA 3ZH9B 5ALVA 4CUZA 2H2WA 5BSFA 1FTGA 2C2YA 2V65A 2B99A 2ZYGA 4JNKA 2VP9A 3VZQA 1A9YA 4UPDA 3TQRA 2OO7A 4J0HA 2KPOA 2PL9A 4KZKA 2FCRA 2L18A 2PDAA 3BTUA 3U16A 3JYPA 3FF1A 4WA8A 4CT5A 1BDHA 3MJEA 1G98A 3RVSA 1ZRMA 4YAKA 3FYCA 4IDFA 1SVIA 2BMDA 2H2IA 2V9PA 3AHGA 3G8DA 1V2HE 3Q87B 5D01A 1C30A 2X22A 3INGA 2ZI4A 4FEEA 1RXVA 4RF5A 4CM4B 1JSLA 1W36C 3W2HA 1JR2A 3DZGA 1RRVA 4GX1A 1E3LA 3PUHA 2UYHA 2NMVA 1ZW6A 3NM5A 1L7PA 1NKSA 5AUPB 2ZJZA 1NWCA 1Z33A 1AC5A 1KJIA 1RXIA 3ORYA 4JQSA 3CX4A 1KGSA 1R8JA 3EWNA 2PIDA 3ZV7A 4XD7A 3BXEA 3KQVA 4M1SA 3IRVA 2PU7A 2JNWA 4W5QA 2A1TS 3IYLW 3SDSA 1N8SA 4RY8A 1PYOA 4WOCA 3NTRA 4B81A 3WYGA 3NHMA 1E2HA 1SUCA 2J1LA 2ZB3A 3PR1A 3KJNA 2YVAA 4LJ5A 2GHQA 5HKLA 3AF0A 4EW6A 4ZKEA 3VVBA 4MTCA 4WN3A 3JW8A 1IOLA 4RA6B 4H1UA 2JAWA 2XVMA 3VDQA 3BRWD 5IZ4A 1X7ZA 3GLVA 2RK3A 4F3TA 2XDAA 3QITA 2GILA 3BWCA 5IK2A 1PIWA 3HEAA 3CR7A 4E2FA 3EMKA 2WD7B 4KLAA 3FNGA 3LZCA 5CGZA 4UDXX 1ADFA 2PZGA 4PTYA 4PIMA 3VNRA 2DCUA 4GGMX 1YASA 3NIGB 4R1QA 1MJHA 2Z2KA 1V26A 2AJTA 3AR6A 1JIIA 4WBNF 1ZX1A 2C3MA 1RMTA 2JAPA 2SHKA 1NATA 4Q3CA 1VYVA 3T5TA 3I9MA 5B5SA 3L8DA 5A4DA 2P3OA 3DEIA 4ENUA 1YCFA 2WF6A 2XIJA 3W9YA 1PE0A 2FRDC 4MUAA 1ENYA 2EEZA 3NDRA 1Z16A 2VDKB 3U3OA 1G5QA 3V8RA 2BPOA 3WNDA 3T1HB 4F96A 2ZCJA 2FW1A 1BU5A 3H3JA 1E9SA 3LCRA 3TRFA 4Q4LA 4MS4B 3R0IA 1U8AA 1Q0PA 1Z47A 3CWQA 1JFSA 2PRJA 4GMDA 1KIFA 1U63A 1PFVA 5GM2A 4OXRA 3E22A 1M5UA 3R7DA 5DNCA 4E09A 4BB6A 2HIHA 3ZEIA 2D0IA 4OI1A 2C31A 1SUDA 5TQ2A 3W4JA 5C9ZA 4EKIA 3OC0A 3Q98A 1RPJA 2C7RA 2YQZA 4INOA 4KMRA 1FEZA 3C8ZA 2EKDA 2CGEA 3STUA 1A4IA 1JDPA 5BR7A 2ZFUA 1JR3A 2XKBA 2ZXEA 3NWPA 1IXRC 4LHEA 4LRXA 3SJZA 2G3YA 3HA3A 1X7WA 1E18A 4MW5A 4PO8A 3TBHA 3JQ9A 4UW9A 5AVRA 3LLUA 4V0NA 5JFTA 2JJ2D 1KKUA 2QRVB 2PUCA 1PKXA 2M1ZA 3G2LA 2YS6A 5K8TA 3GF4A 3KOYA 3PGLA 2GUGA 3U56A 1FQOA 5KVCA 2WMYA 1DV1A 5K20A 1MNQA 4IFTA 4K9MA 1RFLA 1NP7A 4U8HA 4UM9B 5F7ZA 1SCUB 1SOUA 2XI4A 2BDTA 3NC4A 3D0RA 4P5EA 4EFDA 2IL1A 3QEKA 1E1MA 3WLEA 5KINB 1L0BA 3G3EA 3KOXA 1IJEA 3BRWA 3EWAA 1FNCA 1E8MA 1D7AA 5FRDA 1J1ZA 5BW8A 5JPIA 4MQEB 3G2HA 4MDEA 4L74A 1Z83A 1SUAA 2OBXA 4NK4A 4WZ6A 3R5SA 2P4HX 1CS4C 1L3CA 4ZA2A 3MERA 2J0UB 5L3QB 1D0VA 2IIPA 3KTFA 1XN4A 1X8KA 1B74A 2KLBA 2WAMA 4B31A 1X8JA 4ALIA 3SHWA 5BV7A 5F9HA 4MGYR 2Z4SA 3COPA 3DGEC 4O63O 5D00A 5EZ6B 2PLWA 3VX3A 1RI4A 3K0FB 4EQ6B 1MJGM 1U2QA 1OXTA 2QX7A 4QJIA 4JI1B 2IXFA 4IW3B 4YAGA 2HJ9A 3TL2A 1CZKA 1T3ZA 1G3RA 1T9KA 4CIBA 4RQTA 4Q48A 1AKNA 4IIBA 1P1KA 1QH1B 1WXWA 1YRHA 3T4XA 1E2KA 2ET6A 1RYMA 4BV8A 2WZQA 3ECSA 1V5IA 1SBZA 1UFQA 2ORIA 3THWB 4NCBA 3WLIA 3BF7A 4IJVA 4ZCIA 2XGOA 1UPFA 3OVMA 1WHTA 3PRHA 1CUBA 3LHKA 3W05A 1EI9A 1NGSA 3H87A 1P80A 3H9EO 1NZJA 3JXEA 1SCIA 1CQJB 2XZTA 3QGMA 2BEWB 4DARA 3M6MD 4LY9A 4QULA 1Q44A 4LXQA 2BEVA 3SNHA 2XVZA 1Y8CA 2ZBPA 5CIWA 4QFMA 4ALNA 1NSFA 3TB4A 3O31A 2WF7A 1JYEA 4MA5A 5DBEX 3K6SB 3VR6D 1WTAA 3KXIA 4P7KA 4RDCA 2ZR9A 3SR4A 2X9LA 1YTLA 3B9QA 1JPUA 2OD7A 4M0CA 4BQRA 4KVAA 1C4WA 1PO7A 2P40A 2PT6A 4NCJA 4ZD6A 3UZUA 3A11A 2YOFA 4KXVA 2JAHA 2A0XA 1I33A 1JFVA 3C3WA 5IFLA 5IJ9A 3L49A 2PL1A 1R10A 2FWBA 1J2EA 4G4JA 4KWIA 4MX8A 4BNHA 4ZHQB 3PX7A 3ZZMA 1P8AA 3C7KA 4LHSA 1BXGB 1UPXA 3VU8A 1E2NA 2XCQA 1R5OA 1YHZA 1B1CA 4F21A 3DMFA 2O7RA 4KL8S 2BDUA 4N54A 3ZW8A 3ZHRA 5DLYA 1SR8A 2CDBA 3BJRA 3GRRA 4A6EA 5HQJA 1A4RA 1PV2A 3HXKA 1VBNA 1XCJA 1RYEA 1WABA 3F6SA 1T4CA 2WDZA 2IV3A 1UDXA 4UHEA 2QUIA 5GINE 2DB3A 2DWUA 5J2TB 2PFKA 2HXGA 4WESA 5F7OA 4NS1A 2FP4A 1XU9A 2EZ4A 2GPNA 3DLAA 3HZOA 1GUBA 4G41A 1D1QA 3GQVA 1TFRA 1CY7A 1XZAA 2WVAA 5KI6A 1YZVA 1DRUA 2J41A 4BMCA 4F4FA 3NW9A 3PCRB 2VJDA 4JIMA 5AI8A 4WXRA 4BNDA 4DSOA 4R40A 4F12A 1W9MA 1A9OA 4X8HA 2R8YA 3MGAA 2R11A 1PTKA 1WZEA 2H5EA 1RWOA 1BOFA 2WYUA 3PFNA 4H7IA 1LF5A 2I3BA 4IMIB 4Y2YA 4CIDA 2H9AA 4HGNA 4AJLA 3CSDA 3ZXXA 4FDAA 3K70B 1X8LA 3CH6A 4LN1A 2J8ZA 2ZSHA 2EDCA 1HL7A 1PNQA 5JYCA 3I39X 1DP4A 2WTEA 3T5AA 4JLMA 1H3NA 4MI9A 1ADCA 5G0WA 2JLYA 4RL6A 3A0UA 4QICA 1Q74A 2ZSAA 3AF4A 3UG6A 1YU6A 3JVEA 1O9HA 1ZN8A 3OFVA 5DGDA 1NNEA 4K9NA 4KACA 1K3UB 1F8GA 2YHAA 3NOOA 4JKIA 1M1NA 5ELMA 4HGPA 3EZNA 4E13A 2P6MA 4BQQA 4YRAA 1G5RA 1TT7A 1W4AA 1JHRA 3B53X 1RLUA 2O2JA 1P45A 3HRHA 2L0XA 3WBFA 4RZIA 2POCA 1V5WA 2HX1A 3BFVA 1T8SA 2CC2A 1BMQA 3LUDA 4OVKA 4EHDA 1N34B 2HC9A 1AUVA 3P27A 1SBIA 3VR2D 4EUFA 4F56A 3G2JA 1JF8A 3EODA 2ZJ1A 1NA5A 2FDXA 4NJMA 1UFVA 1S2NA 2C7GA 1DELA 1EH5A 1OQAA 1GKUB 1U9CA 2EKPA 1I4LD 2FEAA 2Q9UA 2PT9A 3A2MA 4GX2A 5JWHA 3TM5A 3UHAA 1L4HA 4K2HA 5HDQA 1F2UB 2FETA 3R0QA 3EJ6A 4RZ3A 1PTJA 4D8WA 3IIJA 1OX5A 4U7PB 3PQEA 4YR7A 5LU8A 3COYA 1JEAA 4FI3F 3L7LA 3MAAC 1MT3A 2BFDA 1WUYA 2DJ5A 5HVNA 1U04A 3UAXA 2FPUA 3G79A 5JSFA 1YBHA 3PDWA 221PA 1OLXA 1WNTA 3AM5A 2PL3A 1R9GA 3F7OA 1Y4DE 4JEHA 3I2YX 1A50B 1LBEA 3FBWA 2PUAA 3QFTA 3KUDA 3RIMA 4UU1A 1BVRA 1VJDA 1PG2A 2D13A 2P7IA 4MWSA 2AZTA 1Y82A 2WVJA 4PEVA 4FXPA 3ZHUA 1F9EA 4ZQEA 2O19A 2RKBA 1UJMA 4HAXA 3PQ5A 2GM5A 4MUGA 5CD9A 2WUVA 3MD9A 1U94A 3GBPA 5COAA 4YFVA 1LVGA 3UEOA 4CT0A 3HXOA 3MJTA 1FW6A 1BWRA 4J3JA 4CG2A 3Q4GA 1GTRA 2G09A 3ESXA 4RHYA 4NPCA 2WYOA 3KR1A 3PXCX 3JYLA 1CJCA 2FMTA 1XO1A 2XKAA 2VIIA 4IDCA 5D84A 3K71B 3FKSD 1Y3HA 3KQTA 4FIDA 5F1OA 4PGGA 2X1LA 4J3FA 4YALA 1ZNQO 4GEKA 2R2AA 3MOGA 3GJ6A 1JLLB 4PW0A 5AKEA 4KQKA 1DKUA 1PJ2A 1YR3A 4YP1A 4CKEA 3TDNA 4S12A 5AI6A 4GOJA 1JKMA 2C0QA 1SULA 2XQGA 1KRXA 3KFXA 1F7UA 1L7VC 1SD2A 2BCGY 4TWJA 4ZGWA 2BWJA 4X00A 1IK6A 2F3PA 1ULAA 5SV2A 1B0AA 5HP4A 4P58A 3NC0C 3TYXA 5ICSA 5D5QA 2I9KA 1JVSA 4D9BA 4KE9A 4F45A 4XE5A 5EJEA 3FN4A 1JPJA 5CB8A 2D5IA 1TCUA 3I9FA 2C2XA 1IZ9A 1W96A 3AV3A 3BGOS 3CXUA 4XM2A 4EG1A 1U3FA 2W6OA 3H5NA 4YLYA 1O6BA 4QEKA 3A4MA 4J6FA 2HGZA 4I50A 1V8DA 1TJYA 2GPWA 1T1EA 2JVKA 4EUEA 2VDUE 3C6YA 3MMPA 4F38A 1W0JA 4J0QA 3PI7A 5IF3A 4OMDA 3GLSA 5A5GA 3HKBB 4FMCF 1DPFA 4BZQA 4R1SA 4REQB 3MT9A 4B6GA 3VO1A 3PNPA 2A7XA 2GHRA 5ADHA 1H1TA 4JLUA 3AG6A 4AO8A 4CGYA 2CVHA 3CGGA 1WU7A 2DFDA 3EHDA 4QGBA 2R8PA 2GETA 1SFRA 3OURA 1N7IA 1T5BA 5SICE 4F9FA 4TSKA 2ZIAA 3OJLA 4QOIA 5EXTA 2GPBA 3AVOA 3BWDD 1JKIA 2XUPA 4BAUA 5I9LA 2PKRA 4ZCMA 3DNPA 3QTLA 4K9PA 3ZD8A 4EA6A 4F84A 4Z4FA 2I91A 2ZUEA 3KXLA 2XWBF 1WQ1R 4X92A 5FP0A 2JLZA 2PCJA 5E7IA 5L6MB 2YN0A 3LNCA 4HAWA 3R9KA 3GWGA 5FPHA 2F1RA 3RNLA 3DPSA 5ICFA 5JLAA 1DAHA 2CXUA 4TMTA 4XZ3A 1QQ5A 4AKEA 4M54A 5J23A 4CQMD 3QWFA 5LDDC 2IV2X 1AN9A 3I05A 3S55A 3HDVA 5ESWA 2ZYDA 3HWWA 4KMSA 5KSZA 2OG2A 4W7HA 1N4DA 1AKUA 4JJGA 5NULA 1UXHA 4M55A 3B1YA 2AF3C 4M0EA 4CM8A 3LC1O 4K1XA 4IICA 1XCLA 4I5IA 4D8VA 4DDUA 2F3QA 4UCWA 1Z5ZA 4HATA 4DRZA 2KW5A 1NC1A 1NW6A 3EJWA 4OJMX 3U62A 2O0HA 2RI1A 4CLOB 5CYGA 1M8JA 2BFEB 1RNLA 1W6RA 3JQFC 4A1FA 4LI0A 3KYJB 1OJ7A 2X9VA 1BYIA 3Q8WA 4M8SA 4FFBA 5KQGA 4OHYA 3OCUA 4KR9A 4BB5A 3ZVKA 3CVVA 4B4VA 1ZXBA 4K3UA 3DLCA 4B83A 1MO5A 4C89A 1AF4A 4YGXB 4B2LA 1C81A 2JEOA 2OAEA 2IRWA 4J2HA 2DPGA 2FPIB 2XMBA 3QHPA 4JUIA 2VUIB 5KNBH 3EXEB 1PX0A 4EL0A 5DBFA 4MV3A 1LK7A 5JPDA 2EF1A 2NO0A 1NYQA 2VDRB 3LCUA 3BJZA 1DDIA 4DCNA 1G6OA 2VHJA 1SIBE 2GBCA 3MTJA 4KSCA 2C5BA 4UHDA 5K4AA 2GT1A 1AB5A 2B8TA 5LB4A 3CUUA 1G8KA 1EVKA 2LKDA 3IJRA 5E95A 2XUKA 3RNOA 3WADA 1X38A 1NIJA 4X93A 3N59A 2RHCA 1RWKA 3GJZA 1U0RA 2ZIEA 3P0JA 3AEKA 4X24A 2ZW9A 4PYNA 1VE3A 4XIJA 4NC9A 3V3KA 4F0JA 2QN2A 3TLBA 7REQA 3ZG6A 5PNTA 4HBGA 1Z4NA 1XMXA 2HWYA 4IZOA 1DO2A 2WA1A 4I9UA 3NNNA 4FE3A 4EI9A 2QMQA 3BA1A 3L4EA 1HKUA 1JMKC 4GKJB 2R00A 4UMVA 2ZTLA 4DABA 1E99A 2A58A 3DYBA 1JEYB 1E1QA 2FEKA 2Q5FA 3FM9A 1KK2A 3WGJA 4F7WA 3IT2A 1N1MA 4WLFA 1G2IA 1EDZA 3Q10A 3ND7A 5AW8A 4D3XA 1EZ4A 4INJA 1WQ4A 3DOCA 4QGGA 2PIAA 1ZY2A 3IUEA 3E9NA 5FOVA 3MJFA 1O0SA 2W2LA 3SVTA 5HRCA 3A3OA 5CXUA 5KHAA 3DOOA 5M29A 2RGCA 2YMMA 1UXKA 4MCIA 5F51A 5A6SA 3TFWA 3A1DA 2ORWA 3RC3A 5IX8A 5C51B 1OD6A 4Y9TA 2CK3A 3B85A 1CWUA 4IQ8A 4RE5A 2D5CA 3A9TA 4LJ9A 1NNUA 3VUEA 1TPYA 2HLHA 3PIIA 4HDKA 2AA3A 3KSMA 4IXTA 4FWIB 1ENZA 4UBLA 3R75A 1MHTA 1ORVA 1XZDA 4X63A 4HDCA 1OZFA 1ZCAA 2Z5LA 2FDCA 3OIFA 4S2UA 1AKMA 2PMFA 2XA2A 4G67A 1JSRA 1MEOA 2Z57A 2OFXA 2V0CA 7REQB 3VR4A 3NBMA 4BNFA 4CYMA 1ZD5A 2BGJA 2DBYA 3EVFA 1ZI6A 1DB3A 3ONEA 1M3SA 1KR5A 2G7MC 2RGXA 3OUZA 3BFJA 3IE2A 4GOXA 4RHTA 4P7JA 4RH1A 3RD5A 2JHPA 4YCLA 3RRFA 2HMTA 1AHIA 1IPFA 1G6KA 2F64A 2IW1A 5MGBA 2ZZMA 1O7JA 3IHTA 3AEZA 1A72A 3A9RA 4WAUA 4K86A 3CE9A 2XAUA 3FE2A 1TVKB 1BHJA 2FGKA 4L4YA 3FPKA 4AK9A 5CFPA 1SHUX 1VKOA 4WIAA 4LKRA 4AZVA 4HQFA 1XQ9A 5C7IO 4HGRA 4BMXA 1CTQA 4GQBA 1K7SN 4C1BA 3IUQA 2ZRDA 3GGPA 4DSTA 4RSHA 2NV2B 3GN2A 3MTGA 1O5OA 3BRQA 4NBLA 2GBLC 1UMCB 1ZESA 5HIIA 2VTDA 2EFYA 4GFDA 2P79A 5ULLA 2OLEA 3O47A 1DI0A 4RVOA 4WKOA 5ERYA 1RTKA 2I2WA 4M1TA 3KE8A 5K2OA 5T8KC 2FOXA 1IPEA 1DINA 3VMFA 1YS6A 3CZQA 3URMA 1WE2A 1AE1A 1ZU5A 3GNQA 2TYSB 3T4UA 3UUEA 3H7AA 4HXFB 3UWDA 4BE4A 1EVIA 4Z4CA 3GEPA 2EZTA 4QBTA 1QF7A 1U0FA 3HUEA 2VPXA 1FUIA 1P1BA 2LZ0A 5F33A 1V1RB 4BNJA 4ARBA 2WZCA 3SU8A 1Z26A 2XCOA 1CFZA 2NYVA 2JJ2A 3AERA 3RHTA 5KOYA 5FT9A 4JX9A 3SICE 2D5BA 1GAJA 3ASVA 3FFBA 1XL0A 2ZREA 5E7MA 3WK6A 1IXSB 4REOA 1I80A 5TIIA 4OBEA 4CR7A 1H2FA 2UU9B 4YAJA 1JH9A 1NXXA 3FFTA 3L0BA 1A8IA 3CKYA 1EVQA 2H1FA 4BLVA 3K1AB 4BKOA 4MEJA 1LCIA 2PRKA 4GUDA 2GFIA 3GLHA 4PBRA 1MG5A 2FH5B 4TMZA 1M5RA 3HB5X 3D7SA 2WIJA 4A8JA 1BSVA 1ECJA 2BFMA 2XGJA 4I99A 5BSMA 2XR1A 2VSOA 3AERB 4MHTA 3R3WA 1NRWA 3G1TA 1OHHA 4JXKA 3OSUA 1IM2A 3PR2B 4CL8A 4F5WA 1BA2A 2X4IA 1TEVA 4LVCA 1DG3A 4B40A 4V02A 2Q4TA 4J94A 3P0RA 1P3DA 5ICCA 3IALA 3L4SO 3UIEA 5GZ6A 2JIZD 1HDZA 2JCYA 1O08A 2PLNA 2YJGA 3C97A 3HU5A 4GM1A 4JVOA 4NY1A 3WSWA 4EY5A 2J9XB 1QCZA 4JVNA 2R84A 4RCYA 5I9BA 4BX8A 2R7AA 4M76B 5FHQA 1XC7A 4D79A 1YACA 1ZAKA 3EGWA 2BV3A 2SKEA 3SKVA 4LY6A 1QFXA 1CUYA 4TT3A 3SXJA 3T34A 3T4EA 3TLKA 4G84A 1EGHA 3Q1KA 4IFIA 4LEIA 4Q66C 2H00A 4RPIA 4BL5A 4DLLA 3LOQA 4HO1X 4NZMA 4IIXA 4WNAA 1PV1A 3H42B 3HM2A 2HK8A 3DFZA 1Z7BA 4CTOA 1O8BA 5FB3A 4B46A 3JD3A 5LMCA 4C43A 3DPIA 4RY9A 4CEIA 4ATNA 1A8HA 2O2IA 2C5HA 4JELA 3AVQA 4OI4A 2NXJA 3UAOA 2XSZD 3GDFA 3NUZA 2I4RA 2PA3A 2VPPA 4IDPA 3GCWA 4NBTA 4ESEA 4RTSA 5ES3A 4XEHA 4QD3A 3BH6A 1SURA 3MWJA 2PKQO 2X14A 4DTCA 1IEWA 2M98A 1WSBA 2H1WA 3WGGA 2FSVA 3PC8C 4LXIA 3IBTA 5LDHA 9MHTA 1A88A 2RHJA 3EQZA 1SXPA 3NAQA 1Y9DA 4P31A 4HDKB 2D0OB 5HG0A 3BXOA 1W44A 4QUGA 3WOVA 2DY1A 2GTIA 3RVKA 2JCXA 4XIGS 2NZJA 4XUEA 3EEOA 2WWXA 3OLCX 5JMTA 4RD4A 1B4DA 2NP7A 1E6KA 1VPLA 2VWGA 2DY0A 1WY7A 4FDTA 3ONFA 1ADBA 1MB2A 2BFWA 2OV3A 4IZIA 4WXHA 1OXVA 2BR4A 3SYLA 4O2LA 3LRXA 2AG6A 1KEZA 1TCCA 4KLZA 3O91A 3L1VA 1VPWA 2AEEA 4A6PA 1JEYA 4R8SA 4FCWA 4RMJA 2INGX 3I8SA 3TW6A 1V1JA 2ZJ3A 1VMAA 1XVVA 1E4EB 2OORA 2Y0EA 4YDHB 3B3GA 1AUXA 1I0ZA 2ETVA 2B34A 4N65A 1LSOA 4BKQA 5ALFA 2ETXA 4FK8A 1U0TA 3P4UA 2YJNA 3GPLA 5DP2A 3NIWA 3EA0A 1S7CA 2W2NA 4AJJA 5A5VA 4RK4A 1KK3A 5LLTA 5LKAA 3DBRA 3UWPA 3TTYA 3UCEA 3W2FA 1SKYE 2Q9AA 1TW3A 3AK4A 2R6HA 4FJ0A 4BFTA 2ZYHA 2H4FA 2CXHA 3AUAA 4IMJB 2Q0HA 4X62B 4GX5A 2P6RA 3ZBTA 1XZKA 3OMLA 3T95A 2YFQA 2C03A 2IPOA 4BRWA 2PVPA 5HIJA 2IXGA 1TM7E 2JHGA 2PH1A 4LKOA 4R3WA 2FZLA 3G0GA 1R6XA 4OB7A 4OQPA 4UOEA 4EKGA 1T1SA 2XSZA 2X0FA 1QOZA 2JFUA 5F3DA 2GCOA 4ZT7A 1G63A 4RELA 5MN4A 3H2JA 4HS4A 5TDHA 2CXRA 4GU5A 3BHIA 3RF7A 1JA9A 3HJBA 3K0SA 1Z4OA 3M6XA 4S35A 3BXPA 3VKFA 3QPVA 3ZV6A 3BXZA 2VZ9A 2YIDA 4D0NA 3DUWA 3M3HA 1NAHA 1SU8A 4MPPA 2ZB8A 3PXGA 1WO8A 3HO8A 3A36A 1M5TA 1OA1A 1KP3A 4JBYA 4NHOA 5G2OA 3WICA 5GZ3A 1IY8A 1X0VA 1OX4B 1W2HA 3HLTA 3GCZA 1P44A 3JU3A 1WSAA 4YONB 1FFEA 2P9QA 2Y1GA 3CNQS 3FAZA 2Y71A 3I6IA 3L1HA 3MJ4A 2ZTMA 1QM5A 3GYBA 1WCYA 1OB5A 4QBHA 5L45A 1O2DA 4GH5A 4YRNA 1SUEA 2F67A 2V58A 4TPKA 1SELA 3ZTYA 5HKOA 2HA4A 3TGWA 3UUWA 4DM7A 4O29A 1LK0A 3I1FA 1IONA 3AV0B 4LGCA 1NOJA 4UBIA 5DI3A 2B4RO 3E9YA 3IPLA 2IUSA 1GFWA 4PC6A 2ZYVX 2H1VA 1GRQA 2V7WA 3D6NB 1UANA 4MINA 1K89A 5LQJA 1JG6A 1ONOA 5JE8A 3O4GA 3IIMA 3A1FA 4P4LA 3WRXC 4KTTE 3EG9A 4E14A 4JEUA 1OPXA 2OCIA 2V6FA 4NZOA 5T6BA 5AKGA 1TTPB 3EPHA 2F8LA 3STYA 2H54A 3UH1A 3KOUA 1UBSB 1IY0A 2OCBA 1LK5A 1SOAA 3D64A 4LOLA 4XQCA 1DXOA 3OMWA 2OXEA 4LMPA 1SKYB 1D03A 1L5WA 4WT7A 1F20A 4C20A 4NFSA 4C7MA 1RHKA 5J4KA 1UBHS 3N2LA 1DC7A 2HI0A 2KE5A 4I8XA 4NYMQ 1EHCA 4ZXPA 1PJLA 2FMKA 1ZP6A 1DRWA 3W34A 4ZOQI 4OP3A 4AF6A 2OO3A 1FNSA 3C7AA 4N7JA 1GRRA 3JZFA 4Y1EA 1QXSA 5HK8A 5A3QA 1A1VA 1U1GA 2VSYA 1X1QA 3QKRB 4PRKA 3PD1A 3U2QA 1KTVA 1WP9A 2HSJA 4LRUA 1HT0A 1PNTA 2QBYA 1ZNXA 2VOEA 3K05A 3H5RA 3RUDA 3I28A 1H2YA 1JLKA 2JANA 3JAKB 3V9AA 1AKEA 1KBQA 3I8OA 2RHGB 3EXAA 4S2EA 1CVLA 1M8KA 1SCKA 4CNQA 1FU8A 4HDMB 1FFXA 3JQGB 3T3PB 1YDEA 4IINA 3E03A 3D8UA 2QL7A 3CEMA 1EFKA 3TKYA 4V0SA 3TJZA 2BZSA 4IEEA 3LV8A 3AR4A 1TT5A 4K88A 1GUZA 4OP1A 4QGSA 5KNBA 5COBA 3ZLBA 5BV1A 3EK2A 4ZK2A 2JKVA 1A9TA 3PXBA 3QWAA 4GI2A 5CJPA 3MWEB 5A03A 4HAOA 5JSZA 3W9UA 4F97A 1IK4A 3G85A 2YNMD 1YGYA 3A37A 3O8QB 2F1OA 4MGEA 3VZDA 1J33A 2Z1MA 5F9MA 4YUAA 1KYYA 1Q7TA 2OQRA 1PI3A 4MW1A 4ZXFA 3IQDB 3ABZA 3PNYA 1B0UA 1NPYA 3NPMA 1IQUA 1LBSA 1MA0A 1W29A 3LQ1A 3WLJA 4DIEA 4JLOA 3STTA 2FRDA 4KIJA 4OF4A 2R97A 1IWOA 3E6AA 3QLTA 5EMHA 3Q2IA 4DCPA 1ZN9A 5TEVA 5HSGA 4LHXA 4UFOA 4ZQCB 3MUFA 3GZTB 5JW6A 1MAVA 4CXMA 5F78A 3B52X 5AKKA 3HKDA 3HBLA 2WP0A 3QVWA 3PHJA 5IKOA 3C41J 1C8BA 3SQMA 3DPUA 1T6ZA 4HX9A 5IC5A 4YP5A 4ZQFA 3LUCA 2Y66A 3PD0A 2Z6UA 1HOTA 2WVGA 2EHJA 3M4ZA 2WSLA 1NVBA 3OHPA 4M9CA 5KYXA 4GX0A 3IKMB 4D6PA 1B00A 1QH8B 2GEVA 1QSGA 3UTCA 3ZNNA 1NRIA 5ALHA 4AZWA 1E60A 2BUBA 4N03A 3D4PA 4XUGB 2ZPAA 3WZMA 3TOSA 2CV2A 2A5FA 2IYOA 1OHHD 3KZMA 3VXKA 1DBWA 1F0PA 2WAXA 5JARA 1DKOA 3FMVA 3E15A 3NHPA 4GRIA 4QLAA 3HK2A 3ZVNA 1GM5A 3NDBB 4WNCA 3U7RA 2YOHA 3L07A 4NOMA 4HNQA 3IQWA 5A2QA 1YBFA 5IJWA 1AIPA 2IUTA 3MT7A 2VUUA 3GEGA 3V5NA 1LDNA 1U0GA 4YPOA 4PC1A 5TQ2B 2GK4A 2BMWA 3F78A 1JBKA 3ERCA 1TPZA 1VZ3A 2ZSBA 2ZJAA 3KQHA 2P4QA 3U6KA 3A26A 3QF4A 3BKWA 3DBHA 3IUJA 4Z4EA 2JDID 4EFKA 1YB5A 2ZWAA 1N5DA 1TQ6A 4JC4A 4FCTA 1AHHA 1KI4A 4KRFA 1MC5A 3O9VA 4FHEA 1IHYA 5KAPA 3V34A 4MDYA 3CX8A 1BRMA 2Y93A 5DTJA 5JDCC 1Q84A 1VP3A 1GGKA 4HDQB 1MIOA 4PLTA 3S2SA 1ECGA 1S7GA 4IIGA 3WMFA 3PEYA 1HA3A 2NZUG 3FJ1A 1A1SA 3C6BA 3VISA 3TGLA 2X4GA 1N2CE 4U2GA 2OAP1 2IZZA 2FW6A 5IJ0B 1HZZC 1KKLA 2QW8A 1L1RA 3A7DA 4IFBA 5K0NA 4P32A 4C88A 1X14A 1M54A 1X6VA 4MAMA 3ROPA 1O95A 3A9VA 4V0ME 3UK6A 1QS0B 2B6NA 2BBWA 2O0KA 4U6QA 4WZZA 3VQTA 3NHZA 4CMHA 5KVAA 1VQ1A 4RPLA 1G8MA 3L7MA 3NBFA 4R41A 1QO0D 4BO3A 4MV4A 2OENG 2OBLA 1Z6ZA 2PH3A 1WZCA 4E3WA 1TYZA 4J7AA 1GRVA 3G9QA 1GZUA 1JU9A 4Z9AA 3BFKA 4YPFA 2GJ8A 3JARB 1V9LA 4S1VA 4MVJP 3EB9A 4X90A 2JZOA 4DS3A 1J7JA 3P8ZA 5CA0F 1A2BA 1LBQA 1XRRA 3JRWA 4NONA 2D62A 4BZZA 1GAQA 4J4HA 5BUSA 4KE6A 2Q4RA 4NZYA 4KGVA 4R83A 1B8NA 4RIFA 4DXHA 1T4MA 4FKMA 1W5BA 3K0AA 1PCXA 2CKMA 2C2HA 4RPJA 4JFRA 2QLMA 5TC4A 3KKEA 1TA9A 2FQ1A 4AZTA 4F1JA 1TTTA 4H1TA 4NMLA 5JISA 1BHO1 1H8HA 1RC1A 1V39A 2P90A 3A1WA 2NVOA 3HNOA 4YT2A 4Z3KA 4CM4A 5AHRA 4IHKA 1ESZA 2FF7A 3ZGXA 1E2MA 1V16B 3I1IA 4NQRA 4PCUA 1T10A 4LE1A 3N2GB 1PAUA 2HJGA 3PNBA 5BP7A 3W5CA 3VR4H 4FMPA 1QZ3A 3WMXA 1PWXA 4S3MA 2R7NA 4PZDA 3R7BA 5LIRA 2X0KA 3S27A 1N25A 5ALOA 5BV0A 2HM7A 3FW1A 1GNLA 2IHKA 4LBYA 2G4VA 1TECE 4J29A 3LFHA 4JN6B 3B1JA 5LJLA 1J2JA 4AJ1A 2E3JA 4FN5A 4HTAA 3QOYA 1YS2X 3HE3A 3DDCA 2QYTA 3ETGA 3D3JA 1CY2A 3LPAA 4R51A 1UXIA 2HPHA 4GW3A 2WG0A 2XVYA 5LZ4A 1R74A 4M36A 3ITEA 4IXDA 4ZVKA 5CCDA 4C6SA 2GN1A 5E4JA 4TMWA 1BJKA 3FTEA 3W6ZA 4F8JA 5AIAA 1Z2DA 4NCHA 1I30A 1MAAA 1RLTA 4UHKA 4X7MA 3SK0A 3OJEA 4PLVA 3SHOA 2XNHA 1YI8A 4QTUB 4R0MA 1HQCA 4AIRA 2C4HA 2J0UA 1PUXA 5C8YB 4KWCA 1MX9A 3EGXB 4WJZA 1RMQA 2VPIA 2LVBA 4BXOB 1L7NA 1XDGA 1ZH6A 2NZXA 4FOOA 2XUGA 5L7YA 3DT9A 1YQQA 2QVGA 2B20A 4P3XA 4GI1A 5AKXA 3V6MA 4MW6A 1SQ6A 1TUBB 5H59A 5LNK6 5DTEA 2XYPA 1WPRA 1FFHA 3MCZA 3TVTA 4KQFA 4H0FA 4KFTA 4FS8A 1QO0A 2OY0A 4LYEA 3ZWYA 3GB9A 7GPBA 1DOHA 4QVKA 1JJFA 1NW5A 3M9XA 1D9XA 1H1DA 1I6WA 1QH8A 1RXCA 1OKKA 1YVRA 2QWXA 3FPHA 4YLGA 4XYGA 3UXEA 4QNNA 2A78A 1AQNA 1IYZA 3JWPA 4J07A 4NYJR 4G0PA 5FNVA 3HS3A 5I9SA 1XMOB 4BRUA 2WJZB 3OY7A 4MJ7A 2IH4A 3TCKA 5KQLA 3DMHA 3MS4A 4NSNA 5PGMA 3DZJA 5JDIA 1SHTX 4CNBA 1NLYA 2MTBA 2VC2B 4QZVA 4Q19A 1KEVA 2BI8A 3TOXA 3C5WP 4Z0TA 3DEHA 2BUAA 4C76A 2LTAA 1DOAA 1HO3A 3UJ3X 1T25A 3L04A 2XJ9A 1O94D 4R7TA 2O8CB 4C21A 5CHEA 5JFOA 3KM0A 1TU4A 2ZRKA 3IMKA 3PHBE 2I2CA 3H3XA 1Y8QB 4Y0NA 1O6GA 1TRHA 2AN1A 2R8ZA 1HBJA 1O03A 2Y4NA 2EJBA 4L02A 4Q1CA 4DSNA 2WQ7A 4CG1A 3EH2A 3NTXA 4YN3A 3I1YA 4UTPA 2ZRGA 4U2KA 5TQJA 1LWOA 1LTHR 3C1UA 3QZUA 4I1SA 3W4IA 2XD4A 1ONBA 1YBMA 3CKMA 5DF1A 1GJRA 1JWAB 4DYVA 1K7FB 3AVTA 1MEJA 5BMVB 4D9KA 2BP7A 4P08A 5DNAA 3JSAA 4MGHA 4HDRA 4ES6A 1SQSA 3WL4A 4HT3B 2GLUA 1BIFA 5WRFA 3UANA 4ABTA 3NT5A 1ZD4A 2A0WA 1PUIA 2J32A 2X8JA 3NS7A 3PSHA 2AEJA 3AUJB 2FEOA 5AI4A 2JJ8A 5B1IA 3VDXA 4MVWA 4UC0A 3WKBA 5JXWA 1H2AS 4L4SA 2W71A 3OEWA 4MPDA 3QK7A 1ZK1A 4A7PA 5DTMA 2WD7A 4WRRA 3AKCA 3QFRA 2W93A 3C5VA 1VKHA 4PSUA 5CT4A 4GDMA 3L6UA 1TJ4A 5TPWA 1NUPA 2R66A 1H5QA 1X7ZB 3FWZA 5CB0A 1V5FA 2O8FB 3LRPA 3VAAA 3WYCA 1F2DA 1SA0B 4PFSA 3UJ8A 1D2EA 1QRRA 4JI4B 4PQGA 3DL0A 3UJPA 3V1KA 3TNJA 1F8XA 2V7PA 1H1LB 1WW2A 1YRBA 2G5GX 1EHYA 3ETEA 3GGOA 4MIYA 2AXPA 2FX3A 2HUNA 5IARA 3R3HA 1Q11A 4R1MA 3OHSX 4RPKA 4CL0A 5CEJA 3Q3JB 4D8XA 3ORRA 4ZQIA 4D9CA 1E9EA 3DAHA 3LO8A 3O8OB 1JKXA 2QAIA 2TS1A 2YJZA 4C5BA 2R8OA 4R8LA 5HZMA 4GKAA 5K8LA 2QJRA 2CNWD 1HR0B 3WWCA 3S5UA 1JIVA 3FKSA 5AHWA 2YWEA 2JH3A 2V1XA 3EGCA 2H3HA 3MG9A 4O0LA 3SXUB 5BQFA 3L18A 5GAJA 1WS6A 5C1IA 1QH9A 4ABYA 4BGVA 3FTDA 5A7FA 1QVAA 3AMVA 2FTKE 3NONA 4TKLA 2P4EA 4AROA 4GXTA 4MS1A 3RQIA 2KX7A 3ZLTA 1XCBA 5F1KA 1FFDA 4C4XA 2QUAA 4J1TA 1CY0A 1RCFA 2BGRA 1T91A 2GRUA 2ECOA 3AZPA 3BYZA 3H1TA 3PC8A 5JO9A 2X5JO 3V4OA 1A7UA 3A06A 4ND7A 4DWOA 1CYEA 1VHLA 1OYWA 2IS6A 7ADHA 4LTDA 4PZUA 3RDPA 1I9GA 2M32A 1NM5C 2W6QA 1LC0A 2HREA 3G68A 3RROA 2IF0A 4ONEA 4PPYA 4JYBA 3ZCVA 2QXTA 2C4WA 3H97A 1ZHHA 1P8JA 4Y30A 5IMBA 3FH0A 3BCSA 4JCOA 3RIYA 3HL0A 2EBUA 2MSWA 4KN5A 4RD3A 5FA5A 4BBAA 4C0SA 1M6WA 1X94A 4F3CA 2YRXA 3PC6A 1YRWA 4WV3A 2D2EA 5CB4B 5BSHA 3KJXA 4TSFA 4CUJA 2W83A 4EI7A 5EP1A 2CJXA 3K6JA 2PUVA 3Q15C 5F2OA 1O3YA 3FLBA 3LNTA 1J2UA 3KSUA 4TN5A 1ODKA 3IBSA 2LNDA 5I3CA 4AS1A 2B94A 2NUAA 2NYRA 2QTNA 2R5NA 4HNVA 2PGOA 4XKJA 2ZIGA 5A7HA 1UQRA 2QLTA 2AMJA 5AM5A 4I1PA 3L0CA 4MRAA 1B0ZA 3P4XA 4Z9XA 5H5JA 3V1UA 1W85B 3CW8X 3UWOA 3L46A 3ZY3A 5FAKA 4UD2A 1MHPA 2F90A 1PFKA 3NNDA 4TVBA 1J0BA 4UULA 1FJHA 2NU8A 2XUZA 3C85A 1Y7HA 1E6CA 3W04A 2VCEA 1JHZA 1XEWY 3AFMA 2G0AA 4H3SA 4NYIR 5DK6A 1CZNA 2WSBA 3LTEA 3ZU4A 4COOA 4K6OA 1UWVA 4ENWA 3Q3GE 5K1ZA 1IB6A 5LP6A 1U0JA 4PHCA 4AZ0A 1ISHA 3WVNA 2Z1NA 1M0TA 2B92A 1C9EA 1QRDA 1TCBA 2JIRA 2ARKA 4BBPA 1H94A 3AR2A 4Y6GB 3IFSA 3KYDB 1IM8A 2DCMA 2WAAA 3GCXA 3CF4A 3RVJA 3KQUA 1A27A 4R1TA 3DBRB 2WSYB 4LJSA 3SHQA 1YE8A 3LA8A 4LFCB 3UMMA 4U39A 4KEAA 1T4GA 5LKRA 2Q0XA 1EFPA 1XA4A 2PVSA 4OXQA 4XUCA 3ZUPA 3DWGA 3ZWMA 2AQIA 2R86A 1BCSA 2B1QA 5JSHA 3TWOA 2QHXA 1K75A 5AJHA 421PA 1L1EA 1QQ6A 2AOVA 3ILYA 1XD9A 2JVJA 1H6AA 3EYAA 4IUYA 3FPEA 1ZM7A 1SXHA 4YH1A 4TTRA 3F97A 3C7CB 3L6BA 3KE9A 4JJZA 1MO4A 5F77A 3IHWA 3KEOA 4O1HA 4QASA 2O3QA 4WZBA 3ANYB 4QOJA 1TJ3A 1SVSA 2WSIA 4HGZA 3UXHA 4LCBA 1FX1A 3LP8A 3O2JA