2YMPA

Chloroacetic acid complex bound l-haloacid dehalogenase from a rhodobacteraceae family bacterium
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
224
Chain Sequence
SGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Marine Rhodobacteraceae L-Haloacid Dehalogenase Contains a Novel His/Glu Dyad that Could Activate the Catalytic Water.
pubmed doi rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 86
structure length 224
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2ympA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2ympA01
1O03A 3ED5A 2JAWA 5AW9A 2G08A 4HGPA 4XPZA 1RLOA 5AM0A 3UM9A 3QNMA 4UW9A 1RLTA 3ESRA 3L1VA 2P69A 4BX2A 2YN4A 1L7OA 3NRJA 2ZBFA 2PKEA 3AR2A 3QU4A 1TJ5A 2R8ZA 3FPBA 4NABA 2HCFA 2HHLA 5AW3A 2JAUA 1Y8AA 3N28A 2QLTA 3GYGA 1RDFA 4AS3A 3N5KA 2I55A 1QQ6A 5AVVA 1T5SA 4IG4A 2WF9A 5AKGA 5AI8A 4B6JA 2ZBGA 4CNQA 2WF5A 1U7PA 2B82A 4KNVA 3OCZA 1TJ3A 4Y2QA 1Z4MA 4FFDA 4Y2JA 2HF7A 3AR3A 3ZWDA 1AQ6A 3N07A 3ZVMA 4FYPA 4Y2PA 4E88A 3AR5A 2G07A 5AK3A 1Z4PX 3DAOA 2GHQA 1T5TA 5AVWA 5AKYA 5AVUA 1EK2A 4UARA 4I9FA 4OCZA 1QQ7A 1WR8A 2G09A 5AIAA 3KBBA 4KYTA 4ZEWA 2B0CA 3N1UA 5A3QA 3QX7A 2YMMA 2YJ3A 2IOFA 4YGYA 2B8EA 3OCYA 3TLMA 4QQFA 2IOFK 2HF2A 2BDEA 4EZEA 2B1RA 1KYTA 4BX3A 2FPWA 1L7MA 1Q91A 4L57A 4RESA 3PGVA 4BEWA 2ZBEA 2HO4A 1L7PA 5ALVA 2JGAA 3S6JA 2C4NA 2FPXA 4Y2TA 5AVZA 4C4TA 2HEGA 3ZX4A 1QQ5A 3ZVLA 2W4MA 2P9JA 4ZEXA 3SKXA 1F5SA 1K1EA 2R8EA 2G80A 3ZU6A 4AS2A 5AVQA 1RLMA 4UM7A 1TE2A 2IA5A 2ZBDA 5AM5A 4BKMA 2FDRA 3PGLA 5AVSA 3W5CA 2I54A 4BNDB 1ZD4A 3PDWA 1L6RA 1TA0A 5ALHA 5ALOA 3L0CA 5IS2A 4CF4A 4Y2RA 3B8EA 2W43A 2C88A 3EF1A 4Y3UA 2EAUA 1XVIA 3QLEA 4L6CA 1NRWA 2AUTA 5ALDA 2WF7A 1L7NA 2WF8A 1YDFA 2FI1A 4KX5A 5JJBA 4NAVA 1U7OA 1T9ZA 4EELA 3MMZA 1Z4NA 5AK6A 3L1UA 3OCXA 4KN8A 3QUCA 3KOOA 3SD7A 5ALUA 1VFPA 2P27A 3W5AA 2HOQA 5ALSA 3R9KA 1TJ4A 4NFLA 3KD3A 3OTQA 4UASA 3ZTYA 1Z5UA 4C4SA 3WKCA 1RRCA 4UAVA 1J8DA 4MUMA 1YJ5A 4UAUA 1QYIA 5AESA 4YH1A 3B9RA 2ZOSA 3VAYA 1SWVA 3QYPA 4XQ0A 1XPJA 3SHQA 3IJ5A 5AW5A 5AK5A 3AR6A 4UMVA 2FPUA 1MH9A 3R09A 3CZ4A 3A1DA 4HGNA 5ALNA 5ALIA 3ZTWA 2YMLA 3UMGA 3OPXA 2HI0A 2FUCA 2R8XA 3I28A 3KDPA 5AKIA 3AR8A 3I76A 2FUEA 3NUQA 5AKZA 5AKLA 3K1ZA 3J7TA 2YFYA 1ZD3A 1YV9A 4CF5A 3EWIA 3WK8A 1L8LA 1Z88A 3BWVA 5ALMA 3L0BA 2OA0A 3FVVA 4UU0A 2HX1A 4YIHA 3IRUA 3B9BA 1U2SA 4Y2YA 3IB6A 1Z4JA 4YIKA 1S8OA 5ALEA 4Y2VA 3WK5A 3ET5A 4BEVA 3U7FB 2CFTA 4UATA 2WF6A 1Z4IA 3I6BA 2MSNA 2C8LA 3AR9A 4AP9A 1JUDA 5AKJA 2PQ0A 4J03A 5A3RA 3UMCA 1CR6A 1RKVA 3UMBA 3L7YA 2B1QA 3SF0A 2CFRA 1Z4OA 3M1YA 5AW8A 2GFHA 3E8MA 4IFTA 3F9RA 3OCVA 4CF3A 1ZD2P 3FM9A 5AI4A 4RETA 1FEZA 3NIWA 4UMFA 3HLTA 2BY4A 4JB3A 3U13A 2RAVA 5AVXA 2IYEA 1RMTA 2R8YA 3WGVA 3WKDA 2JARA 3W5DA 2C8KA 4DW8A 3QXGA 3OCUA 3A1CA 5AW2A 4HGRA 3N8GA 2AH5A 2FEAA 4DWOA 3NASA 1J97A 4NV0A 4QJBA 1ZOLA 2Q4RA 1O08A 5AI0A 2O9JA 4YCNA 5ALLA 2OYCA 2IOHA 4UMDA 1SWWA 4JDPA 3P96A 3WK9A 3DV9A 5AW6A 3WK7A 5AK4A 3EF0A 5ALZA 5AKXA 4H1WA 3ZUPA 1RQLA 5AW4A 5AVTA 2YBDA 4YCMA 2PR7A 3I1YA 3DNPA 1LVHA 5AW0A 1Z4KA 3L8GA 2WFAA 1Z5GA 2CN1A 1ZRMA 3W5BA 3MPOA 4GIBA 3NAMA 4I9GA 5AVRA 4J2TA 3QUQA 2HSZA 1NNLA 5FP0A 3U7GA 3NALA 3FPSA 5ALQA 5AW1A 2YJ5A 4UU1A 4C4RA 3ZW7A 4L6AA 4EENA 3EPRA 2YJ6A 3KZXA 3MC1A 3L8EA 3FZQA 3SMVA 5ALTA 1PW5A 4PNHA 3QUBA 1ZRNA 4KNWA 4UMEA 1EK1A 2P11A 1RKUA 4Y2SA 5ALYA 3A3YA 3AR4A 4EX7A 3ZX5A 2WHEA 3WK6A 4BX0A 3HYCA 4DFDA 1N8NA 3E84A 3QU5A 4F72A 2MU1A 1X42A 2RB5A 3PCTA 3U7HB 2Q4TA 2B8JA 3SLRA 4DCCA 2G1AA 1RC8A 3KC2A 1LTQA 1WVIA 5AICA 2B30A 2EARA 1RQNA 3WGUA 4BBJA 5AW7A 4HGOA 2YY6A 3ESQA 2CFSA 5AM3A 4F71A 3L8HA 1VJRA 4EX6A 4XE5A 2RBKA 3WKBA 3OCWA 5T41A 1Z4QA 2X4DA 3U19A 5AI9A 3WK4A 4EEKA 4O8CA 3QU9A 3AR7A 4HGQA 5ALXA 5AM2A 1RKQA 4Y2UA 5ALKA 5AI5A 5AI6A 2JAOA 3M9LA 3L8FA 4YCLA 4OFZA 2YMPA 4XOUA 3ET4A 4UM5A 5AIBA 5ALPA 3NANA 1Q92A 2FPSA 4OHFA 3ZI4A 3WKAA 5IT4A 4Y2XA 3QGMA 4NWIA 2I34A 2DQSA 2G0AA 4G63A 4MWOA 1QH9A 1WZCA 2MU2A 1U2TA 3ZWKA 3RFUA 1L8OA 5AM1A 3SKYA 1SU4A 2BDUA 3R4CA 2W11A 2WM8A 2G06A 3WKEA 1U02A 2GHTA 2I33A 5ALWA 2ZXEA 5A3SA 5ALGA 1XP5A 2EATA 5ALFA 3L5KA 2GO7A 5AHXA 2D2VA 4G9BA 3FGOA 3ZVNA 4OD0A 5AKEA 1ZD5A 2FPRA 3U7EB 2C9MA 3QU7A 3L0YA 2NYVA 2OBBA 2NO5A 4CE6A 1N9KA 4KX3A 1ZS9A 3QU2A 1VJ5A 2QYHA 3ONNA 2OM6A 2NO4A 5AKHA 3U26A 2GMWA 1YNSA 4FE3A 4HYTA 3E58A 4BYGA 1S2OA 5AVYA 1RMQA 2AMYA 2O2XA 1Z4LA 3A1EA 2ODAA 5ALJA 2Q5EA 5E0OA 2I6XA 1YS9A 1NF2A 3BA6A 1CQZA 1RMYA 2VKQA 2AGVA 1RPZA 1YMQA 2RARA 3DDHA 2ZG6A 5ALRA 1IWOA 3D6JA 5AKKA 5IT0A 1WPGA 2YJ4A 3RF6A 1ZJJA 2I7DA 3E81A 3CNHA 4BNDA 3QUTA 4ZEVA 4GXTA 3MN1A 2HDOA 2YMQA 5AM4A 4HAIA
chains in the Genus database with same CATH superfamily
3UOWA 1RM6C 1KK3A 2FRDC 8ICTA 2JIOA 2BMEA 4II7A 5EFOA 3TTTA 3HK2A 2D4AA 5FBHA 1C3LA 1OD6A 4ZIRB 3QLUA 1EZ4A 1XTPA 1YAJA 2UVDA 4LIPD 2CLIB 4PZYA 3S2GA 1CUIA 1ELOA 2QPTA 4O5KA 4MS1A 4OL0A 2WV9A 5I51A 4E14A 4WJLA 5H02A 4G4JA 5ECDA 2PKEA 1MB4A 3KCQA 4B9LA 2Q0ZX 3QU4A 3OQIB 4TMYA 3C3PA 2X77A 5FADA 3F4BA 2V58A 4PYMA 3INTA 4ND8B 5DP2A 3FYUC 1E9BA 3R3WA 4U7CA 1ZM2A 1E3IA 1Y8AA 3C7AA 1W5TA 4XPIB 4ZODA 3LX5A 1TT7A 4HC4A 4AT1A 4OYLA 1HYBA 3RUAA 5KL1B 1KRPA 1T9BA 3CH6A 3GLHB 4C6SA 4Q15A 3TMAA 4AKGA 3GAZA 2GAFA 1US8A 3T95A 1NVMB 4BO1A 3N7PD 1YS1X 4KUHA 1LPSA 1JKJB 1MEEA 3T35A 4K9OA 2HMVA 1RZTA 5J5CA 4HAUA 2A4KA 4HDNA 4D4HA 3VX3A 2OECA 3C1ZA 3QZ8A 3PA6A 4NBUA 4EGQA 2BP7B 1TYZA 4QPJC 4KR7A 1UAGA 2EZ9A 3MS4A 4IP0A 1XNHA 2DWQA 1AKYA 2AG5A 1ZKMA 2YV5A 1JH8A 1W49A 1W1UA 2XWJI 1TQ8A 2RHTA 3DDZX 4P4UA 3TSZA 4N7BA 4YJDA 1XAHA 2P3SA 4L7VA 2LRHA 5IXYA 1EWYA 1V35A 1XYVA 4MV3A 1BIFA 2GXUA 2ECKA 3TFWA 1RTTA 3JRWA 4DEZA 1WDKA 2AOVA 3V7LA 3DMRA 5KDOA 3K8YA 2OO3A 3EAQA 1XCOA 2X3UA 5DOZA 3KOUA 4KIUA 4RY0A 1HTWA 3O4RA 2JCVA 1P3JA 1K4KA 2WZDA 4FZLA 1G2PA 3FMOB 3ORRA 2QRVA 3EG5A 4MHOA 3AESB 3BWYA 3X1YA 1E9SA 2BFPA 3K32A 3B89A 3OE7A 2Z5FA 2YC4C 1LK7A 5H2FU 3S40A 3FNBA 4PYLA 3KXDA 3NB0A 1NM5A 2II6A 1P0QA 3CNOA 5E2BA 4YPOA 1OYYA 1JILA 4BMSA 2GAOA 5IJ0B 4D44A 4QA9A 3ZZ0A 1AMOA 1XMXA 1KJ9A 3ZHQA 5ICEA 1CS4C 3GT7A 3KQYA 3BEDA 2XUDA 5LLDA 5BO5A 2QMZA 1VPEA 3PNOA 4WZ6A 5DHPA 1RYFA 3G82C 1ZUWA 2VDOB 3MAAC 1KI7A 3NHWA 4WOBA 2KFNA 3IR6A 1PJRA 3B1WA 2JLQA 3SMQA 1JG3A 1XDUA 4UBIA 2DHRA 3S6JA 1WXFA 4RZXA 4NOLA 4ES6A 1QIJA 4YMLA 4EB8A 1JHPA 3G02A 3I64A 1I32A 3JQ8B 5U4QA 3TLXA 4DWVA 1II8B 1JMVA 4W82A 1TT5B 2X42A 5TQ2A 1NKBA 1MAWA 5GIOE 3K70C 4K2AA 1J4AA 1CS0B 4OIFA 4AJJA 1FDSA 1NV9A 4D96A 2W9CA 3S29A 2REQA 1A8QA 3QF7A 3G0BA 3LAWA 5IARA 4BMYA 4PGQA 2GTHA 1CR4A 3DLTA 3DMGA 1MIOA 2FOIA 1WW3A 2XD9A 3TAXA 3A2MA 4F2GA 3E5NA 2K4HA 3P7MA 2JEYA 2DPXA 4H7PA 5FORA 5J0UA 3LHKA 3G8BA 1FX0A 1MN6A 2RKOA 5CEHA 1RABA 3F2IA 4FDMA 4ZPXA 4YI3A 4BUZA 2H08A 2HWUA 1YDWA 2WUVA 5EOVA 3TJMA 2H4XA 5KOHB 3D2SA 1ETHA 1N7GA 1VYTA 2ARKA 2B6HA 2HWKA 3AHGA 1N3IA 2DQZA 3KL2A 2IPOA 2O14A 3G85A 3HJAA 3ZI7A 4CNBA 2GEJA 3BD8A 4KN6A 1ZITA 2AJBA 4NK5A 4PPGA 5HFNA 3TXXA 3L5OA 2ID4A 1X7XA 2WRZA 3USES 2CNOA 1IZ0A 1QK5A 4K3UA 1NR7A 2LPEA 1IL0A 2PSHA 4HDNB 4KVGA 3ZDBA 2PT9A 4D7AA 3PWKA 4DDUA 5KJFA 3SF8B 1WUKS 4YDSA 1J70A 4IJUA 3WA7A 3LK9A 4ED2A 1JPUA 2O5RA 5IM5A 3G2HA 4BJ3A 4G1VA 1TVEA 1CZOA 3QUCA 1V9SA 2I4NA 5E9WA 3O94A 3JWEA 3W5AA 1HDRA 1VCNA 2YINC 3QKRB 4F7DA 1DG1G 2VLIA 4YQEA 3T4PA 5KFTA 5FPYA 5FO1A 3IT0A 3EC2A 4LBVA 4MYUA 4ZGWA 1OKKA 2Y77A 2FPGA 3DBHA 4G5OA 5B1SA 1F2UA 1IG0A 3OOEA 2JGDB 3R3ZA 1J8DA 1J2UA 2EFHB 2B78A 1KJNA 2G77B 1NX6A 2JFZA 3IBFA 4HQNA 3R0ZA 4O6VA 3DZHA 1X80B 4C7OB 5CCBA 1GZ5A 1U3TA 1SVIA 3IP5A 3WE7A 5B1YA 4YH1A 2BCRA 4BUJA 3IEKA 4CEJB 3QYPA 4KACA 1KQQA 4MUNA 1KQFA 1RRVA 1TKCA 3HCDA 3WLRA 1SQ5A 2FGKA 4Y9SA 5AW5A 4PHDA 1VE9A 3LUFA 2V55B 3AF6A 2BI8A 3LQ2A 2QB0B 2XRMA 1K63A 1Z6XA 2V74B 3NAGA 3PNBA 3KT8A 3ICCA 2GWRA 3MVEA 4GQAA 5H1YA 2W04A 3KL4A 2I7VA 2WLSA 4G5YA 4HGNA 2CD9A 3DL2A 4S24A 4EJ2A 3RT9A 2WVGA 2RH8A 4B3DA 1T6BY 1TCBA 1GNQA 2HRQA 4RD0A 1WHTB 3MJEA 2GBPA 3B9QA 3LBYA 1WLSA 4DLEA 1V1MA 3GDWA 3F5FA 4EDHA 4RYDA 3DLAA 3WMXA 1L4BA 1SVKA 5JMPA 3DQQA 4PZNA 3CR3C 4LHSA 4PGFA 4WCDA 1R0SA 5F64A 1LC3A 4LXIA 2QG9A 3QWAA 4JKOA 4HMOA 2NXEA 2DFTA 2PFNA 3D6MA 3NEYA 2WW8A 3A3NA 4H7KA 2QMEA 4HH1A 1JEEA 1PLKA 4MLCA 5AMXA 3FVVA 4ZI3A 1G4UR 2HX1A 2KYRA 2WJJA 3TZ6A 4QEKA 3WWZA 3IS3A 3RC8A 1F2TB 3A4NA 3GN1A 5IVDA 1DJOA 3X3HA 3ABRB 1ZA1A 1W0KA 4NV1A 4IRDA 3SDZA 7ICHA 2RK6A 3GIDA 4O0MA 4RPGA 1C8VB 4LYDA 1IVNA 1V43A 3VYRB 5KWSA 5DZSA 4LDZA 3D6FA 1EJ2A 3SYTA 4DL2A 2J7PD 3C21A 2Q1UA 1B3BA 4FOTA 5KYTA 2GK7A 2QL6A 3UHOA 3GLFE 3O84A 4KQGA 3L4JA 5JAHA 4Q66C 3VR5A 2CYBA 1QIMA 2J9FB 3DUWA 3DYBA 3L4SO 3FHCB 5LNK6 4R0NA 5ENZA 3D3EA 2RGCA 3GQCA 3FJOA 3QKWA 2W2KB 5IBCA 1TLTA 3E9MA 1PJ2A 1N92A 1NHWA 3B6KA 4YV2A 2WUEA 3DTTA 3DZFA 1UBUS 5AI4A 4ZN6A 2IVFA 1FEZA 1NK0A 2A8YA 1QVRA 3MGHA 1XALA 1YFLA 2QTZA 4JB3A 3D6NB 5EINA 5DRTA 821PA 2EYQA 3FOZA 1Y8ZA 1KOGA 4Z49A 4AP5A 4MVJH 4C03A 4BFXA 2X76A 1I0LA 4QOEA 2YWFA 2Z2JA 4IEFB 1Q1QA 4X84A 2I3AA 4BQNA 1CYEA 1F3LA 1E3QA 1R00A 2RP5A 4IG9A 1T4CA 1U04A 4GBJA 1NK6A 2WTBA 2X6TA 3G2NA 5FCDA 3PA8A 1IXRC 2WD7A 3KLNA 2WSMA 3B7GA 3IQFA 3UPUA 2VG8A 4XEHA 3H16A 5AJVB 1BTOA 3VZRA 3ZBUA 5E7QA 3NASA 3INYA 2V7BA 4JK3A 2H1OA 1QV9A 1HT1E 5C1DA 1M1UA 1P81A 2JLCA 2ZB8A 4O29A 4XQEA 2SICE 3TZHA 1TEZA 5L4LA 2QYTA 3BJMA 4G5SA 4I28A 4W1PA 1N8SA 4F21A 2OCBA 1YNOA 2HHQA 3WK9A 2GHIA 2OSBA 1SL1A 2VSYA 3BILA 3FPFA 1YJXA 3ML1A 3F5DA 4B9VA 4JBWA 4MA4A 3ZHRA 3PNVA 4DBLE 4M6WA 2GCOB 3UFXA 5KVCA 2FPGB 2X86A 4IVPA 1QV7A 1KY3A 4QDJA 3MRXA 5KFUA 1Y81A 3KVVA 4IEEA 4I4TB 3VMMA 4YR3A 4O2BF 3MWLA 4RTJA 3BZBA 4BNUA 3TBFA 5AVTA 4QNNA 4ER5A 4D25A 4AJOA 3BZUA 5HRAA 1T2FA 1N77A 2VT7A 3DVAB 2TYSB 1M2GA 4LJ6A 3DNPA 1GZ3A 4XWKA 3N8KA 4J0EA 1H5UA 4HB2A 2ONZA 1MX3A 4ELTA 4WDQA 3ZU5A 3AQEA 3X1XA 3FZNA 5L51A 3SF8A 1DCTA 5CFMA 2KB0A 4ZALA 1GTVA 4W5RA 1KZHA 5JJLA 3PHHA 1O6ZA 1TK2A 2I4MA 2VZ0A 1WUJS 3RSGA 1M10A 3EGDA 3WLJA 3LY8A 4I9GA 1ZG3A 1ACMA 2FSPA 1ULZA 2GBLC 2TMKA 3CUWA 3OEHD 3O4IA 4IQ8A 3SY8A 2OG1A 3OQ1A 4N0EA 1TM3E 2WVJA 1S4QA 3JD4A 3KQVA 3JWIA 2EP5A 3HMQA 3T61A 1HQYE 3DBHB 1UWCA 3GRCA 3OM1A 3HY3A 1E2PA 3QV2A 4IDNA 1ODIA 1M7BA 1Y6RA 3ZXUB 3N9IA 4XIGS 5LUAA 4PZDA 4YNBA 2AG0A 5FL7A 3TW8B 1Z6TA 3G6VA 1RXWA 1J99A 1T2EA 3OA0A 1TC1A 2PL5A 3SSAA 2P11A 2W6JD 4M0AA 2BPCA 3DR3A 4RQ5A 3D31A 1G60A 3GOHA 1I94B 1RJWA 4BGUA 1I2MA 3ANXA 4LOAA 5HK8A 2GEFA 3PQDA 3R5XA 2EAOA 2PYZA 3GHHA 1V95A 4EYGA 5D51S 2JDIA 1A9XB 4K0RA 5FX2A 1Z06A 3ZIAA 3GGSA 4NOJA 2PFOA 1OI2A 3QVXA 5DNVA 4G0YA 1MF7A 2A14A 2GH1A 2WQZA 3BE6A 4OLBA 4LF4B 4B33A 2PSDA 1JHOA 4ECRA 3FWPA 3RAJA 1ZQBA 1T8PA 5U4XA 3UWMA 1XTUA 3JPRA 1U6JA 4O4JB 4YUYA 1RPLA 4WOCA 4U2KA 2AMLA 3MERA 1QFJA 4D02A 4NRDA 1N0UA 4RVSA 1JQJC 2VQSA 1TZCA 4MDEA 3ANYB 1E0AA 1AUPA 3W1EA 1COKA 1SK9A 1U1DA 5JVDB 4Z6EA 5KJ1A 1FRNA 3BRQA 2XNHA 5JY6A 4S1TA 3VKUA 4GPAA 5SZKB 3ZGLA 2W5UA 1PJLA 4C8OA 1AO3A 2E49A 4F2WA 2MSEB 5EZYA 2ZR8A 1T1IA 1BU8A 1U7UA 4DPMA 3J81k 2G4VA 2GNPA 3OCWA 3EPLA 3K4GA 3ELWA 5TGZA 2E0IA 4DA6A 2H07A 3BCHA 1HE2A 2ODWA 2A1AA 8ICXA 4MAAA 3H13A 3RFXA 1ORDA 3MRTA 3JQ7A 5FULA 2I6GA 3Q40A 2Q5LA 3CEHA 4X92A 5IABA 4MQFA 1J9GA 2W8ZA 4HDAA 4BFZA 1Z13A 4YUAA 2REQB 4WD3A 5D00A 1PVPA 2SKCA 3QELA 2HVHA 4OUDB 1ZK4A 1CS0A 4J4TA 4QARA 4DM3A 2F8TA 2OGWA 1NQUA 2O48X 4CGYA 1EUDB 3T3NA 1WEKA 4KN4A 4EQZA 1ILEA 7REQB 5ITVA 1MVOA 4IDDA 4ZQCB 1YRQA 3AHJA 4IGEA 3SC4A 5KYWB 1AZLA 1V47A 1W5FA 3QXHA 2G0AA 2DQSA 2WJGA 3CJQA 5L95A 2QD5A 2Z2XA 1KMMA 1U2TA 2GFIA 3TIVA 1R0ZA 2ACKA 3KEGA 1ZJ5A 2IF0A 2P30A 4QDXA 2X2EA 3E9DA 1A97A 2VCYA 4UZEA 2WIGA 3H8WA 2YWGA 1CZRA 3G79A 4EB0A 1DAKA 4N76A 1OR8A 5JRZA 5EE1A 2ZIWA 4L8YA 4QU0A 3EY4A 2I4RA 1U8UA 4DRXB 3GAAA 5DKWA 3COZA 5F7OA 1FLDA 1PVVA 2OWEA 2R6ZA 3T5TA 3RFAA 2FEPA 4DUGA 4C76A 4TGLA 3BDVA 3UT6A 4US9A 4Q3CA 4JOCA 3VKHA 3IO3A 4YK7A 4NXNB 2CVOA 4NNJA 3M0EA 2L18A 4IIHA 4LNHA 4AXBA 4CT5A 1DKMA 1EFVB 3AYXB 1P4HA 2HNAA 4FZRA 4LJYA 5AVJA 3SC3A 5JQGF 1OXKB 2OBBA 3DUFB 2A3VA 1KYQA 4Q6BA 2PMEA 4DIEA 2RD2A 2HHHB 1PGOA 3UCFA 1XDBA 4GP9A 3Q9NA 4DIDA 4U6SA 2KBEA 4O2RA 1ZS9A 4KLTA 3CWCA 1EGVB 1EUZA 4FDAA 5E7MA 2XUAA 1K0FA 3BA1A 1Q12A 2PUWA 2BM8A 2RAUA 3VR3D 3FPGA 1MA7A 3PL1A 3L6CA 3P2JA 5HE9A 5LC1A 4J3NA 3MTIA 4M9NA 5H16A 2C0CA 4OJ5A 4ECEA 1BHSA 1K2VN 2WNIA 1P2VA 1QG4A 4NM1A 2BRUC 2WG2A 1W4RA 2HA2A 1V97A 4YRRA 1BFDA 3SHWA 2VDUE 2XQVA 5BOLA 2XZLA 4O59O 2Z57A 3UAYA 2LNDA 1NF2A 3FWZA 1P2BA 4TZ6A 1OASA 1E5XA 7YASA 2AGVA 2GO1A 4DRYA 2FUG1 3EUWA 3GEBA 1HWYA 1W35A 3KSZO 4LQLA 1CF2O 1ONSA 3TRKA 3TW4A 2QRKA 5CVEA 4KH0A 2VYNA 2VDLB 2CL0X 1J0XO 1OV6A 1QE5A 5F12A 3WHPA 2DSTA 4YECA 5F23A 1SXJC 1WPGA 1Q77A 5D3MB 4IVQA 1EHIA 5AP9A 4OHOA 4ZCPA 3WLAA 3RSSA 3S2IA 4K1XA 5B6JA 3TAPA 5K3OA 1TA4A 3DKKA 2PBRA 4L50A 4IV0A 4OP2A 3C97A 4FS8A 5BN3B 2V6IA 2ECPA 3L41A 4JKYA 1K9SA 1YR6A 3NBYC 3IALA 4U7HA 1LJLA 2ZJ0A 2WSSA 4XKJA 4CHGA 1SL0A 4FOPA 4R9SA 3W04A 4CQMD 4DV5B 1XU7A 1BD4A 3EVBA 4TKVB 1IN4A 3DEIA 1MTZA 2AHRA 3NOQA 4QBHA 5FOTA 3RT1A 3LTNC 4TMZA 4BP9A 3DHWC 4I5IA 1PAUA 4RT3A 4OQZA 3N0WA 5AO9A 3AERA 4W99A 5IVIA 2Q21A 2L82A 4X63A 4HO1X 4RPJA 1KS2A 2F6RA 5HG0A 1IY1A 1XVVA 1LLDA 3FPBA 2CDRA 1NQTA 1TEXA 1QHIA 3PC6A 1U1GA 4NOKA 3F3MA 1ZKDA 4BIIA 3TXYA 4KQ6A 1FBNA 3EVGA 4U2FA 5K0BA 3S1SA 3MR6A 2K7ZA 4YCCA 4B6SA 1NUSA 1D0VA 3ZDCA 1K7XB 1KERA 4QTZA 3S2FA 3L7IA 4L4SA 1QAOA 1P74A 1V7QA 3GYGA 4L5IA 1TM5E 2IA6A 2XSZD 1LK5A 3DCIA 4RE6A 4KE7A 4R81A 1Q50A 2J9FA 2GESA 3I9KA 4RXTA 4UC0A 3RHFA 3IXLA 4XQCA 4B4WA 1HETA 4JI1B 1U4NA 2PUCA 4I9NA 4IH1A 4DMKA 4GR4A 1DU4A 2AUMA 9ICBA 3VV2A 4CNQA 1FQKA 1DWQA 1WXIA 5J2AA 1CSEE 1ESCA 4IQUA 2H7CA 3DOJA 3C98A 3H5LA 4JC5A 2JZOA 2ZUSA 4QRDA 3LY7A 4X8LA 1N5LA 5K3FA 4OU4A 2ZDGA 4GRDA 4GXJA 1NVFA 2V5AA 1VSTA 1I3OA 1VI2A 1Q19A 3ZWDA 1VL5A 1DXSA 1V8FA 4M21A 2EANA 1UK6A 3GEGA 3GRVA 3K20A 4UTNA 1ZGJA 2FZEA 4GZ6A 4KK4A 1FO4A 1K5DA 2O8BB 1XKQA 4R54A 4BAUA 3NHRA 1K1SA 4NCXA 3H2ZA 3VR5H 1VLZA 2Y3IA 2YWHA 5BYBA 4W5HA 4FWTA 3TSYA 3ZHOA 1RNLA 3EVAA 4UDOA 3W2GA 2VHXA 4U8HA 3GQBB 2WIFA 2LCIA 4AVYA 3T9CA 5BQOA 3DE7X 1DQZA 1JDUA 1VG0B 2QMOA 4N48A 1CC1S 1NYQA 2F00A 2XBLA 3E3AA 4CHTA 1FP4A 3AJDA 4HWPA 1WR8A 4MB2A 3RROA 5CYGA 1O0SA 3A4LA 2V8BA 3RDPA 3OKPA 2JLVA 4HX5A 4F1WA 2Z8XA 1NBEA 2B0CA 1AXRA 2WYUA 3SVLA 3HVKA 1MFPA 3Q8LA 4X1IB 2BBTA 2KP7A 4K4IA 3MWKA 4KHPB 1CV2A 2B8EA 1FS5A 3HSYA 3OCYA 2O3JA 1JMSA 2H48A 2IHTA 4MUYA 5B4TA 1T9CA 2EH9A 2C83A 3F67A 4LZNA 1GA4A 5I7RA 5KI6A 3EXEB 4CMIB 5C5EA 1GTSA 2JB9A 4J0FA 1SZJG 2R79A 3G9XA 3EZ5A 2ZZKA 2D59A 3HKBA 3PJEA 4R1NA 4YV7A 2PX0A 4N41A 2EF0A 2VJCA 3T3HA 3GWGA 2YZGA 3EIUA 1W581 1KEWA 1IUOA 2XD4A 4RVNA 4BPRA 4DMRA 5JCOC 4Q37A 3SICE 4PLGA 4MWSA 2HEGA 3ZX4A 3IYLW 3ZVLA 2NUBA 3RK4A 5BNIA 4L16A 2H06A 4P3NA 4WXYB 4ARZB 2D1TA 2YFQA 2W7OA 4WJKB 4B9UA 2NU8B 1IPHA 4L4UA 3H1AA 3FUUA 4JXJA 2HHAA 4Q9KA 3NAQA 3SYRA 1T2VA 1F7UA 1JBQA 1PJTA 1GZSA 2A58A 3VJKA 1WKCA 3I5UA 3UANA 2V1UA 2GN2A 4E5SA 1H94A 2RJ3A 4HH3C 3R8CA 2IPMA 4XYBA 3D8BA 4ZAGA 5HUHA 4OTZA 3H1GA 4FDTA 4B4UA 1MC4A 5L3SA 1O6FA 1U2PA 3C1AA 4PVDA 5J23A 7ICEA 4RD3A 4R1OA 3K8ZA 4ZVLA 3GZFA 3LT2A 1W4LA 1OI4A 2WT8A 4ZA2A 5JSYA 3HXOA 1OWOA 4CTOA 4M99A 1V3UA 1X0XA 5BSFA 3OIUA 3VR5D 5B7GA 4MLZA 1DKPA 1GPJA 3QVMA 2Y1EA 1QYRA 2CHUA 3C16C 2IHNA 5KFIA 1X19A 3KKPA 2ZYVX 3C23A 4QZEA 2FCAA 1LDMA 3EY9A 3AVQA 4RK6A 8ICUA 1L7DA 5TJ9A 3HCOA 3T7KA 5LWQA 2PANA 3JQRA 4MUGA 3EIWA 1XZDA 3LFUA 3OBBA 5J43A 3OH8A 4UCWA 2E7ZA 5G4KB 1UXJA 4R9UC 2WHXA 1QK4A 3L7JA 3MLEA 2V6JA 4NE7A 4CM9A 2JBAA 7ICKA 1BVSA 2ETVA 4M7WA 5G0TA 4I2DA 2DKNA 1NVUQ 1S01A 2GPTA 3BWXA 2QOEA 4KLOA 3A9WA 3U4IA 2NXNA 1DXQA 1QLWA 5LB4A 2QRJA 1NI3A 1ZHOA 3VNVA 5DFAA 1AHNA 3LPAA 3P52A 1TCUA 1Q16A 4BNKA 3D6AA 2QENA 4I2JA 4K9SA 4QW8A 3U1TA 4IICA 2X1MA 1LBSA 2C5BA 3IT1A 3KELA 3KFVA 4GR9A 4R84A 3PFHA 5EP3A 3KB1A 3RC7A 2BFNA 3E2MA 4GLLA 2W55A 2CB9A 2P9EA 5GV7A 4C4PA 5DDMA 4F50A 1ITZA 1Z00B 1W87A 4MKHA 4OV6B 3GEHA 2WD9A 4LYFA 4G5XA 3OP1A 3VOTA 3LOPA 1H69A 1VZ3A 1KY2A 2CXOA 2ZSFA 5DBEX 4A3SA 4FLMA 1VKZA 1HQCA 1AQIA 2BMDA 3X1WA 2IL1A 3U0VA 1TAGA 2OV4A 5ELXA 2IHKA 1FF9A 1BXGB 2A94A 4NICA 4R6WA 3TECE 2CLOB 5C0YA 3BGOS 2R8OA 4RMJA 1H0RA 3HB7A 2I71A 4K6MA 1JR3D 2C0QA 3AU9A 3D5QA 3L6BA 4LJKA 3ZY3A 5KPDA 1K5GA 2ZIFA 4IVRA 1C4XA 3M3HA 4CCHA 3OQBA 1VHWA 4E5PA 2FUEA 4NAHA 5LQUA 4OXXA 4M47A 1NXVA 2FW0A 1WWKA 2PI4A 1RM3A 2J32A 5JO9A 1MV8A 2O8EB 4XA5A 1G8PA 4RSMA 1TGYA 3K72B 1SZHA 4WLUA 3E9RA 1LBEA 5BSGA 2BCSA 4IMRA 5ALMA 4UTZA 3MPUA 3T34A 1RE1A 2HHSA 4CFSA 4UAJA 2QSUA 2ZTVA 3ZV3A 4F4YA 4RO0A 5BSWA 2IYSA 1GR0A 4X8HA 3ZCXA 1VE1A 1EUCA 4NJMA 1IONA 2QAIA 4M46A 2GX6A 1Z4JA 4UNIA 4Z8YA 1D9XA 3ZG6A 1QU2A 1SB8A 2QUIA 4IDEA 3QXXA 3RABA 3UJNA 2ZJ2A 3WK5A 1FU4A 1PQYA 2HMSA 1GQSA 2VHYA 4G5RA 1UBOS 3F49S 1PGQA 1M7GA 1CP2A 1U3DA 4US8A 2AIRA 4FQ7A 2PZBA 3VAAA 1W36C 1GPWB 5DTRA 2HQ1A 3A6JA 3EAFA 4RF3A 3ZWVA 4BKUA 3GWZA 2X58A 4CV0A 5IJ9B 3JQFC 1XB2A 4GGOA 4BKPA 3E4CA 3HX0A 3EG9B 1BGWA 2HHWA 4EABA 3OHSX 4I6JA 5CA0B 1I7QB 2XKBA 3VSCA 5LFAA 4CIXA 5EWGA 1WVGA 2H4HA 3KAQA 5KOJB 4LXUA 1S4MA 3IAEA 5JCOA 2EWVA 3VJRA 2YIDA 1X86B 6NULA 1ZLYA 4II3A 3HP1A 3B1VA 2XMGA 3Q7PA 3OO1A 1EEXB 5DASA 4PHFA 4WUVA 3WLEA 1NN0A 2JEJA 4LI3X 5F5LA 2HIAA 3P5SA 4BBPA 4X54A 3SK0A 3UPTA 1D4FA 2PWBA 3DWFA 1TM1E 2I62A 3GEPA 3JY6A 1IN6A 5H9VA 4HNVA 3EGDB 4HDSA 1JQEA 2X19A 3WKDA 4XWTA 2HJRA 2NVUA 3EH2A 2GA9A 3RVQA 1FRQA 2QZJA 3D4PA 3UENA 2YOFA 4MQLA 1Z0ZA 1W5BA 1IN5A 1FRVA 4RVOA 2WU4A 4HRXA 3OCUA 4PG6A 4V03A 1BRTA 4TSFD 1USGA 5E9AA 4WLVA 4EZ9A 4EGFA 1TM4E 1SZDA 3G5TA 4ZOQI 2NZJA 3IHWA 5HKAA 5L9XA 2B92A 1U6IA 2O3RA 3OLCX 4X9XA 2BCVA 5FF9A 4J43A 3OEEA 4ERXA 1XO1A 1JFLA 1QTMA 1XCMA 1IC6A 1X8LA 3DDOA 3FB4A 5LZ5A 3WB1A 2JLYA 3L6UA 1I6LA 2GF9A 4J8PA 1UINA 2IE8A 3PNQA 4RCYA 2IV3A 3H84A 5KMGA 5DM0A 2PMWB 1A9OA 1D6JA 2PZEA 4GWGA 4JJ4A 1ZVKA 4WLEA 1DFIA 3AERB 2D1QA 1M2KA 2P0EA 2R7KA 1E5TA 1LW6E 2O7QA 2QI9F 3LCJA 4FE4A 3STYA 2JH3A 3W1VA 4ZEMA 1NF8A 3PUYA 1TK5A 2WJ6A 3OIFA 5A4DA 1THZA 1SOUA 4LC1A 4MX8A 2DPYA 4X6YA 2PR7A 4GI7A 4J16C 1BN7A 4ZREA 5CM8B 3KTDA 3TL3A 5I7VA 1BPDA 1LH0A 1HG1A 3BGWA 4MW6A 5CCDA 1NXXA 1XA3A 2ZZNA 2ZIUA 4L85A 3H4BA 3AV3A 3ER9A 3ZKWB 3LCMA 3SG0A 2V65A 3EXHC 2X8LA 3EA5A 4M36A 1EFLA 4FT2A 5DGCA 5LIPA 5A0LA 3O8CA 2GPJA 3MS2A 3RJIA 1AROP 4FZNA 1VMKA 3DV0A 4E08A 4LJRA 3KVNA 2VSQA 4DXDA 1GZUA 5FP0A 1ONNA 1U7ZA 3KE8A 1A71A 3V2HA 5AW1A 1TVKB 2Q3MA 2H18A 3NIFB 4GPZA 4HJXA 1VI6A 2PDAA 3B1ZA 2OL4A 5TMEA 2PEYA 2XY7A 2ZIAA 4Q1CA 1SV0A 2E8PA 3MGIA 3I9NA 5JC8A 1IWPB 4Z2YA 2CLEB 3EZ7A 4TXMA 2Q5HA 4OLFA 1JZQA 3M5DA 3CONA 3FTEA 1J1IA 1MXHA 1Z12A 3DEKA 4OL9A 3MR3A 5IDQA 4L1KA 3L4EA 4NQZA 4ZQFA 3QUBA 4XXHA 2ENUA 4BEJA 1KAMA 1EK1A 2BMJA 9ICNA 3VYSB 3COYA 3JRXA 1T5HX 1JHDA 2BTOA 3PSAA 4GM0A 3BQ0A 1CUCA 1EWRA 2G1UA 4KQMA 4AQDA 1JDBB 1O9BA 3BB4A 5JXWA 2WHEA 1KA9H 1X7XB 1SQSA 3PNKA 4QULA 3V7FA 1P8AA 2GXQA 3H5NA 1UANA 1IE3A 4CQMA 1EUQA 4RNNA 1WETA 2C98A 7ICVA 4NULA 2R1VB 2BPGA 3IOBA 2PJDA 3CB4A 4NXZA 1SBQA 4XQGA 1SCIA 2ASDA 1SBTA 2Y05A 4QPDA 3GY0A 3PCTA 1IVSA 3PTLA 1Y89A 1KJIA 1SVUA 1GAJA 1WCLA 3ILSA 2GFQA 3HKEB 3CZ9A 3KOZA 4PGXA 1E18A 1GEGA 1Z0UA 2OCDA 3VO9A 3L4BA 3PQ2A 3SEQA 1SKUA 1W29A 2C8VA 2RC5A 2VS1A 2OWDA 3ESQA 2GS9A 4MQEB 3RRMA 2UUPA 3SQOA 4DAEA 1HMPA 1SK8A 4H0CA 1F2UB 4Q1BA 1OMOA 4BNZA 4MHVA 3MD0A 2PQ6A 2XUJA 3WBBA 2OLJA 5DB9A 4O2BA 4BEBA 2P9HA 5BW8A 5CRIA 4TROA 1FVFA 4G09A 1P45A 2KW5A 1I2BA 2EAMA 3BGVA 1JG7A 2X4DA 1JHMA 1UDCA 1WB6A 2ZS8A 3LLCA 2FE4A 1JQLB 4LRQA 4OB8A 5FQOA 4BFTA 4YAUA 3OHMA 2FLLA 2VBFA 2RQ5A 2IJGX 1ECFA 5T67A 3EW9A 1GQRA 2BM9A 4INOA 3RSZA 5COQA 3QFCA 4F8YA 5L3QB 3MT9A 4C2TA 2LHTA 5T6BA 4BB6A 5JZVA 2N1RA 3M9LA 1Z47A 1GO2A 1JPNA 2G82A 2VRWA 3HVUA 1U5CA 3L8FA 1U2QA 4X3CA 4ZAXA 5GOTA 4LFCB 4EEXA 3THXA 3EODA 4KNYA 3ZZTA 3CG0A 3ZDDA 4KKVA 1WUDA 3PC3A 4J1TC 3WYEA 1XQWA 2I1QA 2NXCA 1W0JA 3L3FX 2NO1A 1KN5A 2HHTA 3ID6C 2VPYA 1G291 1T5BA 5H3LA 1WZCA 5BW5A 2Y4NA 1M6NA 2WUDA 4DB2A 2W7PA 1XXLA 1P0PA 2NTEA 4IVNA 1SU4A 4MOWA 1NK8A 1RZRA 2E2WA 4TRRA 4XJVA 1ZI8A 2L0XA 3A1UA 3FI9A 4HEA6 1Q0QA 5KKCA 3SAHA 2DUWA 1IZ7A 4G0OA 4D8XA 5JAUA 2XNDA 1NOMA 3IXQA 4RFSB 5ALGA 1TQDA 4BO7A 2JZCA 1CDEA 1RBZA 4Z53A 3C5EA 3BWEA 1NJXA 1SPXA 1WABA 1X7YB 3NATA 4J7UA 1VLVA 5E8JA 4OD0A 3A28A 2WI8A 1HH4A 3OZRA 2EZ8A 1KFKB 1LLUA 4FK8A 3GDGA 4P34A 1CNEA 2GYYA 1ECCA 3PYLA 1FX1A 3HVHA 1XKXA 2V7UA 1JXLA 1MO4A 2FLKA 1VJTA 3OT1A 4RENA 2NSYA 2X8JB 3BN3A 4YO7A 1UZUA 1KQPA 5HGXA 2D8MA 4QG3A 3CKKA 2C7PA 4GPD1 2HHXA 3GCGA 5TT1A 3M6AA 3GFVA 3FBWA 4F5YA 3E22B 3KJXA 1NF9A 3I6IA 3QPBA 4LX0A 3SI7A 3OFKA 4FE3A 4BOYA 4DSAA 1NQOA 3GUVA 1JAHA 4JI5B 3H83A 3KUCA 3DYIA 1LZKA 3P9PA 1KE2A 1P1JA 1W19A 3AHIA 3NNSA 5CXQA 3T52A 4EF4A 2ZBPA 5B55A 2I6XA 1YS9A 2AZMA 2DCUA 1C9YA 2C7GA 2FSIA 3K6RA 4KZPA 4EPXA 3DF7A 3LOQA 5JSZB 1U1IA 1EZ1A 2GZHA 3H18A 3TBHA 3JATB 4A36A 3KJNA 3H5RA 3PCXA 5CA1B 2ZVDA 3MWYW 1R50A 2QMQA 2DLCX 1H9CA 4YO8A 1FSGA 4DQUA 1JJAA 1E8MA 1N75A 1T2CA 4FYXA 1AA6A 2H1LA 2ZETA 4G1FA 3A6GA 3F78A 1NVGA 5LBTA 4XD2A 2GD1O 4W8HA 4ZJUA 1PZFA 5IYZF 1QR2A 2CD7A 2R44A 4OMUA 1KRHA 3ES9A 1RWXA 3AK4A 4ZDKA 4PPQA 5J2TB 5TY0A 1N1DA 1V7CA 2VNSA 3OPMA 3PITA 1W48A 4RV9A 4F2DA 2QHXA 2HIHA 2CLHB 5G5GA 4RHYA 3NFRA 4HMQA 4N39A 5JZSA 4CG3A 2NPIA 1DAHA 1Z36A 2HXSA 5JZBA 2REBA 3IDOA 3VM6A 2XI9A 2OXEA 2BTEA 3PSTA 1UUFA 2OPHA 1E1CB 1L7OA 4C0WA 4XB6B 5FA5A 2EL7A 2FZGA 7ABPA 1GWNA 3LBNA 2GEDA 4R1TA 2DG2A 4DJ5X 1NSYA 5EIEA 1FJHA 4DL6A 3TN7A 1CT9A 1EK5A 3O2QB 4MDYA 2GOYA 2WMDA 4O63O 3C6ZA 5ECGC 1JQ5A 1NVWQ 2XITA 4P2BA 3G6YA 4IL5A 2JHFA 4FGLA 4KG7A 4UQGA 4KVAA 4LY3A 2ATVA 4PGHA 1ZOSA 4U7TB 4DPKA 2ZIVB 2FSHA 1FBTA 2VUUA 1SKRA 1WO8A 4U3JA 5JSQA 5L9AA 5IINA 2K4IA 1KRXA 2OHGA 3W79A 1WSWA 1BE0A 3G6KA 1PVQA 3D8NA 4H3HB 1QIDA 4RM2A 3BWMA 3RFCA 4FYWA 5A4IS 5IJXA 2W9BB 1Y9EA 5HR5A 1KNQA 1Y6QA 1WUHS 1TTHA 1J22A 1F1JA 1AX9A 2FWJA 5CFPA 2JLUA 1MEJA 3AR3A 421PA 1FIQA 4L5CA 1NOJA 1SU7A 3HRHA 4KE8A 1VPVA 1T6YA 2J5KA 4RK4A 3VDNB 1AY0A 2G07A 2WQ7A 1EX1A 3CC8A 3IAXA 2I87A 2OHFA 8ICLA 2HHCA 1TZJA 2UDPA 1V0JA 3AFOA 4C2UA 1XNJA 2FJPA 2GSDA 3CZ5A 4XDHA 5CX1B 3H0RB 4F5EA 3THWB 2EX0A 1H2RS 3AFIA 4X7PA 4ENUA 5HK9A 4LZZA 1EGMB 8ICSA 3PP8A 1UM9B 1WTAA 4MV9A 5AVWA 4ZPJA 1EXVA 4JLAA 4MUFA 3NH6A 3D1LA 2ZAMA 1Z29A 1YDGA 4LDQA 1PR1A 1LDGA 5DBGA 1B0UA 3SS7X 2RGRA 3P9IA 4YD2A 2J45A 4OJPA 5LQRA 1SUWA 3IURA 4P08A 1GGJA 5KYUA 1J0BA 1XCPA 5A3QA 2ES4A 3PUJA 1HC7A 3DXZA 1H8HD 1ONOA 3A6EA 2P2SA 2PGIA 3AYZB 4TL6A 1DOZA 4PJ0U 4IHJA 1GG9A 1NXQA 1QTQA 1EFRD 1GAQA 5KBYA 2N47A 4QQFA 3B1JA 3MJCA 1XCBA 3Q72A 4UHJA 1MORA 1YIDA 1ENYA 1NA5A 1C9EA 1JVNA 2VC2B 4IH4A 2NYAA 5E6SA 3THSA 3R9XB 3EVTA 2CWDA 3OJSA 1Z6GA 2IU0A 1A9PA 2IWHA 5JVDA 5IK2D 3H6GA 4DF4A 5TJHA 4ED7A 1G21B 3TAUA 1E1DA 4R01A 2DLDA 2DF4B 2EBFX 3HJBA 2AC2A 3MMPA 3QFRA 5AVZA 4NY1A 3T7RA 1ZK1A 3BPSA 4DF8A 2A78A 4GGMX 3VKFA 2YHIA 4Q03A 5J59A 1JHZA 4ZRNA 2P9JA 3T3MB 1ZDMA 1JDVA 1NW5A 3SKXA 5ITZB 5J2GA 2W7TA 4H7HA 2L5YA 4QU8A 2QTCA 4WKNA 4BTEA 1RLMA 3NHPA 2ADOA 5C80A 3BWDD 5JECA 4QSMA 3UTCA 4E1BA 2ZBDA 2JH1A 2I29A 3HRIA 3OPQA 3S7TA 1ZESA 4OFBA 2BEVA 2BKLA 2Z95A 4NDAA 1JBKA 1TYAE 4R2LA 2I54A 3ESBA 3X44A 4J16A 3DOUA 4BNDB 5THKA 5BRJA 1QF7A 2PQMA 1INLA 1EWQA 4XVQA 3OAAA 2FSGA 2PZJA 4UQLA 3IVCA 4O4IB 5JR3A 4TT3D 4BFWA 2QORA 4DR7B 3NVYA 2I22A 3EF1A 1P5FA 3JTEA 3FNIA 1NPDA 1GUBA 4M4SA 1DXHA 4UHKA 2A35A 4H1UA 1J39A 2BUCA 2GTIA 3EFOB 1WCNA 1WP4A 1JTEA 3FF1A 4WNAB 3ZD7A 2VJQA 1U80A 4HXFB 1DIRA 1P2GA 2W4QA 3M4NA 3NVDA 4K9PA 4WNCA 4QHTA 1CQXA 4UU7A 4QLBA 2R0QC 1W46A 3U1BA 5D86A 3ECAA 4DL3A 1RJ9B 2ZUBA 4RV5A 1VPTA 4I4LA 1Z38A 3AEKB 3T3DA 4RHUA 4EF5A 2Z6QA 4TYQA 1ZH4A 5AOCA 3FPAA 2QTAA 2JJ2D 4KN8A 5ARCA 5BVGA 1VBMA 4ZV9A 4EY7A 5F9MA 4H0FA 1VFPA 1UXIA 1Y98A 1CHDA 1SVNA 1UK9A 3LPNA 2CL6X 3I1FA 1KQNA 1QRUA 3GPIA 1X77A 3LVFO 3G2IA 3M6ZA 1E6EA 2GZSA 2X41A 3BXGA 3ILYA 2CRXA 2HWWA 4L0QA 1ESZA 4LHEA 3E48A 4PG4A 5FHRA 4KDEA 2IRWA 1NBIA 3HHEA 3NBXX 4F4KA 1ZH2A 4WJ3B 2GLTA 1FRFS 2UYYA 4EUEA 2RI1A 4O2BB 3DF9A 4K4GA 3I34X 3L1HA 3QLTA 4H35A 4LXHA 1K68A 2JJYA 2X9GA 3LZCA 3RU3A 3RYFB 5IASA 7ICMA 3RS8A 3CW2A 1D3AA 4YLGA 1UWVA 2WU0A 3OOYA 4P4PA 1XIVA 1ZXXA 2KI5A 1E1NA 3VKGA 1GZ4A 4LZWA 5GONB 3QXJA 1T3QA 3WGYA 5AK5A 4YP9A 4RUCA 3M9NB 3ZZMA 1AF4A 4IOLA 5IC4A 2RGWA 5EVCA 3CZ4A 5FWDA 4LFAB 1XFAA 4ZAFA 3ROXA 1ABEA 3UCXA 4F12A 4KEAA 3H5VA 3HJGA 2BMVA 1NOIA 4OHXA 3WQRA 5BQ5A 3ENQA 5KAPA 3P9YA 3S70A 1OXBB 1CUVA 2O3UA 3IEIA 4DNQA 3KJIA 3HEBA 5HILA 1G64A 1T36B 3A31A 1MABB 3RQIA 2JIDA 3R40A 4B09A 1JPJA 3BB3A 2Y1JA 2IHZA 5KFJA 3VDRA 4RK5A 3R7DA 2HBMA 2IEAA 1AT1A 1XKTA 4CF5A 3RIHA 1NDHA 4PO3X 2ZE5A 3HDTA 4KWEA 3MABA 3GV7B 1WZUA 2CXRA 1OJLA 2HTEA 3GFFA 3LIIA 1Q0LA 4KE9A 2KX7A 3QWBA 2EAPA 4QELA 4O5EA 1RLIA 4DL7A 2P79A 1TTPB 1PR6A 1KEKA 4HWTA 4IXDA 5G41A 4C87A 4E5KA 2UAGA 4CMCA 4PBRA 4MR9A 1IMJA 2UV8A 1QO7A 2JJQA 3H2SA 1E3SA 1SVWA 2RGXA 1B43A 4MEBA 4A5SA 4B83A 4CKEB 4UATA 2M6LA 4BWGA 7GPBA 3TQ1A 1RBYA 3BE5A 1EFRA 2VKTA 4R2MA 4PAWA 5F2EA 3QEKA 3S5UA 1U8FO 3RYIA 8ATCA 2RGAA 1KZ7B 3D3WA 4RQBA 4BWYA 2EKLA 2J7KA 3A9VA 3OOSA 4B3TB 4JYPA 4LE2A 1CR6A 1SVOA 3A10A 2OUKA 1N6RA 3FTQA 2FHSA 1YUBA 4HAVA 1E94E 2IPNA 2NT3A 3BH7A 4C7YA 2GFHA 3B0XA 3N0TA 1C1DA 2PT5A 4P0PA 3DFKA 5EMHA 5JCJA 1KFEB 4QPNA 4RDHA 4YEDA 3URMA 1GGVA 1Z18A 2PUEA 3FLEA 3FW1A 2PJZA 4LSGA 4XRGA 4HVTA 4X1IA 2Y1OA 4FDUA 4BZPA 2IPXA 1JR2A 2EFDB 3GG2A 3HADA 4LG1A 4PWZA 2P9CA 2H8GA 4H1TA 5HZMA 1BWRA 4G41A 1CZUA 2O5EA 1C3OB 1M8KA 4EAQA 2WKSA 4N8EA 3Q7EA 3AETB 4OI2A 3W6OA 2GBCA 1L5HA 1JKIA 1IBRA 1H8ED 2P7HA 4EKNB 2BC9A 4RKEA 3IQIX 1AA9A 1HFKA 5ILGA 4F97A 4FSDA 2ESRA 3H99A 1U2DA 3U4QA 2ZS9A 2R5FA 4ILKA 5DHAA 1X7GA 2QPOA 2W2MA 3P71T 4M83A 1ES9A 5EG5A 4W8GA 1FVOA 1F1BA 3D0OA 3P9RA 3J81j 3KKNA 3DXFA 4FIZA 3WLQA 2D5BA 5DU2A 3C3KA 5CB4F 2CXTA 2X6RA 3PFFA 4P0QA 1YAHA 4DA9A 5CB1A 2WIDA 3V72A 3P96A 2ZRDA 1Y1PA 1KXZA 3KYDA 3PEWA 3KP1A 4QFDA 1LTHR 1S3FA 4LGMA 1ZH6A 3EDCA 3UK7A 1Y0BA 1HEKA 1L4FA 2H16A 4G65A 3VH2A 2VF8A 3LT0A 3TR6A 4D4KA 1A0OA 1WHSA 3QI7A 3SM3A 4Z54A 3IIKA 3S81A 1WBJB 3SHTA 2J1LA 4BVGA 4Y67A 3RG8A 1SXPA 3EN0A 3CLSD 1J2MA 4GOXA 1JAIA 1OJ7A 4FQ8A 4JXXA 2E1PA 3ONDA 1FRZA 4JELA 4R31A 5K6RA 1H1DA 2JI8A 4J9KA 3QFSA 4JUAA 1Z7YA 4D9IA 5FTWA 3ZH2A 2XRZA 4CEIB 3JRNA 3DE6X 3B51X 4CF7A 5EIFA 3EMVA 4RQ6A 2WFAA 3DP9A 3A8TA 4HLUA 5JQGB 3OD5A 3G0IA 2FK7A 4L2IB 4AG6A 4BFSA 5ICSA 4Z9XA 4B44A 3IBYA 1A9YA 3PC2A 4WCFC 1XCJA 4CZ2A 3ENNA 2JFNA 1TECE 1P61B 2NG1A 1PFYA 4K6FA 4M0CA 4P1ZA 4CR7A 4Q45A 2W3SA 5ALQA 5K20A 4CM8A 5C3UA 3Q7TA 4UU1A 4P3OA 2LYBA 2GJKA 2HF9A 1T36A 2AN4A 2QQGA 2VQDA 3PNMA 5EEGA 4TKVA 4IXMA 2V3CC 1ZQHA 1V85A 1YOVB 1B8UA 3M1AA 1UKAA 1CUGA 2YZMA 4M9QA 4NU5A 3FF4A 3MC1A 3HABA 4BBAA 3LE8A 3BDPA 2DKZA 1VKRA 1C7YA 4L76A 2CVPA 2C20A 1MB2A 3FDZB 1U49A 3G7NA 2QDXA 4ENWA 5TT0A 2BSAA 521PA 3I92A 2Y8EA 2B1GA 3W5HA 4QZCA 3VPXA 1PIWA 3NI2A 2HMXA 2B2XA 1JW9B 4BC0A 4UQOA 5LMUB 4D9MA 1B6GA 4KYUA 2I76A 3BHIA 4EY4A 4QZBA 1Y5NA 1AE1A 3BXFA 3SIXA 1QHNA 1DFGA 3JQFA 4G5QA 4YROA 3EEOA 2QR2A 4DMUB 4KOEC 2ES6A 1VIMA 4D82A 2JFVA 3NWJA 2XPCA 4R5MA 2XTAA 1ZXIA 1G2QA 4Z7JA 2OQVA 5B6IA 2ZYDA 3Q41A 3T41A 2H3FA 1SZCA 4BN5A 4EFLA 4B80A 1E6CA 2G1AA 2FMIA 2OCYC 1Y7TA 1OLXB 2XI4A 3IOEA 5LYJB 2B30A 2FTKE 1U6KA 1YIAA 2BEVB 3I2KA 5LMNB 5CFOA 5LSAA 3FKQA 4OB7A 5DTJA 2HCBA 2PZKA 1BXRB 2OV6A 2XCQA 5EMNA 2VEDA 3PD7A 2EQAA 4WHMA 4MJLA 2YX8A 4UQPA 3AGPA 3LSYA 4Y6GB 4A16A 1HE5A 6PFKA 8ICAA 3GEEA 4XE5A 2QD1A 2A9OA 3I73A 5TMPA 3ONVA 3BUSA 4RPZA 1XZHA 1HM5A 3BQ7A 4KWTA 2ANBA 2CDAA 3ANMA 2JJ2A 2YFKA 4IO1A 4CR8A 4ZYVA 2YOGA 2GKGA 1XRRA 1HRKA 3ZE6A 3CBQA 3GVHA 8ICWA 5ALKA 4MUBA 2JBAB 1ZD8A 4GRIA 1HFJA 2Q0HA 3PK0A 4H3VA 5K0SA 4S1NA 1G42A 4PSDA 1UPFA 1YZUA 9ICOA 1YBFA 4IRKA 2B99A 3ESDA 4O1HA 4O2LA 4U00A 5LA6B 5NLLA 1X6JA 4GQBA 5KQMA 4RTMA 1TM2A 3N7AA 1E6KA 2I1LA 3E7XA 3V8QA 1WCV1 4ZI7B 2HPVA 1X1DA 4TXJA 3ZI4A 2O59A 2H00A 3TLGA 1D0SA 5CLGA 2R1VA 3VHXB 2JK1A 2H4JA 4CKXA 4ZDJA 4DR2B 3HXQA 5FTKA 5JMOA 5CT6A 2Y2VA 1T8WA 1K9VF 4E33A 1U7WA 2B8TA 1RRFA 1QMGA 3NHAA 1G8HA 1FJ2A 2XCIA 2CHQA 4FONA 1VIYA 1ZQZA 1H5QA 2GEUA 2YWRA 3VU9A 3LBAA 1C9NA 2YHIB 3AF2A 3R4CA 4N9WA 3I9FA 4HNUA 4TTTS 1RS0A 4UAYA 1U02A 2F1IA 1JGTA 3RASA 4YT4A 3NGDA 5J2CA 4DSKA 4OXYA 1TUGA 3B6JA 4MWTA 3ZJ4A 4LY9A 5CJJA 3GIJA 5EMMA 4CCYA 4RT2A 2XX3A 3E1GA 3X2EA 2KTQA 1ZIYA 3P27A 2FKNA 1VHDA 4UB5A 2O5VA 3R7NA 1T4GA 4QDUA 5DN6A 3ELDA 3ER6A 3BXPA 2B0JA 2IYZA 3JQEA 5T8KC 3ZU3A 3CEPB 3L7DA 5EJ9A 3JQQA 5MGBA 2Z8YM 1MOZA 1J09A 1ZP6A 1HPLA 2E1RA 3JVDA 3OHPA 1A5SB 4US1R 1SXGA 2UXBB 3ZHUA 5DG9A 3ENWA 5JD3A 2BGKA 2YYYA 3E27A 1M2HA 3KSRA 1KEPA 3DFZA 4HMPA 1G8GA 3O9MA 1YMVA 4LZAA 4BGVA 3QENA 1DDGA 2GN6A 4DS4A 5DNDA 4YUXA 5BW4A 2PX6A 4CUJA 2EZZA 3CRXA 2H6EA 1C5KA 5THXA 4C3OB 4MA0A 4D3DA 4BNFA 4DRZA 3BBLA 3U40A 4A0QA 1X6VA 3KKKA 5FD8A 1FK8A 1PFVA 3U26A 4TTJA 3EFBA 2DETA 2VF2A 2OGUA 4O3FA 5IDWA 3GLTA 1T8RA 4FOSA 4X1YA 3IDWA 1N2OA 2EXXA 1FMJA 3R3XA 1R5BA 4U0JA 5EJ2A 3OIGA 1OZ0A 4TQRA 3THOA 5I9IA 1JR6A 4BO9A 5KT7A 2JVKA 3EDRA 2PYIA 3E1KA 1TK3A 2J9ZB 3JAKB 2EGUA 7MHTA 1AUQA 1QDUA 1M54A 2HCRA 3OEWA 4R9RA 2I8AA 4UEWA 4B6GA 4DLRA 4D9FA 1RPZA 2VSFA 4JT4A 2A0UA 3HHPA 4NONA 5JZMA 5ALRA 1IWOA 3GGDA 3ZJ5A 3DQZA 5CPBA 1DHRA 4GKKB 5IT0A 1IXSB 1KTIA 1H3EA 2W9BA 3ROPA 3PHBE 2HDWA 2DFDA 1UOPA 3OZ7A 5D7BA 1L4NA 1BW9A 1L8AA 2HRDA 2ZRPA 4B71A 3ZC3A 4OQDA 3AN1A 2I4LA 2L69A 3HUTA 2RJOA 2XOKD 4MVWA 2APJA 3OKAA 4N7JA 4N1AA 3MT7A 5KFAA 2CJWB 2OHJA 2J6CA 4MIOA 5HF8A 2B8NA 3VOAA 1NKEA 2A84A 2XCRB 1UBEA 1P8JA 3ED5A 2AHOA 5IIIA 8ICMA 5ESXA 3MWEB 5ADUS 1NI5A 1HLFA 1E62A 3NBUA 3HCNA 4MTCA 3Q5DA 4PAMA 3NRZA 2XUFA 4QYXA 3IDZA 4MVJA 2ZRGA 2PMKA 3CU5A 4N5HX 1NE2A 1M34B 2CLFB 2HDHA 3IR7A 4S1VA 2BTQA 4BX2A 3NGLA 3N2NA 3V1KA 5DM70 1Z2PX 4WY2A 3RIXA 2DQKA 4RZRA 3RH4A 3OZFA 1XK7A 4U5QA 1W5SA 2R8ZA 4S1OA 1KAOA 3CZQA 3OF2A 3T1OA 3BL8A 3BMQA 3CS3A 5JAQA 3RSQA 2W03A 2AQIA 4F4DA 2F44A 3D0KA 2P9TA 1M8FA 1CUJA 3EOBI 4DXHA 4LK3A 4J9OA 1AK9A 1IHXA 4RZQA 2QUHA 3NXKA 5B57C 1V71A 1DRWA 1WUTA 1RDFA 5FNVB 2GF0A 3O3CA 1X7DA 2X1HA 5J3JA 5IT9A 3WWOA 4KSYA 2W2KA 3E03A 3IQWA 4MLPA 2HGZA 1Z8FA 1SUFA 3OIYA 2B35A 1AU9A 1LFAA 1RKBA 3PQ3A 5KEIA 8ICCA 1SXJB 3CRRA 1FS4A 1MX1A 1TJ3A 3TCKA 1OW5A 4OJKA 1YS4A 3PUXA 1D0IA 4Y2JA 3ESAA 4GPEA 1CERA 5DI9A 4E30A 4OAOA 2I2XB 4R3WA 2IOQA 4IUBS 3KJFA 1YGPA 4RA6A 3GFRA 3PNPA 4QL3A 2ZRMA 1H22A 4QJ4A 5D3ZA 2BKEA 1VTKA 1S97A 1JLLB 1QJ4A 2IT1A 4WKBA 2Y93A 3N4MB 5GTIU 1E9RA 2Q0SA 5EJGA 2BM1A 3TKYA 2K4EA 4KODA 1RWMA 4GUAA 5J40A 1Y3AA 2PU5A 3FXAA 4K46A 3JD2A 2HL6A 1VKJA 4NE9A 3V1MA 3FAKA 2H54A 3CT6A 2YHAA 4KLEA 5CP2A 4OXKA 1CZLA 5EJ7A 1G0NA 2EC5A 4DSUA 2WHRA 3IJPA 3PY8A 2B4QA 2YWDA 4CODB 2W83A 4TUSA 1ZQDA 3SYKA 5J58A 1M2FA 2WUGA 3DM5A 1YMUA 2OILA 4KRFA 3EISA 4HYYA 2QP3A 1GUYA 1GU7A 1QG2A 2GNAA 2W93A 3V8VA 2LIPA 4YMOA 3EA0A 1P72A 2WJWA 2ZBVA 3ENKA 4MPPA 4OGGA 5JISA 2JS7A 3VR1A 3WLKX 5EZQA 2VYVD 2XVMA 3N2ZB 4UULA 1DMSA 3PDUA 5GM2A 2P2CA 4NS4A 3X0DA 1S5LU 2BONA 4ZZ0A 3OJ0A 5JSKA 3BQTA 4OKNA 3MB5A 4I4TF 5A3JA 2H5XA 4L57A 4QD3A 3WNZA 5HKOA 3EYWA 3UGJA 3AKZA 2D1YA 5DWDA 3RI3A 3U3ZA 4C6TB 1B23P 2NVUB 1L6NA 5DOVA 4EWLA 2XGMA 5TRTA 8ICPA 2R8HA 4LVUA 1N2JA 2XA2A 2NUTA 3ABOB 2YXDA 5IBRA 2AQ8A 2A3RA 2D7CA 5EKXA 3U6BA 1IG3A 4DV3B 3NHZA 4CQLB 1F4PA 3PUKA 1IIPA 4WTOA 2VDVE 2XNDD 1CUFA 1M2WA 1RHJA 3OZXA 3ETRA 1R1DA 2PX3A 3UIEA 2DPGA 3KQTA 1DV2A 4TLMB 1L3TA 1K3TA 4N7MA 3U17A 4DREA 1I14A 1B42A 1E32A 4HSGA 4RH1A 1X87A 5LMZA 5KVVA 2JI6A 2QROA 1DTWB 1Z25A 3CX6A 4GC5A 1PK3A 3PGLA 4R98A 4TV8B 5EWLA 4CEJA 2Q7DA 5FEMA 3TSAA 3OMXA 4RNCA 2Q3JA 1G21E 5L8VA 5KCZA 4UUBA 2C7RA 2OE2A 4GM1A 1L8XA 5EJ4A 1XC9A 3PX7A 4K6GA 1HDCA 2Q7OE 2VTVA 4I4IA 2QTVA 4NH4A 1LVUA 2C5AA 4DGQA 1XKLA 1Q74A 1UR5A 1EQ2A 4IIJB 3RR2A 2QY9A 1FPQA 1LPOA 3K2IA 3WQSB 4EHJA 2C04A 3HVIA 1Y1QA 5JWOA 3EIEA 2RE8A 5AUPB 2X6QA 4KR3A 2OBXA 2H7YA 2YR0A 4TVOA 4W7HA 1HJPA 4I55A 3Q6NA 1TMOA 3NKLA 4L3OA 1U7OA 2QM7A 2O52A 4TLBA 4DL4A 3LQ1A 8MHTA 2XB8A 3ACCA 3O0DA 4RFSA 5CDUA 4FDVA 5G3ZA 3BHNA 1U9CA 3OLZA 2CUKA 5EP2A 4ATNA 4BKQA 1EINA 1JU9A 1ZXBA 2PAAA 1S6YA 1FP2A 5EE3A 1FFXB 4I14A 3E9ZA 1NMYA 4ME6A 1MPTA 2GD2A 4U7DA 5FOVA 2P9BA 2Z30A 1RXIA 4H7EA 4CT4B 1W9HA 2WSIA 2TMGA 2HADA 2Q6KA 1VJDA 1K7CA 4G8DA 4JL6A 1YBHA 2XEDA 2ZKLA 3M9WA 3M1LA 2DBZA 2GLEA 1BS9A 4NG5A 4GKBA 2IHUA 1ISPA 2CWWA 4N6OA 4EW3A 3LWLA 2JHAA 3I9V1 3TL2A 1SUEA 1V45E 3TQTA 4QOFA 2MMGA 4EA8A 3GIWA 1WYGA 3QFTA 3MBOA 4XM0A 4N3AA 1F0NA 1R3DA 3T7TA 3V4RA 4EB6B 1KR2A 4DFPA 5H3HA 1I3MA 4JI2B 5EEHA 3Q8PB 1D8BA 4MAFA 2E4VA 2QU8A 4C05A 3SQMA 4EFNA 5J4HA 5ALNA 3QJGA 4G1EB 5DKFA 3RU7A 4BP8A 1BCSA 2P65A 4ZZ3A 1JLSA 5JH7B 3DBRB 3UMGA 1QZUA 2ATLA 3MGVA 1UPXA 2AZ4A 4OBBA 4Z6KA 3C2KA 3I28A 1NATA 4XEUA 5AKIA 2VOJA 5IPFA 3LVBA 3V33A 5K0GA 1YZTA 5KL8B 5U9CA 3WYNA 1RRGA 3NUQA 1R8YA 2FFBA 3NTLA 1J20A 2XWSA 3DEZA 5ICCA 2V7QA 3ZGXA 4U4AA 3MT8A 2C2XA 4G67A 4L5AA 2EG9A 3UC5A 4BDPA 5M29A 3ESCA 2V4RA 1SXJD 4GLXA 1KVSA 3GLHA 3NJ8A 4I46A 1HYGA 1YVRA 3WI7A 4NIMA 4OJ6A 1XZ8A 2Z1MA 2WNHA 3NVZA 1RWVA 2WB1F 3VTKA 1HUOA 3G13A 1RXYA 3UTDA 2JRLA 4YRIA 3LK7A 2C3UA 2CMGA 4TKUA 1FFWA 1KI9A 4QBGB 3IRUA 4GNRA 2A0WA 4DV0B 4AKHA 1PSWA 3B53X 3NBZC 5GTDA 4X66B 2KIWA 1ZUIA 3KT6A 3RUCA 1R8JA 2RCNA 4EO7A 4M89A 1B6TA 2Z5GA 1BOFA 3B7WA 1A4RA 4DJEC 4M86A 4F96A 3BIFA 2K4PA 4N6GA 1PWHA 4FMPA 1ZR4A 1R8XA 3P9CA 2JIRA 3UMCA 2Q46A 3LX6A 2R8BA 4FP9A 2C2DA 4CI9A 3SHFA 5IAOA 3W6UA 4D9CA 1KH3A 3FLAA 1GLVA 1S8FA 1PL8A 4JJGA 2H1FA 1C9MA 4IFTA 2W9AA 4GXIA 4L9SA 4YMIA 5JXIA 3GFOA 3FM9A 4J0CA 4ZT2A 2CV1A 4UMFA 3K0FA 4J07A 2BY4A 3U7RA 1A7KA 4I2CA 3RIEA 4L9RA 2BGNA 2KMDA 1CUSA 3AFHA 3F7NA 2QXUA 3O31A 4Y6RA 1XSLA 5GJVC 4YY3B 3SHVA 2FUKA 2DJIA 3CRQA 3VNQA 4ZT7A 4KDFA 3UG6A 1QQTA 1KOLA 4LFBB 4RTPA 1XG5A 2EL9A 2XOXA 1FXUA 3OTOB 4B3JA 3T12A 2V9PA 2DGZA 2EHDA 3D5TA 3EZ2A 4K1LA 4QO7A 4MPRA 5BT8A 2VPIA 2D8AA 5AW2A 2V7TA 4QZFA 4PQGA 2AMVA 2XCUA 3G68A 3R6TA 2GBLA 2VBGA 2Y1DA 4DLBA 2R6R1 2ZJZA 4YAWA 1XCGB 2BN4A 4NV0A 4RZ3A 4YCJA 4F56A 3CLTC 1JIQA 4F8EA 2CJWA 1RC0A 5E6UA 3HB5X 2MYPA 3FWYA 1GCOA 1A8IA 4YCNA 4MHTA 3L79A 1ENOA 1EKXA 1EFCA 1SKAA 1CIPA 1XC7A 4NLKA 2AN1A 1XD9A 4F3CA 3D3JA 5TDHA 1FNMA 2D3WA 3T1VA 3U80A 2RLTA 1G7TA 1VL2A 4I0WB 2BL4A 2CVFA 4M22A 4C7XA 1MB9A 5CW1A 4HAYA 2CHEA 4C20A 5AKXA 2XOEA 1KEVA 4ROSA 5B3AA 2UXDB 1N0VC 4HQKA 2AS0A 4DTIA 4EB3A 2YXEA 4OLJA 4FWIB 2NZ2A 1WBBA 1GIAA 3F8SA 1Z4KA 5A7FA 3QTBA 1WWUA 1YZ7A 1DMRA 3BS7A 4S1PA 1ZWKA 3E5MA 4FW9A 2YIVX 1N62A 3IIJA 1GGKA 1WD5A 2OO7A 5T4EA 3ORHA 4ANFA 1ETUA 3H9EO 1ZRMA 4KLLA 1UK8A 2D8CA 4J0GA 3UBMA 4LZGA 1TK9A 2LVBA 1L5WA 2YDXA 3L8MA 4YCAA 4PQEA 1A5BB 1YR9A 2ST1A 4QUHA 3STVA 3QEJA 3LPMA 1MRZA 3FPSA 3EBOA 5DYWA 2JZNA 1GLNA 5B66U 2FSVC 3QEMA 3U3DA 1O54A 2W58A 5D6NA 3GRAA 4I50F 5IXSA 5T5QA 3SXPA 1SIBE 5HHIA 3AEQA 1XF9A 3EXIA 3N70A 4R1LA 4Y18A 1C14A 2OK8A 4WN9B 3IP4B 3EPRA 4O2AB 4ALKA 1KMIY 4ENQA 3W9UA 5FPKA 1U9JA 2FGJA 5JADA 3N2KA 3WV4A 2ZYRA 3LVVA 2Y1KA 1AB6A 2BW0A 3HNPA 4GXNA 4DOMA 5F9FA 3PFIA 2ODTX 4OP3A 5ELMA 3BVPA 2EV9A 1X1AA 1EDOA 3NJ4A 4EATA 3EPGA 2OWOA 2V8OA 1JR3A 2E4AA 4KXWA 4KFRA 1MIHA 4O4HA 4O4JF 3BREA 3RH5A 4P3XA 4P58A 4MV7A 4UVDA 4MYHA 2WK1A 3BQ1A 5JAIA 2OG2A 1EXNA 1T1EA 3N0VA 4LWQA 1KIMA 2UYCA 2ZQYA 4F72A 1NYRA 3GNQA 1V8OA 1T3TA 2RB5A 2JFWA 1ZQNA 1Y1TA 4MKIA 3DGEC 3REQA 5JH7A 4WK6A 2CSXA 4JB2A 2I3ZA 5I5GA 1PWZA 4ZKEA 3RIYA 1ZAKA 2IYUA 3F98A 5ER9A 3TLEA 4EKIA 4P2GA 3VPAA 3IBGA 4DMCA 3DXXA 4M0PA 3CF6R 3PXDA 4ZYLA 2EJTA 3AEUB 2UYQA 1F20A 4ECSA 3GVIA 4QSHA 4XWAA 1DUIA 2Q50A 1M6VA 2CB0A 1QXSA 3L7LA 4WCVA 2H0AA 5FI1B 3HJHA 4LRTB 3W06A 5CA1A 4Z7QB 4BLQA 4Y30A 2DQYA 4BVKA 4XTCS 3ISBA 3C43A 4EGAA 3RYHB 4UBNA 4JJFA 3GGOA 7ICUA 5BNZA 3R3SA 4PX9A 2HWXA 4EECA 2FWRA 4G0UA 1H66A 1O2DA 4YP0A 3V2UA 1U0HC 1UZLA 4Q7QA 3S27A 4AN0A 1QPZA 4PHPA 1Z39A 2GQ0A 4GEGA 3G9TA 3DOEA 4QJIA 2CBZA 3ORFA 3SQNA 3T3IA 3MOSA 1EIWA 3PNLA 3JQCA 2WJAA 3V3KA 3S5JA 2CVZA 3EGOA 1MX9A 1ZQMA 5CCXA 3ZIDA 2H1CA 4LYHA 1KMHA 1QRDA 1XE3A 4PAOA 1ISFA 5IT4A 2PGNA 2AOUB 2JA1A 4R1QA 4XUDA 3FG9A 3QGMA 1YACA 2I34A 4D56A 2ZU6A 2AXQA 4MGYR 4ZOCA 2CVHA 3ND7A 2JH8A 1N3BA 3DZBA 3QJ5A 3K4PA 1FJGB 5TF4A 4IIJA 4P83A 4WESA 5CYFA 3N53A 3ZY6A 3QLUC 4A9AA 2OP0A 2CJPA 2JCBA 4MIKA 1ODSA 3GCXA 1XTRA 5J2BA 3VO8A 2WM8A 3E23A 3KQNA 2KMLA 4RSHA 1J2YA 2ZJ5A 5TARA 2UVRA 2O1XA 2FKAA 3C1YA 3CPSA 1P62B 3WLOA 2ZT6A 2VPWA 3OTGA 2WWHA 4Z6FA 1NJZA 2EG5A 1SIJA 4GYKA 2JFUA 4KQKA 4B6RA 3KSAC 2BFOA 5KOYA 5EZ5A 5D85A 5TE9A 1TU4A 3SZ2A 5E1OA 5HVNA 1UFOA 1JE1A 5A6SA 3HJTA 5LQKA 3JYPA 3W77A 1MZPA 1ZD5A 1EWVA 1JDBC 1YUMA 3HXKA 1GL3A 3QU7A 1R9MA 3PC8A 3RAGA 3BD7A 3K0EA 7ICOA 1QHEA 2F1KA 1V2GA 1J0AA 4N5NA 2JAHA 2TS1A 4CU2A 4R1UA 1T2DA 1PT5A 4OXRA 4QZDA 4CG0A 5C53B 5JW6A 2QTHA 1YD7A 1NRXA 1Z8DA 4FCCA 1NTRA 3NYRA 4PG7A 1QVAA 4LTMA 4LXQA 4XGNA 5DB6A 2R8GA 1JIIA 4KWIA 4B3IA 1N2SA 3ABSB 3I04A 2EWMA 2VRBA 1GZ7A 2VK8A 4LTNA 3U7JA 1JR3E 3LCUA 3C45A 5FYQA 1YQQA 2RIRA 4V0NA 3TPZA 4COKA 1VMEA 1KKXA 3E58A 1NW8A 2FVYA 2Y27A 4OQNA 1RMQA 1GAXA 2DOKA 1Z4LA 4JV2A 1U81A 3AUTA 3G89A 5A4KA 1EK0A 5E0OA 4KTTE 1EFPB 1W1WA 1SY7A 1YI8A 3IH5A 4LCJA 1DDIA 4C0SA 1CY6A 3AKEA 5I01A 4U6PA 3NRCA 5CD1A 1RM0A 3FDIA 1M2VA 1QO0D 1CLEA 2Q4BA 4IPTA 4XZ3A 4CM4A 4NENA 2P0YA 3KU4A 4LCBA 4QUDA 2PUVA 1E98A 3C3YA 5KKAA 1AC5A 5I3ZA 4EL5A 2QX9A 2P1ZA 3ICVA 2DH5A 4PBSA 3TKLA 4W9RA 3VYWA 4D9KA 2VF5X 2GA8A 4YJ3F 4NVRA 3WJAA 4B7XA 1FOEB 4CQMB 4DSOA 5BUCA 5BVHA 4F4CA 5EP4A 4DV2B 5H9WA 2J0EA 2QPLA 3CV3A 3GCDA 3OZCA 4XM1A 3UO8B 4RSRA 4BNDA 4MVJM 5P8WA 1GL6A 3PJRA 1UHUA 2EIXA 1Z33A 2JH9A 4HX2A 4R7ZA 4Y9TA 4QBFA 3RVOA 1T29A 2C3PA 3UHPA 5G02A 3ZK7A 5HJ5A 2AW5A 4RNMA 3OAAD 1GRQA 1PWEA 2J6IA 4LZLA 1N25A 2NUPB 3QIAA 4N3BA 3P0RA 1RXVA 1RLOA 3VVLA 3WGGA 1K5OA 3UA4A 1ESEA 2G7ZA 3ZY4A 4TVBA 2KKPA 1F8GA 3M5PA 5EHGA 5HDBB 4DC1A 4OJLA 1C0LA 2XO7A 1PYDA 2P69A 3QXSA 4QBKA 4C3ZA 5CLIA 3VU3A 2ZYSA 3OQNA 2VXBA 1UBKS 2QN8A 4G1BA 4E5NA 2WG1A 5DIFA 5A9SA 1MO6A 5KU1A 1PZMA 3GZNA 3ZHSA 3FLMA 4KAXA 2IEDA 1E4YA 2N3ZA 2ZAOA 1L4YA 5LN1A 3AQ4A 4DQ0A 3Q85A 3RVJA 4QZAA 1KPHA 1P1CA 1QS0B 2PV0A 3LGAA 3AVYA 4OLAA 4D98A 4BUGA 1X38A 1SOVA 4FYYA 2AMFA 4HXEB 2G1KA 3QKIA 1VBFA 3DDSA 4R16A 5HS6A 5GGYA 5JXHA 1A72A 4IG4A 4E13A 4KLQA 3NHLA 5L3RA 5IK2A 1NW7A 3JZFA 3L92A 1VLMA 3BMCB 4YVFA 5KAIU 3W5IA 1G3UA 4JV0A 5K6AA 3P4XA 1T3LA 4DUYB 5B53A 4KXLA 3BSYA 5HJ2A 4TYYA 1P4RA 1OBOA 3H0CA 3KKMA 4YJ2B 3DL7A 1UBTS 3W8RA 3UWDA 5L7WA 4QM7A 1EGQA 4ZYUA 2J0VA 3EPJA 2VLBA 3VI3B 2BGLA 1ZI6A 4HLDA 4ITUA 4P93A 2CYAA 4OP1A 3ZKAA 5AK3A 2J6TA 1KYYA 3IB3A 3ITEA 4MVJG 4DVGA 3B3GA 3HFJA 3MB8A 1ZQOA 3BG5A 3RD5A 3MCVA 4YR2A 1EVYA 3JALB 1D2NA 2E21A 3B3AA 3PPWA 1EE9A 4OLHA 4RIHA 1LS6A 1T5IA 2BISA 3IIMA 4JGBA 2FEXA 3MTBA 3P94A 2JNWA 4YDRA 1FFAA 4H6VA 1N5MA 5IWAB 3V9PA 1UC8A 1JMKC 2EZTA 1W8IA 2ZQZA 3MELA 4B3RB 3HV0A 2NRVA 1ONPA 4D26A 3IJEB 5CVVA 3ADOA 1SXJE 4D9BA 4KFUA 5CVCA 4D42A 3IBSA 2WU1A 3DV0B 1RYZA 2EQBA 2W2LA 5DB7A 2NTVA 2V7EA 3DS8A 3FBTA 4OMFG 4A2WA 3EZNA 3AQIA 1EJ6A 5CVJA 4NLGA 2J7PA 4D57A 4MRMA 2H4ZA 3RTAA 5EQTA 5J4LA 2F4VB 2QWXA 1EX9A 4N8DA 3LCRA 1IHPA 4F4HA 1ANKA 1FA9A 2GERA 2Q3FA 1W0KD 2BZFA 2WG0A 4LQ4A 1NVBA 4F60A 1NUQA 4XB1A 2E4UA 2BFEB 3HWSA 2I2FA 4RGBA 5SYMA 5C7OO 4QXMA 1ZQQA 1Z7WA 2ZBRA 4EZIA 2IXFA 4EUSA 2PKQP 2C4NA 5BRAA 2G1JA 4NCJA 3VHLB 4KO1S 5CXUA 1RYSA 1KBQA 2XMZA 3ASVA 4JBNA 4PF1A 4Q4LA 3WV5A 4C4ZA 2WYIA 3ZU2A 1AGRA 1FQWA 2G5GX 5BOVA 2RHCA 3VZBA 4JLWA 4MMXB 4QZIA 3ZDYB 2GVNA 1CR2A 2F3RA 1Y7IA 2NZ8A 2XV1A 3DEEA 3LLSA 4J6EA 4DRXA 4HUQA 2GD6A 2V4MA 3C8MA 4IHKA 5HE8A 4HK4A 3V2GA 3WMWA 5KX5B 2KSQA 1YCFA 3QVGA 1D8YA 4RW0A 3DL0A 3R1IA 4ESEA 1PL0A 3K92A 1S2DA 4BKMA 2FY8A 1EUDA 2W9XA 3PHIA 4MV4A 1YTUA 2EYUA 4BB0A 3LC0A 1Q0PA 4EW1A 3K7EA 3A6LA 2MT9A 1A27A 4AZ0A 1C3OA 4KJXA 3C3CA 3EULA 4Q9HA 1B22A 4KPFC 3UT0A 2OFPA 4NMMA 3RRYA 4PYQA 5DO9A 3E18A 2A9FA 3GBPA 4GPTA 4KAJA 4BFYA 4J7CA 3H9BA 3UV6A 4XAQA 2HCTA 2NSHA 3DWIA 1E1RD 4JOBA 2XWPA 1OXJA 5H5JA 4M04A 4GE0A 1QH1B 2ECFA 1M2VB 1J2RA 1Y6GA 1A2BA 3KZMA 4XLZA 3L4BC 1XRQA 3LYHA 2PQ2A 4GD3Q 2BHRA 3L1KA 2BZGA 5EA2A 3G88A 2R3SA 4EG1A 4WLFA 2BR3A 4QODA 4YR9A 4JFAA 4MW9A 1R4ZA 5EJMA 4BRWA 5ALSA 4EY3A 4B2PA 1JIVA 1YCDA 1R74A 2AW3A 2R7LA 4GM4A 3KEQA 3SVZA 2K7FA 2OR3A 3ZE9A 4C0QC 3DAFA 5SZHB 4J0DA 2PNJA 3HR8A 4V1CI 2J3HA 4BRZA 5L1JA 2FQ1A 2O7VA 3CRVA 4FZVA 5IN4A 4JH0A 1GGFA 2CW5A 4OYHA 1OTHA 1ODJA 4JR1A 1H4QA 3TAQA 5TVGA 2FLVA 2YVUA 1L5RA 3RVRA 3MZ0A 4NYJQ 3UMVA 3BD9A 4PZEA 2P77A 3AP1A 4XQ0A 3I5XA 1TF5A 3GNLA 1ULUA 2Q07A 4PS1A 5I9SA 2IV2X 2I91A 3TB6A 1Q7CA 2DBVO 3AVWA 4D4MA 4P80A 3PS9A 2ROQA 4YRQA 3QVWA 2DUMA 3EF3A 3ODGA 3R09A 4GXRA 3KQUA 2J9RA 2CLKB 1FQJA 5HIMA 2OCXA 1OXUA 2OV8A 1QIIA 3PE4A 4O4LA 5ALIA 2V54A 4CCWA 1SBZA 4DCGA 3VBEA 4N03A 2GYVA 5FPHA 2AFHE 3M9OB 5A05A 4XUCA 3WICA 2ZCVA 4Q9JA 1ZQEA 3ASYA 2AI3A 3BL5A 2O8CA 1IU9A 1C1XB 1K8QA 2RHHA 2H57A 2PKCA 4IFEA 4RY8A 4Y1RB 1RZRD 5CVDA 5KAMA 1XHLA 4PFJA 4OMCA 3JQ8A 1IXZA 2ZXIA 3TL6A 2YFYA 3EMBA 3O91A 3MTGA 1CG6A 1PTJA 4OGWA 3FDZA 1I36A 3VTAA 1Z88A 3MWGA 5CR0A 1QKKA 1QR6A 2IDZA 1BROA