2Z2ZA

Crystal structure of unautoprocessed form of tk-subtilisin soaked by 10mm cacl2
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
395
structure length
389
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin precursor
publication title Four new crystal structures of Tk-subtilisin in unautoprocessed, autoprocessed and mature forms: insight into structural changes during maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 133
structure length 389
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2z2zA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2z2zA02
2SNIE 1Y4DE 3A3NB 2PWAA 3OSZA 2X8JB 5K7SA 1PJ8A 3BGOS 3DE3X 4YN3A 5ARDA 1T1GA 1BFKA 3EDYA 1SIBE 3SQOA 2TECE 5ARCA 3I37X 4WOCA 3TI7A 3T41A 5JXGA 4WOBA 3VHQA 1XF1A 2WWTA 3BPSP 3DE2X 1WVMA 3GCWA 3AJ8A 3P5BP 5JMOA 3HJRA 3A3NA 3PTLA 4C3UA 1Y1KE 3VV2B 4Z2AA 1PFGA 1C3LA 1SIUA 2W2MP 1AVTA 2Z2YB 3DVSX 1P7VA 2SECE 3A3PA 1YJCA 3WQBA 1OYOA 3P5BA 4OMCA 4JP8A 2Z2ZA 1R0RE 1GTG1 2QTWA 1BFUA 3F7MA 1KDZA 1SELA 1KDVA 2W2QP 4H6WA 1Y3FE 5FAXA 3VTAA 5FBZA 2ST1A 2ZWOA 2HD4A 3WIUA 1GT91 1NDQA 3TECE 3AFGA 2Z56A 3F49S 5AVJA 1OT5A 1SUEA 1T1EA 1TM3E 3LPAA 1AH2A 3UNXA 4OV6A 1GNVA 1SH7A 1GA6A 3F7OA 1JEAA 1MEEA 3DW1X 2Z30B 3DDZX 1S2NA 2W2PP 2WUVA 1P8JA 4DJ5X 4KPGA 1S01A 1HT3A 1EA7A 4C3VA 1SCAA 1Y48E 4NE9C 3CNQS 4BWGA 1BE8A 2SICE 2Z58B 1PTKA 1AF4A 2SBTA 1YJBA 3DE4X 4LVOA 3TI9A 2DUJA 2XTJP 2X8JA 1Y3CE 1TM1E 1KDYA 3L1KA 2B6NA 5ARBA 4MZDA 4DZTA 4J94A 1Y3DE 4H6VA 3DVQX 2ZRQA 1IAVA 4HVLA 3GT3A 4AKSA 2Z2YA 1A2QA 1AQNA 4K8RA 4NMXA 1SN7A 1SPBS 1TM5E 2P4EA 4CFYA 1BE6A 3CNQP 3BGOP 1SIOA 2WUWE 4ZARA 1CNMA 3EIFA 1R64A 2W2OA 4DWWA 1DBIA 2HPZA 3LXUX 5B1EA 3AJ9A 1SUDA 2W2PA 1GTL1 1SCNE 2PMWA 3VV2A 1Y33E 3ZXYA 4GI3A 4ZOQI 1ITPA 1MPTA 3Q5GA 3WIVA 2GKOA 4B5LA 1TO2E 2IY9A 1AV7A 1IC6A 2PRKA 3PRKE 1OYVA 2Z57A 4OV6B 2PKCA 2W2QA 3DW3X 4CG0A 1ZVKA 2PQ2A 4AKTA 1SCJB 4FONA 3WHIA 1WMDA 3Q40A 5CW1A 2W2MA 2DP4E 1SCJA 3DE5X 3QFHA 3GCXA 5FFNA 2V8BA 5AQEA 1T1IA 4HX2A 1NLUA 1TECE 3DE0X 3DE7X 3QTLA 1BH6A 3A3PB 4NE7A 1P7WA 4KB5A 1GCIA 1WMEA 2DQKA 2XTJA 5SICE 1S02A 3GCWP 4OMDA 1SVNA 1TK2A 1GNSA 5JXJA 3EE6A 1ZVJA 2PYZA 1LW6E 3I30X 1SUBA 4K8RB 4NMXB 2W2NP 1C9NA 2Z58A 2IXTA 2ID4A 5JXIA 1WSDA 1ST2A 1SBIA 1VSBA 1KE1A 1AU9A 1SCBA 1TO1E 2Z56B 1WMFA 1V6CA 2WV7A 1UBNA 2E1PA 1Q5PA 1TM7E 1GTJ1 3VSBA 1AK9A 1SCDA 1SBHA 3A3OB 3GT4A 1ST3A 5B1DA 1NDUA 1R6VA 2W2NA 2ZWPA 1EGQA 3CO0S 2PWBA 3QMPA 3SQOP 2ID8A 1SPBP 1KE2A 3H42A 2QTWB 2Z30A 2Z57B 3DVRX 3H42B 1TM4E 1SBTA 3I2YX 4H6XA 4I0WB 1SUAA 3VV3A 1BJRE 1CSEE 1SBCA 2W2OP 3DE1X 3ZXXA 1YJAA 1PEKE 5AVKA 3VYVA 3DWEX 1GA1A 1Y34E 2XRMA 4RYDA 1TMGE 3DE6X 4CFZA 2PMWB 1Y3BE 3SICE 1V5IB 4YN3B 1C9JA 1SUPA 3LPCA 3A3OA 3D43A 3DYBA 1C9MA 3BX1A 1V5IA 2G4VA 1YU6A 1SUCA 5I9SA 4M1ZA 1Y9ZA 1THMA 3GCXP 3BPSA 2Z2XA 1Y4AE 4LVNA 1GA4A 5AMXA 4KG7A 4NE9A 3I34X 3CO0P 1DUIA 3D9QX 5JXHA 1SBNE 3LPDA
chains in the Genus database with same CATH superfamily
2CJKA 1N32B 5TT1A 3DXXA 3QIVA 4D8UA 4NPHA 2ZB3A 1I94F 3ZTRA 3D4BA 1IY9A 1AGPA 1CIVA 1M7GA 3CXUA 1H2WA 3N0TA 1Y7TA 1NR5A 1VG0B 1H2XA 3AUJB 4QWCA 3KFLA 3MD3A 2J6TA 5LU8A 5KFUA 3D2AA 3UMMA 2B8JA 4D5EA 1ULRA 1XZCA 3LYHA 3E8OA 1Q1KA 1IKVA 4F4JA 1S1UB 4ZDIA 4LHZA 4MVYA 2OSRA 4OX7A 2Q6IA 3P45A 5G41A 4WBXC 4EKYA 2YKMA 4RSGA 2WOJA 3PL5A 4P9SA 3HFRA 2JIDA 3SQNA 3VNVA 3S8YA 1HKUA 3T9BA 1ZVMA 4ESHA 3N2EA 1JL3A 1XGKA 3R27A 4MR8A 4EDHA 1DLIA 1T9TA 4NEQA 4ZVKA 3OJXA 5DMHA 2GEBA 2XB8A 5E7IA 5F3TA 4KJXA 3G2JA 1YL5A 2XE8A 2MYNA 4O59O 3I6ZA 2HRTA 2HQSA 4MYRA 2VF7A 1KQFA 3AR3A 2Y0BB 3I5YA 4XM0A 3QEMA 3A36A 1J33A 2AWOA 2C0QA 4RIIA 3FKBA 2Z8XA 2VC1A 2PFKA 4U3JB 2JVKA 3OQIA 4CTAB 1TU3A 1L5YA 1P60A 2BXJA 3FCWA 1TKBA 4WLNA 1QKKA 3M89A 4CWBA 5B0DA 1V3TA 4RJVA 4DIUA 5TT0A 4AYXA 2NVBA 1ZMTA 4J0KA 2GOYA 4KE6A 3HF5A 2ZBQA 1S1MA 3L8FA 1B3RA 3CF0A 4YRPA 1RAFA 3HWRA 1G3IA 3O94A 3QVSA 4JODA 4UARA 3J7YU 3T7RA 3G2QA 2W6IA 3EQ9A 2KXNB 1NQ5A 2OE2A 2P8JA 3AEQA 2Z9BA 1HWLA 3G0HA 1SVDA 1ZD8A 3PO5A 2PMCA 2XMPA 3OT1A 1DO8A 1XEWX 1KDOA 4BYGA 4Z7NB 4RTRA 4KGVB 2P2CA 2R8GA 3PPIA 1IQZA 5FPSA 2PX8A 4ZZ0A 3HK2A 2H1FA 3TAPA 3VGTA 2QKYA 2PFSA 4X3OA 3DGPB 1WWKA 4WE3A 4BFSA 2H7XA 1YAHA 4TTQA 1D0IA 2HA4A 4B32A 3SF0A 4OB6A 4DDVA 5L7WA 1NBMA 2YJ6A 3W2FA 3LPEA 3D2WA 4N47A 5BQ3A 3QU5A 3TRFA 3WISA 1FXLA 2XSJB 3AB8A 3PPXA 2HJHA 2XB6A 5EZYF 2DUNA 4L8GA 1P72A 3HZGA 3TR0A 3NWGA 5ESRA 1FB5A 4AMBA 3BD9A 3MCSA 3QE4A 4V1CA 1JLFA 1S6QA 1JQKA 5ETJA 3PYGA 3UJ3X 4WK0B 2Q07A 4FPIA 1P5JA 4PNPA 5IM4A 3G79A 3DZ8A 1NCLA 2DGSA 2WSIA 1QQTA 1T36A 1YB6A 3K05A 2D1YA 3EDMA 1RRPA 2FYTA 3SDBA 4JI5J 1QTQA 5DLEA 1GCIA 5EPOA 3BQ2A 3DPSA 1S1WB 4X62B 3QYAA 4QICA 5IBCA 4WACA 4MUBA 2XB9A 3N74A 4NWIA 4E5MA 3PC3A 4IJQA 4XSGA 1ECFA 3SX4A 4BLVA 1DC8A 4DL7A 3KKOA 1CQPA 5ITSA 4M8IA 4ZYLA 1LW2B 3L9ZA 1ZJ5A 3TOSA 2WJPA 2RARA 2VL7A 3OBIA 1ENOA 4TMXA 1RUSA 1U1MA 1WXEA 2GYYA 4DV7F 1V7PC 4UREA 2QT0A 3NIWA 1JMYA 5DHAA 5HG0A 2PAAA 3G6WA 2DGUA 4H4OB 4BXOA 4M7OA 4DKJA 3UMBA 3N6NA 1MQ8B 3AFMA 4A23A 1PO6A 4P86A 2ZPUA 4LJ9A 2FC9A 1QJCA 3L6RA 4QGSA 2D41A 4JOBA 3FPHA 2PGCA 3PJFA 5I9BA 1S1XB 2OHFA 5IFKA 4U7DA 4D4MA 3UXHA 1L9XA 1J0XO 1PFKA 3DWEX 4FFMA 2D5BA 1U8ZA 1A7KA 4AJPA 1JMKC 2BSQA 2A8YA 3M30A 2ZTSA 2FLNA 5L9XA 2HSWA 2CFOA 2OL4A 2IU0A 1R9MA 1Y5MA 4CN8A 2WSMA 1RVDA 1E77A 1S6PA 1OX5A 3V1YA 2G77B 1LH0A 3PVZA 4MWTA 4D42A 5BXIA 2QG9B 5IF3A 4HYKA 1GZVA 5EWMA 2H1RA 1M83A 3KYDB 1MEJA 3MQFA 1R0WA 3IDAA 4JJGA 4LOLA 3ICQB 2MT9A 3LUHA 2QIOA 1Y8AA 3DZCA 3M34A 2QRHA 1KSGA 1QWOA 1QLWA 5A0YB 2BM8A 4AULA 3TD6A 3EWAA 3C2QA 3FBWA 5D6NA 4MQEA 4BGUA 1P2TA 4W99A 3V6KA 3ELDA 2EL7A 4YC7A 5A9SA 1O9BA 5BR8F 1Q53A 3M6VA 1HO3A 4MCIA 1JLMA 4MB2A 3FLBA 4RY0A 1FSGA 4ZANA 1S2GA 1F60B 2GNAA 1GTVA 4I1OA 3LZ6A 4ECAA 1SVMA 2QLJB 1TO6A 1LBIA 1ZNZA 2GZSA 3W05A 1TMMA 2OORA 5I45A 1GX5A 2ONKA 4JJ8A 3S2UA 4DIBA 3BORA 3QJPA 5G0SA 1U4OA 4Y2HA 3UY4A 1FIUA 1O96B 1A5SB 1N2ZA 2KFZA 3LF0A 1BAPA 2IIPA 2OK7A 1KRXA 3QVJA 4RWWA 4S24A 1YH3A 2PZKA 3O8WA 4YY3J 3VOAA 3DULA 4LHEA 2I34A 5IK2A 2PE5A 5KYWA 3UG7A 1MAHA 4PYIA 4DA8A 4HTIA 3EUNA 2ORWA 2HX1A 5FLEX 4ILEA 4NXMJ 4RGVA 4DLSA 3KR9A 2XOXA 1Y8ZA 1NDQA 1W9MA 1T2UA 4JUZA 3UAXA 1NXIA 4PBRA 1F0KA 1CJVA 2GFHA 3PDHA 1H72C 4OU4A 3C6KA 4NNOA 1I51B 3QW4B 4R2JA 2JJ2A 5FTKA 2P62A 2CJAA 2OHOA 5EWLA 2R1TA 5C7YA 1I7QB 4JL8A 5KYTA 3PXDA 3KPYA 4CLRB 4BWGA 2HY7A 4BVKA 5CT4A 2L3MA 1GRVA 3ECAA 4OL0A 3U19A 5HP4A 3K1AA 2VTVA 1AIPA 3IE2A 3Q7RA 2G63A 1Z8NA 4TXNA 1OFTA 2LE0A 3CNEA 1CDOA 1K0UA 1JXAA 1RRFA 3B5EA 3K96A 4YR0A 1SOUA 2CL0X 1FERA 4NECA 2W93A 1W85A 1ZIDA 1G4UR 2FRXA 5ALWA 5AK5A 1YDMA 3UHPA 3P9SA 1Z7BA 3VX3A 4BNDA 1UA0A 3G0BA 4D8TA 5C3UA 2CPIA 1S2MA 3AHJA 3CO9A 3SDZA 5HJ7A 5EXDA 4YDQA 4DL6A 4LRCA 1M6YA 4UDNA 1WOPA 1MQ9A 1QX3A 2CZ4A 3STYA 3DKPA 2ZM6J 3AJEA 2G5GX 1YMVA 4OHCA 1QP7A 3CJ3A 4PYKA 1AS2A 3WKBA 2QW0X 3OAAD 3CH7A 3ZS8A 3K70C 5I9NA 2QO3A 3GTYX 3HGTA 3JYQA 3PX4A 3VX4A 3D5MA 4NKRA 2VDMB 3HYLA 1TZBA 3GCXA 1L7VC 2YRWA 1LDNA 5CEEA 1SAYA 1BWQA 3DEHA 2I2CA 5IM0A 4NE7A 4OP1A 3TZHA 2PU5A 1P5RA 4EB8A 3AR6A 2GAJA 4PINA 1LEOA 5DN6D 2JCVA 3LK7A 3CW2C 1H7WA 3H19A 3V4ZA 4Q3CA 3UTCA 4UZSA 1YZKA 1PJ4A 2DH6A 4MROA 5FEUA 1BU8A 3IQZA 1OLXA 1PK7A 2GTPA 4LAFA 4DPUA 3ET6B 3EDRA 3B3GA 3IDSA 2H1LA 1TU0B 2QMWA 5F4ZA 3L8MA 2O2EA 3AODA 2B9EA 4GZLA 2PH3A 2RHSB 1OPIA 3ZZRA 2LNDA 4M5DA 5E1OA 3SQOP 3B5JA 1R16A 4OY3A 3CIMA 1KH3A 3QKTA 2Q5CA 9ABPA 1Z2EA 4YIKA 5K14A 2EKPA 2CSXA 2Q1WA 5G1PA 4CL2A 3JSMB 2WM2A 1Z6XA 2QU8A 4BVGA 2QORA 5E4JA 1V5IB 1F8UA 1QE1A 5CGQB 1W1WA 3PQ4A 2K8GA 4UEQA 3NBQA 2XKJE 5KFAA 5B53A 5I7WA 4M1WA 1VGRA 2R7LA 1TE2A 3VPHA 3A1UA 3EZLA 2WT8A 1JMVA 3NKFA 2E5WA 3ENVA 2X9NA 3UMFA 2D2FA 5I7SA 5CFNA 4TRJA 4NAUA 3K4PA 1DUIA 2AMFA 2G0CA 1JWAB 2RI6A 3SR4A 2HMSA 2Y0DA 4FF3A 1DG1G 1EEHA 4HYEA 3TLGA 2JEFA 2BHTA 3TI0A 2IIHA 3FTNA 2YN4A 3TOVA 1IY2A 2V1UA 2YJGA 4X66B 3WAGA 3QFRA 4QOJA 5CHEA 3TB6A 3V4MA 3AYZB 1PVDA 1ZBDA 2RC5A 5JD5A 4MMYB 3SE0A 1TB4A 3FI0A 1NZFA 4KXQA 2INGX 3GCWA 3P5BP 2O06A 1XCMA 4OFWA 4PAAA 2PUFA 2C4WA 4KN6A 1O4VA 1LX7A 3U0BA 2OGUA 5ALQA 2OBNA 1TDJA 2DNMA 3OR2A 3CDAA 1IHYA 3GRYA 1EMDA 4B4OA 4R8UB 5SZIA 3Q85A 1P81A 3NV7A 3NM6B 1Y5IB 2JGNA 4XQ9A 5LQJA 2CLCX 4M5GA 2IGTA 1JWWA 1S3IA 2YX4A 4X9XA 1QH1A 5AK0A 1COWD 2A3JA 3ZIAD 4ETIA 3MPUA 2BMVA 5TR9A 4BNZA 4D92A 4DR1B 3RO7A 3HJGA 4L95C 5LA6A 1VOTA 1VQ9S 3GK3A 3M3HA 3RRJA 3OI7A 2O1EA 4ZC1A 1IZ8A 3D0GE 1PUXA 1KWKA 4TY9A 4WFNQ 4WY8A 4L3KA 3AY7A 2GS9A 2XMCA 2QSFA 1HC7A 2P1RA 3DBVO 1EIWA 2J7KA 2QN6A 4DXLA 4IG9A 2POCA 4LPSA 1Z47A 1XERA 3ICLA 1JPUA 3JQ7B 2IX3A 1VDZA 5A6PA 4O2AF 5KX5F 4HDGA 4ICLA 1P0CA 5E3HA 3ILLA 4W5OA 4NH4A 4R0MA 4YAKA 2WE7A 3BE6A 3BDIA 3C6XA 4MYCA 2OZLA 3Q0IA 3BMQA 1EVEA 3P2OA 1QU3A 3P26A 1VQ6S 3GR1A 4MRRA 2ZSAA 3M6FA 1I2ZA 4XX0A 5HK8A 5ESDA 3T5TA 3H05A 4CMCA 3ZDFA 2R8OA 1LLQA 4QTYA 2MMCA 3AIKA 5F76A 3HCRA 1C1BB 3UVJB 3GA0A 2CKMA 2KKHA 3SD7A 2CE7A 2J7PA 3ZE8A 3SVTA 1D5WA 1NLFA 3VR6A 2QTLA 3HXLA 1VIMA 3OHMA 3WLMA 2L2QA 4CF7A 5L9NA 2IRXA 3TQHA 1NKSA 2ZU6A 3PR1A 2IT1A 3M2UA 2GQCA 4EGSA 3K9FC 3TMAA 3GEPA 4U7UD 4YAFA 4PYJA 1ULZA 4TKMA 4NICA 4DLTA 1MA3A 1I7SB 1AZTA 3BXGA 2OTLS 5AW0A 2B7CA 3IP9A 3D6FA 3QYPA 2JGKA 3IIKA 2XSJA 3D59A 2BT4A 4B33A 1W46A 3MWDB 2VDHA 1E2DA 4V3CA 3DL7A 3W4IA 2YTZA 2LU2A 3OSPA 3GGJA 4TXSA 3MA0A 1ULAA 4UZCA 3FTPA 3CURA 1HUQA 3HBFA 1NSKL 2NUAB 1M9NA 4ESOA 2E29A 4WBFA 2UXDJ 4W5TA 1CUFA 2R97A 1WB9A 3HFZB 4Z3DA 4RTMA 4KN8A 2IA5A 4ELVA 1SHJA 5EP1A 2C9ZA 4IG3B 2QPAA 4MIWA 3MGCA 1EWKA 3OVBA 1JHXA 1GDHA 1U1RA 3DZKA 3QFFA 1EP3B 3KG1A 4ID5B 4H6XA 4DEYA 3BM5A 4I0WB 3PP8A 1LVHA 3SIXA 5DWQA 3ZZYA 5CD4H 1LS1A 3SF8A 4B09A 3O3NB 3SQXA 1HEYA 2FDNA 2XNDA 4XFDA 1QCZA 5C25A 3KDAA 4PCQA 4JOUA 5K5MA 4MQMA 4CLKA 5GJVC 2H5EA 5EX0A 4ARIA 1ECLA 3ELUA 3ESDA 1XYGA 1JHDA 2GDJA 4UMEA 4ZOEA 3WXBA 4S1OA 5J2NA 2ECKA 2YXLA 4OBEA 2P7HA 2OFXA 2ANCA 4NU5A 4K05A 1NT2A 3DL0A 1KEUA 3TLCA 2X6QA 1XPUA 4MR8B 3HKCA 3OTEA 1VHTA 5CVDA 2NUTB 4KYVA 1H6DA 2I6XA 3U2QA 2WD8A 1BQ3A 4KXUA 2BELA 1QIGA 4DFJA 4B9EA 2GD2A 2QVYX 1UDAA 1KR5A 3Q2IA 2TECE 4DIMA 1MXHA 3NV9A 4OIFA 4D74A 3GMTA 3OPYB 1CX9B 3OBBA 4YJGA 1A2KC 3L5OA 2VCHA 4S1TA 3K5WA 1E0DA 1RRKA 1S1UA 3KLGB 2RHRA 2YYYA 4C8MA 1JHAA 4EZIA 2Y6VA 3AP3A 4O4IF 2P6TA 3C4QA 2O3JA 3D6MB 1JQDA 3POTB 5CCLA 4OIMA 2KM1A 4FQ8A 5CBKA 3KT0A 1TC2A 1NI3A 5EWGA 1UW9A 2BOAA 3WWZA 1IH8A 2HWYA 3B13B 3QPIA 4J7CA 5JNSA 2UXDF 4IRUB 1JJAA 1LBSA 3IWLA 3KKFA 4Q9KA 5C0OE 2ABYA 1D5CA 3ABZA 1E6KA 1EK2A 2VA9A 1SD1A 2O2HA 2ZM6F 4J2OA 4AJJA 2FEKA 1DIOB 4J0GA 3E9NA 4H17A 4GGOA 5CA1A 1T2FA 2F63A 5AVJA 4UAGA 3H11B 4J9RA 2MSSA 2CYCA 1KEVA 1AROP 1JX4A 4OX8A 4EVIA 3Q41A 4KAFA 3WAJA 4GKVA 3LHDA 1I1NA 2WWXA 3E22B 2WJWA 4V0MA 2WRMA 1LKZA 4UD2A 1R5BA 3CN7A 3ND9A 3FSYA 2ZC4A 3GAAA 2BMAA 2HDHA 4IO9Q 2BONA 4HMPA 5D51S 1XEAA 3RUCA 2WJIA 3VGVA 4N8NA 3QA9A 5JDIC 4RDCA 1IOVA 4IYJA 4RBUA 2C58A 2QI9C 2P9FA 1ZK3A 4RZSA 3TANA 4AICA 4KUHA 2ENUA 3NEJA 1VJWA 2ZE2A 3QZ8A 3GSDA 1Q78A 4DV2B 4IDAA 4YB5A 2VJDA 3SIWA 4EI7A 1VLOA 5ALEA 2OCBA 4UTNA 4O4JB 2XRYA 4CUZA 4U2BA 2QD4A 4XDHA 4D8WA 5CA1F 3NONA 3SEFA 4ENOA 3WBKA 1RWBA 4HDRA 1R43A 3QMQA 2VYVA 2WUGA 4NASA 3CR8A 5EJEA 2CNKA 4FMCF 1T2AA 1MROA 1HE1C 4CNQA 1CJSA 3GB0A 3FDJA 1OF1A 3HDGA 4Y3UA 2WRZA 5E0OA 2DBRA 3WLSA 1P7CA 2J3KA 3HYNA 2BGWA 1WMDA 1Q7GA 1RHJB 4O5AA 4PTLA 4DLBA 2BGRA 3S2ZA 1IKWA 3SIRA 1LPBB 3ZWVA 3OE5A 4EGLA 3B4MA 2RF2B 1NLUA 1KARA 2GZDA 2LP4A 3ZDRA 1GTEA 3TZCA 5LQAA 1PAUA 1G1XA 4J37A 3U9LA 4K4ZA 1KIMA 3N07A 5DXAA 4JJFA 3O83A 3C48A 3EZGA 4OK5A 3QU4A 2HGNA 1RABA 2DUWA 2OR3A 1G8GA 3O7MA 2Y0CA 1VSBA 5B0EA 3O8QA 4IIHA 5E33A 2ZTHA 2CDRA 2XZTB 4FDVA 2IOFA 1T4CB 4PGGA 3B5IA 5ITZB 2HHLA 4PSDA 2XBPA 5CLJA 4U2EA 3I0RB 3VH2A 3RJMA 1G9XA 2HO5A 2QYGA 2EWWA 1NF8A 4MQLA 1SL2A 3B1WA 4JP5A 1S4QA 3WGUA 3VC7A 3L3BA 4HXEB 1UUFA 3EB9A 4UQPA 2CMDA 4K3VA 1EE2A 1SBTA 5D5HA 4CM3A 2FX5A 4O5OA 4LR8A 1X7ZA 3DTTA 1XNQF 5JC8A 2AFIA 1CJKB 5JYBA 3WMEA 3FTDA 3ZU2A 5K8IA 4OZNA 1FYVA 1FTCA 3V5RA 5AE2A 4RLHA 2OJ3A 2F3JA 4MW7A 3FD8A 2A18A 1MB2A 4ZYXA 1RBAA 4IF6A 3URKA 3WWYA 2ZSFA 4PSAA 4JP2A 1O58A 3RVLA 2JLBA 5KTPA 5JNVA 3JVUA 3TJ8A 4CO1A 2B35A 4QYXA 2AN9A 1J20A 4FYHA 5B4VA 2D0PB 1XRPA 4ND6A 2WYWA 4FDFA 1N2JA 2OCGA 4FYXB 1XAHA 5FUWA 5LQMA 2PKEA 2P65A 3T0IA 2I33A 3BAFA 2WSLA 3WBZA 2J3LA 4MJLA 1PF7E 4AO7A 2HJVA 2HS4A 2WB4A 1TYBE 3OQOA 4J6EA 4I8IA 1G20E 4D57A 4ROSA 4JR2A 4TUYB 3DE3X 3O9VA 2EERA 9LDTA 4D3GA 5DM4A 4B7UA 2R6AA 4DARA 3ZE9A 1GPH1 1GZDA 2ZI4A 4CCHA 5A2QU 2UP1A 5F8HA 5HMXA 5L38A 2XNKA 3EEBA 1WB4A 3GONA 2YHIB 3U60B 2IYOA 1T9WA 4YMVA 3C16B 3AEUA 5JCOA 1YDEA 3EXFB 2FWIA 3G02A 5HRCA 3DLJA 4I6EA 2C5SA 4OLPA 3GLVA 2V5VA 1L3BA 2OCLA 1XJ5A 1GPLA 1OZ0A 4KFTA 4TU9A 3JCZA 2ZBCA 1XDZA 3N6RA 2G7MC 1HBUA 2WZBA 3VR6D 5BYJA 4GMFA 3DDIA 4RW7A 2WVEA 3OJLA 4X1KB 2CHQA 4HACB 4J5OA 4ZQEA 3BBBA 1YMQA 3MT8A 3VVMA 3B9BA 1EP4A 1L8OA 4EWTA 4XPIB 1EJ7L 1W7AA 4DV6F 5GGYA 3TWOA 2IEZA 1TP7A 4CT9A 1JB1A 3GEHA 4FFOA 2QTZA 4ER5A 1FWPA 1UPUA 1NIJA 4E4TA 1QK4A 4Q2LA 4ED7A 3KEMA 2BW7A 3HVIA 5KG1A 1AZWA 3H40A 4O4RA 1NIPA 4B3OB 2UXBF 5C9ZA 5FTJA 1PJLA 4XGNA 2CUNA 1Z4UA 4TX1A 2F3UA 4NEGA 2ZPAA 1I7DA 4U1RA 2G2ZA 2ZJ7A 3FAKA 4AZTA 4MKYA 1E1RD 1NG1A 2A5YB 2JIQA 4URHA 2VYQA 2Y8EA 2IBOA 4RW9B 2HLUA 1QE5A 2II6A 1CWUA 4DJAA 4FVCA 4J0JA 1ZR4A 2NLWA 3V4OA 3G2LA 4BLQA 4D81A 1TQLA 1E6LA 2H3HA 3MPUB 1EUZA 4I8XA 1TKTA 2JLAA 5ENDA 5K01A 1KMCA 2HNKA 3VHRA 2PMHA 1UVMA 1IBRA 4JGGA 1L1QA 5AXCA 1XR3A 4QOSA 1J1ZA 1FZQA 5CAEA 1HQ2A 4P84A 3REOA 2V96A 4X6YA 2W98A 5J2TA 4X7RA 4OXXA 3Q8YA 1DTSA 2HQFA 2CXRA 3DT8A 3BH6A 5K9FA 4MQBA 3ZD7A 1RAEA 2WU8A 4DR2F 4XW2A 2RGYA 1EIYB 1LDEA 1HYSB 1RBQA 2FFRA 2MMYA 4LVNP 4CLOB 2WYIA 3DXBA 1TAUA 3E0QA 1WUYA 3R5KA 4GH5A 4DLEA 3K2IA 3MMAA 1Q7TA 4GUDA 1BS1A 5J1SB 4ZK2A 3PW5A 2HIQA 4LI3X 2HADA 4Q4AB 3E8MA 1PG2A 2PEHA 3F8SA 4F04A 2Y66A 2WSSD 4ETXA 4BX0A 2B7BA 2YQZA 4TUYA 5HILA 1G5IA 1QUPA 2O67A 4ES3A 4JQSA 3AXKA 1WETA 3M4NA 4P36A 4DSTA 1VGVA 3BZWA 3UWPA 2NQ2C 2XIQA 1CUJA 1EFCA 1ODJA 4I1UA 1VJ5A 2BISA 4J75A 4RMGA 1YS4A 2IXEA 4CG2A 1TAHA 3Q4GA 4A6XA 3RR7A 5K6AA 3HCEA 1KZYC 1C1CA 3L3CA 1HW9A 2PS3A 3PWZA 1G20A 3UEOA 4OLBA 2VZ8A 3S44A 2GMHA 4LZOA 3WOHA 1Y3KA 3N75A 1W1IA 2AOVA 3LC1O 4WIQA 4LXGA 2UZ0A 1W4ZA 4OJGA 2GN1A 3EICA 4WEOA 1E9AA 4LBVA 2X0EA 4PU0A 1QDLB 4LF6B 3GR0A 4ZHQB 4LYDA 4PICA 4MV5A 1E59A 1JFVA 2HK8A 3QG5A 1N36J 1PT8A 3E2EA 4MKZA 4X64J 3H5NA 1N5VA 5A4JA 2MQ8A 4JBWA 5CK5A 1SKAA 1Z5OA 3AJDA 3UZUA 1UOQA 1Y63A 4LYEA 4M1TA 4PSKA 2FX2A 3BRWD 2VH1A 3NOCA 4JKYA 1UBSB 3NEPX 5L95A 4LC1A 2QAJA 3R0XA 5HE8A 5BURA 2ZIAA 1BMQB 2KI5A 4R9NA 1A72A 1RAIB 2BHSA 1WSAA 3FM9A 2X4LA 1PZXA 4G65A 3GDOA 5JSFA 2Q3HA 4NLTA 1E2EA 2BH2A 3EPRA 1ZONA 5CFPA 2E0IA 3VGUA 5F21A 3S28A 3IRXB 4FMDB 4KX5A 4CMEA 2QRVA 5LYYA 4LMAA 4E21A 1P9WA 1QAMA 1E2NA 5KS2A 4UNQA 2OLJA 1VLQA 4B87A 1RBYA 4PY2A 1W75A 5HZKA 1V1MA 5JAIA 4CLUA 3KJEA 1YFZA 4D8XA 4M1QA 3S1AB 3MJVA 4HFJA 1I5OB 1U0LA 5ETTA 3C6QA 4DLKA 3TVZA 3NP5A 3E51A 2GHTA 5JXGA 2XR1A 1FI4A 1ZUWA 2EP5A 2B56A 2YWEA 1UXOA 1E2HA 3WLPA 2H1WA 2WMDA 1IUPA 2HU7A 2RBGA 4W8OA 4LQLA 1TL1A 3X44A 3QO9B 2H7CA 5F7JA 4B82A 4IOCQ 4OJKA 2LRHA 4ZHRB 1EWRA 3OR2B 4M0KA 4XUEA 4A6DA 4L9AA 3A13A 4JI2J 2WUDA 1BWSA 3A6GA 4ED5A 3VZRA 2GA7A 3PQ6A 1JLGA 1N3YA 3G8BA 5LP1A 2VDRB 2FGCA 4IINA 1UZLA 1XZJA 2P30A 4CDRA 2CQ1A 3GZJA 2FZVA 4O4JA 2VTBA 3WQSB 3PFWO 3N0RA 3WL5A 3BKTA 3DV0B 3GVIA 1P1IA 1SB9A 2F55A 2I7TA 3FOWA 1J0DA 4M76B 3EBPA 1P0MA 3O4RA 3VGJA 2QS9A 1NA5A 3AILA 3N3AC 5B3JC 1TCAA 4UD6A 1LSJA 2P5YA 3AIIA 1KQNA 4O2LA 3RRFA 3B82A 1NO8A 1S9DA 3T1HJ 5A2QA 3FMVA 1VJRA 4E5KA 3BREA 3E9MA 4YR9A 1DI0A 4GQBA 4KSBA 2XUKA 2PZ8A 5BUCA 4S35A 1VRTA 4BGIA 3I5AA 5LOQA 3OFKA 1D7AA 3H3FA 1IXKA 1XLWA 4X7PA 1CS4B 5HJXA 2A7XA 4RHYA 3V8EA 1Z6QA 2R5NA 2OFHX 2X9QA 3MD9A 4YV1A 5JIBA 4EPVA 1ZRNA 1VXOA 1Q6ZA 1R27B 4MFBA 5EZQA 1AQNA 3GGDA 4U2GA 1QZZA 4OVKA 4CFYA 3C66A 2CLOB 3G49A 1BG6A 3C41J 2DJIA 1GN8A 2G9RA 4PYMA 4ZIWA 4R2WA 1DKPA 2H7VA 2GILA 1Z2OX 4ZAVA 3ZTYA 2CFXA 1NW6A 2XCPA 3P9YA 3L7UA 3NFRA 1R1DA 2A0YA 2V0NA 3R0JA 1A98A 3FKSD 3UTDA 3CU5A 1OBHA 4Y8VA 1MIOB 1YQTA 1KK0A 2HYIB 2CJBA 2DFTA 3GP8A 3OFND 1TCUA 4IHJA 1A8HA 3ZDDA 4D4KA 4KPFC 2NZ8A 3SLKA 1W19A 4DCPB 1IKYB 4EPRA 4M8NE 2XO7A 1GPJA 4OX6A 3WDMA 1QQAA 1EJ6A 3QWHA 2C4NA 3HP1A 5JTUA 4IWYA 3RC3A 3OIWA 2ZJBA 4LVOP 1PGZA 4KTVE 5CU7A 4WLFA 4ED3A 5DYYA 5JCPA 1TTHA 4I4TB 3C45A 1ITZA 4G81A 2QVBA 2JPDA 1UPMB 3QO9A 3AUSA 3R3YA 1NKEA 5L4LA 4DR3B 721PA 3GRKA 1XMXA 1WRBA 3EASA 4TQGA 3I4FA 2L42A 4FE7A 3RFUA 3LF2A 2O3UA 4RTLA 3NETA 1PNVA 1X39A 2JJMA 4N56A 1TA0A 2CNLA 2ZWPA 3EEQA 3ZU6A 2ILYA 4X84A 4ZCRA 1YK1A 1Z5GA 4CM2A 1ZC3A 1CB7A 5AXDA 1QRTA 2F59A 3AVXA 4DOMA 2ZSEA 4PS1A 1KPIA 3WC2A 1UP7A 4XIUA 2XXAB 1ZN8A 5AKKA 1F3VA 2EIXA 1GM5A 3V7NA 4PSVA 1YZYA 3OCWA 2WHYA 3FMIA 3K0CC 3D43A 5A3VA 3PQ8A 5DNWA 4L3WA 2V2QA 3JD0A 2L18A 5HKAA 4KVZA 2ECFA 5JS2A 1UDRA 4WNYA 2PA8D 4OJNA 3QBJA 4RJTA 2RH4A 1R50A 5E6UA 4MGIR 2OKGA 2ORED 3N6MA 4EG0A 1F9EA 1QYDA 3I34X 1E9DA 1UPPA 4HLDA 3AR4A 5E2BA 2EP7A 4PWYA 2A33A 2RH5A 4HI0E 1VMBA 4B83A 3R9IA 2XTZA 3MMSA 1GFWA 1CY2A 5KFJA 1OFGA 1R0YA 3BGSA 5DSTA 2DMRA 1JV2B 4D45A 1T1GA 4NBLA 3I6IA 1G4HA 4G1CA 1IRIA 3KM0A 3IDZA 1KO5A 3BD6A 3EXIB 3QVTA 3H1BA 2PWZA 2AQ8A 2EW1A 4K2XA 2IJGX 2XAUA 5CD4A 4E11A 3ANSA 1FYEA 3M9MB 3L04A 4Q15A 3KPUA 4D80A 4HEQA 4C7MA 2H5IB 3LDFA 2PXAA 1PYOB 3QE2A 4Y2PA 2CK3D 3IMQJ 4LXUA 5KT5A 1A9ZA 4WD3A 5K0SA 4OHMA 3OM8A 4YWJA 4AQYJ 2VBYA 1S9FA 1SBYA 3CRRA 4PYOA 2UUBB 2FOIA 1U7TA 1IVSA 3ZGNA 2GCFA 1WV0A 1KC3A 2FETA 3OMWA 1Y1RA 1Q7BA 2JLUA 4L0QA 1N5YB 3Q0AA 3P2IA 5K8VA 5K3SA 5LA6F 3RYTC 2F8EX 1T1EA 5LFAA 3DJFA 4IZ6A 4L6V3 4R7TA 2QDXA 2XNQA 1RP1A 1PEAA 3BK1A 4LNHA 3IKLA 4QDKA 2RB4A 5EQJB 5LQUA 1MEEA 4KGDA 3H9GA 1NQWA 3OD1A 5H9FK 2DGXA 1E1QA 1NR7A 4ECRA 2UZ1A 3KU1A 3VAYA 4NZMA 4PSCA 1RYSA 3PEHA 3Q9LA 2JFVA 1WPQA 3EN0A 1I3OB 1DV1A 2GFIA 1UMCB 2C03A 4MLPA 5H16A 1ZJJA 1YWGO 4QTUB 4HZIA 4JITA 5DX1A 1FDTA 3FC9A 4NS1A 4B7AA 2XUGA 1LWEB 2VK4A 3BRQA 1PR6A 3K0FA 3U1MA 3QSGA 3DM2A 1UODA 4B3SF 4JCOA 5J2PB 1RDRA 2HFJA 3QKRA 5TQ0B 4GECA 5G3ZA 4KVAA 4HEA6 3V1KA 3C98A 1LBTA 2DHCA 2BEUA 2EARA 1Y7HA 3U9TA 3ACDA 4CKWB 4CGZA 1J4AA 4WFBQ 3MAQA 1Q83A 4O2AA 2BFFA 5DYWA 2HHQA 3UJCA 1GKKA 2PMZD 3RSFA 1BGWA 5HUJA 1KMIY 1FRIA 1R0LA 4E2FA 1DJOA 1FJHA 2CLKB 3AG6A 5AJZA 1C8BA 3LAMA 2ZVDA 5HDBB 1KVSA 3VDNB 1GSHA 4ZPWR 2EYUA 4BLWA 4K88A 3C4VA 3G82A 1A9NB 3EHDA 1X9IA 4EQ6B 1PGJA 4NMMA 2NSCA 4C8NA 3IOCA 1NW5A 2LA6A 3DHYA 1FRLA 1ZOLA 2P78A 3H3XA 1GXLA 4R3UC 4TMTA 3I5MA 4NATA 2V8BA 1QGDA 4UBKA 1JLSA 3KB6A 3SBMA 1XRNA 3PX2A 3K6SA 3HHKA 3SP1A 4F2PA 4NBRA 4IGEA 2QLXA 3SZRA 1JR2A 5EKSA 3QOXA 5HGJA 1FL9A 2Q1XA 3PT5A 2OH2A 2YCLA 2RHLA 5HLFA 4TROA 3LUAA 3OJCA 2ZTUA 3OFGA 1KO8A 1TUGA 4NSNA 4CKWA 2E49A 1M74A 4NCXA 5BN4B 4NL4H 3QIPA 1TQ8A 4JHLA 3DOOA 2P4QA 1E0AA 1KE1A 1AGYA 1HHQA 4PR6A 5MAOA 5T4HA 3C74A 1MB3A 2IDKA 5HO4A 3FCEA 4FFWA 2I1WA 5AHOA 2B5OA 4G8CA 1IJKA 3R3WA 3LI2A 3HVUA 1XMJA 2V4ZA 5EP2A 5I7HA 1SBHA 2I7VA 2XWYA 2IELA 3E3XA 2I3ZA 3T4XA 5CBPA 1KVJA 2MLZA 1LRKA 3NWEA 3ICCA 4NCNA 4JQCA 4UFNA 2GAAA 1H98A 3M8RA 3KLFA 2Y92A 4UOCA 1LQTA 2E7VA 3W34A 2VUGA 4CEHB 1YKGA 3CX6A 5CFOA 1VJQA 4CLDA 2MY8A 3GX1A 3EULA 2X1BA 1Q1QA 3JSXA 3B70A 3E3OA 5EJAA 4N8OA 4FGZA 4PHTA 5J1PA 4DUZF 2LKZA 4RLEA 2O0KA 3P27A 1ZOPA 1L4HA 3V4IA 5K0NA 1KFJB 2W2TA 4EYIB 4GOXA 4JA2A 2BWJA 4DUZJ 3S0JA 3SEZA 3E05A 3QZUA 1E6VB 3NIBA 3COYA 1F20A 1OX4A 1GGVA 2ZFUA 5A2GA 3B6JA 4QU9A 4NZZA 2I8EA 1IONA 1FFDA 4UEWA 4URWR 2ZT6A 4YXWD 4C7QA 4MKGA 4NYPA 4IDQA 3ZQ4A 2CPDA 1XMOJ 3AESA 2VYCA 4MA5A 4DSJA 1Z6PA 5KHAA 2GO1A 3CW8X 1E5DA 4NIMA 4W8GA 5EWEA 4UBMA 4J0DA 4BP3A 4YRLA 2AJ4A 3FHLA 1I7PA 1HLDA 2JZNA 4C7OA 2JFOA 3Q1LA 1R8AA 2X1HA 1LDBA 1NU8A 1FEEA 4B17A 5BMVA 2BTEA 3RB4A 1WY5A 2CZ9A 4TLCA 4W6QA 1QLHA 4DMRA 5KAPA 4L16A 2R2RA 1REVA 1PVVA 3R7NA 2LKCA 4I7FB 1M2GA 3U39A 2P9ZA 2CBGA 1KEKA 3T6JA 2L9DA 3DNPA 4K6MA 1T9UA 3RUIA 1TQHA 5C46F 4GPEA 2QFJA 1CUUA 1FBTA 4M5KA 4RNOA 1W87A 4MV1A 5JH7A 1QVFR 3ZJYA 3H20A 4TTPA 3FDFA 4U7TB 1NM5C 3UJ9A 2MQOA 3EGXB 1QF9A 2AJ8A 4A0QA 2X4GA 3CC2S 4O02B 1K66A 1N2IA 5ALPA 3UWDA 4TXLA 2IZOA 1LLUA 1NBEB 2FSSA 3BHNA 4PTZA 3UN3A 2QMEA 3C6ZA 5AIAA 4H4MB 4IPTA 4URXR 2IHYA 4EUEA 1E2BA 1OYEA 2FWRA 4MUKA 4HPJB 2WT9A 5E4YA 4Q0BA 3LG2A 5LJIA 3S4YA 1UKBA 1EEXB 1CDDA 3Q1KA 3IPLA 3VSEA 4CM4B 1Q91A 1JDZA 4CO2A 421PA 2BYCA 1QHHA 4QXMA 3PXXA 3ZV3A 4DV5F 1VI5A 2YHSA 3HSJA 2O3SA 2V7QA 4BFWA 1YRHA 3WLFA 3CMMA 1JR6A 1N78A 3RU9A 3WYFA 4ND4A 4NMXA 2LIPA 5K0JA 1WKJA 4YAUA 1WDMA 2VDNB 2Q0SA 4P58A 1UC4B 1VBXA 1E9CA 3W5DA 7ABPA 3EXCX 5KYWB 3MMNA 3KJFB 2WSFC 3AV3A 5HTKA 1ZI9A 1Y00A 3MFYA 4RTKA 4EHFA 3GEIA 3RJTA 5JCJA 1RQGA 1N4AA 1X80B 1PR0A 3UD5A 4ZQFA 3OTDA 5AW1A 3B36A 1UEXC 5IV3A 3DM5A 2FN9A 4B6RA 3AQIA 1H2TZ 1WWHA 2BJ9A 2IDLA 3ONWA 3PR4A 4B9SA 3GV0A 1XCGB 3I2KA 4ZAYA 4P2SA 1TK5A 1Z18A 1M33A 5BUSA 4WXHA 2VWPA 1KYIA 3W04A 1WI6A 2OCPA 2QLTA 3JZAA 2W00A 3QTLA 3M8SA 1LWCB 2JGFA 3A11A 1P4SA 3OFHA 4B3RJ 1DTEA 5H68A 4C2BA 2J31A 2I2BA 1HTWA 4B4WA 4CODB 4ZVQB 3ZGXA 3U4HA 3GLFB 2C2KA 1JXVA 3ET4A 4O4HB 1RWOB 1BE1A 4LJYA 3U9SA 5CABA 3OFFA 1FDOA 5KSWB 2W7PA 1OI7A 3NCHA 1QF6A 2DRDA 1TLFA 1VYHA 4GL4A 1MMDA 1Q0UA 3JQEA 3I82A 3BXHA 1PDOA 5AQ1A 1DQAA 3NBPA 3LC0A 2H48A 4TPKA 2GEFA 2BRLA 1MWYA 3WLTA 4FS2A 1XQYA 3U13A 4LFBF 1VA5A 3KFVA 4FUTA 3CW2A 4KXYA 9ATCA 4X2BA 4BFTA 4Y0AA 3ILSA 3QJGA 4LF8J 3I87A 2OHXA 1CRZA 5KFBA 5AW5A 3DFEA 2ZT5A 3PUXA 5JMWA 1P61B 3IAM9 1GN9A 2H5LA 5TQJA 3OHAA 4XLZA 4X64B 5CYFA 4IGKA 1GKYA 4NWBA 3ENQA 1E6UA 2QSYA 1EFLA 3D1JA 3R0ZA 4D97A 1Y9ZA 2GCGA 3KLEA 3PHHA 2IITA 5C37A 4DQPA 2RHWA 4MV0A 2XKBA 4ZOAA 5JE8A 3CMES 2RK3A 5A6VA 5C1IA 2Q7OE 1GA4A 1ZAXA 2BR0A 2ZUWA 3CRNA 1ZD5A 2CPZA 2IUSA 2BVZA 2Q9AA 2VG7A 2ZRFA 4YQEA 4KV8B 1N5DA 5LQSA 3IG1A 2IUTA 5M2RA 3UN1A 2LKDA 2YNGA 1HBNB 3CNOA 3D3WA 3OECA 1EFTA 1M73E 4NFYA 3KD3A 1U1CA 3B6MA 3EVOA 1X80A 3RYLA 1K6JA 2CLDX 1LJUA 4OHPA 4QOFA 1E9SA 2BBEA 1YZTA 1P9NA 4IDEA 1SJ3P 4YDRA 1BEUB 1U3GA 4KFSA 1EQAA 4FILA 3PPWA 2WVDA 3CC8A 5I7AA 3PXGa 4AJOA 1H74A 3GJZA 6REQB 5CZVA 2ASVA 3GCZA 2OFFA 2H6EA 3PUYA 4TN5A 1B70B 3N0VA 3DFZA 1BJTA 2LYVA 1KQPA 1V9CA 5FT9A 2FZCB 2C2GA 5ALTA 3IDOA 2Z3WA 1NUTA 2VFRA 5IT9U 2Q6TA 4MFBB 3VAAA 4D2IA 1ZN7A 5EN4A 1U1PA 4AQ7A 4IDKB 4RV4A 3GDWA 4BMCA 4BO4A 2VP6A 2X1GA 3P9CA 2YV2A 3GZTB 4D1YA 4CDGA 2HBQA 4G5QA 1XK7A 1XEZA 3LT0A 1VKZA 1YQGA 1QS0A 4NEZA 2W43A 4FSXA 3LT2A 1IQPA 3E9QA 2PGIA 4NRDA 3GROA 3F7NA 2C98A 2B4TO 5HSPA 2APJA 4LHWA 1DQ9A 3PE6A 4H4MA 4MIAA 4WUVA 1Q8IA 1QC5B 3K35A 3QT8A 4OJ3A 1MC4A 3PNSA 4ESVA 2K3KA 5D15A 4OZ2A 5JPIA 1J5OB 3HNRA 2Z2LA 4DU7A 4B6OA 2ZR0A 3CRMA 1UT5A 2HIAA 2VH5R 1NT4A 3QPVA 4LNUA 1E4VA 3JD4A 2QY6A 3L41A 4Y6RA 2VSXA 1N5RA 4HSGA 5ARBA 1ULUA 1DE0A 4AK9A 4QPXA 3OTHA 4C0AC 4TXJA 1FFXA 3DVLA 1IAVA 4XB6B 1SC6A 5EMNA 2PSSA 4XQEA 5JTTA 3FLAA 2F17A 3BSYA 3OQJA 3QVOA 4YBRA 5DTMA 2R8HA 1UM9B 2EG1A 1W9HA 3ER6A 1GTL1 2BCJQ 1D2HA 3TL3A 3MZ0A 1HHSA 1Y33E 4HGZA 3D54D 5B2EA 4XJXA 4P6VF 5CAEB 1RPAA 1IUJA 3ELYA 2EZUA 3VDRA 1N7IA 3WC4A 1GGHA 4FX5A 1JQAA 4DYVA 1T3ZA 3D54A 3L7NA 5KNDD 3IXLA 2HMWA 1N0HA 3KDPA 4PX3A 5KOHB 3AVQA 2VG6A 2ZYRA 4NZ9A 2HUNA 3A1DA 5A0FA 2C1ZA 4KMRA 4KLRA 1L7BA 3NHYA 2NPFA 3GUUA 4HHEA 5FTMA 5EUMA 4ND7A 4WKRA 2R1VB 1WHSB 4Q4JA 3FYUA 2VTDA 5C1OA 5KQSA 3JAMA 4CM0A 1BNCA 3D3KA 1C0UA 2DO0A 2OENG 3S1AA 1HFEL 4Z6KA 4GKJB 2GPTA 1QD1A 4PWUA 2CPXA 3EE6A 3J7AC 9MHTA 4LXQA 3PX0A 1C1DA 2D5CA 3SSNA 3IAEA 5JZOA 4JV2A 2WFLA 2HLPA 3F3MA 1VZ2A 2G28A 1A5BB 1K27A 3KVYA 1S9GB 3AG5A 4E2WA 2PXXA 1NNSA 1RAHA 2K6GA 1BCRA 1VHDA 4FSHA 2J46A 2ZYSA 1VBZA 1J25A 4TLBA 2C7OA 4MYHA 4JI1J 4BN5A 4ENTA 4I55A 2BEJA 4F8RA 1PAEX 1FTNA 4HNQA 2B61A 2J3JA 4FFDA 4CTJA 4FYWA 3EF1A 2IFXA 7ADHA 2Z57B 4IIDA 2LXNA 2E9RX 3O4FA 4KN5A 3G2HA 1T4DA 1JG3A 4BNJA 3EHEA 1ZRMA 3UFXB 3RU2A 4W5NA 4RU2A 1M0WA 2GMLA 2ZSKA 2VDIA 1J24A 3IBCB 2JHPA 2E4XA 1NJ8A 5ILGA 5JNWA 1VPEA 5BVHA 1IU9A 4ZV4A 5DM6Q 3DN9A 3FPAA 4X24A 3K9LA 1XI2A 4ES2A 2GB4A 3EUFA 3GHYA 1PWEA 3G8CA 3DM2B 1M1GA 4ZPDA 4IDBA 4D6PA 1TR0A 4RHFA 1N32J 4UNIA 3CXCR 1ZJ6A 2BMWA 4RZHA 1R0ZA 4N9WA 5T3YA 1XTTA 5F9HA 1RCFA 2RU3A 1TZJA 1L5ZA 3E9CA 3V33A 3WLQA 2V7UA 1Z2CA 3VTIA 4G1UC 1F9AA 1TL7A 1SQ6A 4JK3A 3EVAA 2VJOA 2IRUA 4V02A 2VYFA 3AJ2A 4JFRA 3KKEA 2ROPA 5CB4A 5ALGA 1P6QA 1MX9A 3NHWA 2F65A 1P2VA 3OE1A 4I4NA 3NCQA 1E7WA 2NZ4A 2GVZB 3GRAA 4F5EA 1JDPA 2YUTA 2VHTA 5IX8A 5H83A 3TLYA 2VAVA 1ZL2A 4N7JA 2C77A 1YZNA 1PSWA 2BPOA 4FINA 4XVRA 1NZDA 1NASA 3K2YA 3OTBA 3BL6A 1TFRA 3TRKA 5HBGA 5KNCD 2GASA 3IUEA 2AX0A 4G8DA 1L8AA 5KDLA 1PQ4A 2LP4Y 2BUCA 3QPAA 2PRYA 1K98A 5KFIA 4B46A 2E7XA 3SYZA 2CXPA 1MC1A 4MPPA 3A8KA 4C6HA 4JP8A 4HF7A 2NZYA 2KB0A 3DEKA 1GXSB 1SELA 5BN4A 2JFYA 3R7SB 3R40A 4OJTA 1CQZA 3ETNA 2JLVA 4AQYF 1FP7A 1ZXLA 2WK4A 2ONCA 4AJ2A 4DCUA 2Z56A 3QUCA 2VPWB 4Z7QB 1TQDA 3EZXA 2I1QA 1F0XA 4FZRA 3TNFA 3AWDA 1F8FA 3I61A 1Y8CA 1RC8A 3R3XA 3GFQA 1LVGA 5DDPC 4MARA 3W9YA 2QSUA 5FR1A 2VRNA 1AD2A 2QUJA 1J23A 5AVOA 4BB0A 4FX2A 4QKQA 3TIGA 2H65B 1RQLA 2WBMA 1DEOA 4IX1A 1V8PA 4LVOA 2M0GB 1XZMA 2G3YA 3DQZA 5SZJA 4PR3A 3EG5A 5IVPA 2YWWA 1P19A 2I0XA 1UZMA 3A4YA 4C11B 3M6XA 4CDIA 1P29A 4GBGA 3FVYA 1HARA 4ZGBA 2WB2A 3P49B 4JB3A 4WPGA 4P32A 2MLYA 2NACA 2AX4A 4CO3A 2WNSA 4EMDA 4YCDA 3N7TA 1RGVA 1FLNA 1K97A 2Y0EA 3CISA 4RNHA 3GQCA 1DKQA 2J0QA 1KU0A 4R1LA 4CIBA 5FBWB 2I91A 3NNNA 1UPXA 2DR9A 1PZHA 1VP9A 2ZRHA 1E8DA 4JYAJ 5GIPE 2X9VA 3CDBA 2PGLA 3KE8A 4D4LA 4ERXA 4DHVA 4YEAA 1N1MA 3TW0A 2ZJAA 2G5TA 2BKNA 2NSDA 1XN4A 3V6DA 3WRVA 3AETB 1FFGB 1M6WA 2E6KA 5IWCA 1ZETA 5E9AA 1AS0A 2NUPA 1GKIA 4XPZA 4CUKA 2HJWA 1VP3A 2AI1A 1AQUA 3CPWR 1I01A 2Y99A 2NTYC 2CQIA 2V74B 1L3SA 3MM9B 5KFNA 3O8NA 4NDAA 1QPZA 3ZDBA 2IPLA 4UCWA 3BF8A 3I5BA 2AF3C 4KWTA 3WLAA 2X0KA 4F38A 2DGTA 4DCVA 3KUCA 1XMIA 2FW6A 5DTEA 2M88A 5CBPB 3GPIA 2PXHA 4A8KA 1FYDA 4NCJA 1Z08A 3F5SA 5DF1A 2ASEA 2AF6A 3RM3A 1WLYA 2ZI7A 3RKSA 5KNDA 1D8ZA 3SC6A 5TSDA 4AURA 4M87A 2HGSA 4G0UA 3CZ5A 4JJZA 5D5QA 2HFOA 5K2OA 4X65B 4HR2A 2PC6A 1XCPA 4ZJLA 2D3UA 4DSOA 1NK6A 3URMA 2W5UA 1H2RS 1N4DA 3D8TA 4K6GA 4RJ2A 2X0NA 1L5OA 4WYLA 2ISCA 2PVCA 3QEOA 1YQHA 4Y65A 3E4DA 4A27A 1LV5A 2P2NA 2A9RA 2PEBA 5FA5A 5ALMA 3NH6A 2WSCC 4P53A 4E5PA 2W4CA 1CJKA 3DOCA 3OLAA 2MSLA 1Y7PA 4QLAA 3FCHA 3QOWA 2Q45A 2YOFA 2I4NA 2QN3A 4RD1A 4G6VB 1S6PB 2FW8A 1P0QA 1LWEA 3K0SA 1HG1A 2G83A 4KSCA 1DXQA 3TEJA 5A4DA 3X1LB 2ZYTX 1Z4KA 2JHFA 3OQBA 3WRXC 4RSRA 4F4ZA 2HRUA 1NSPA 1I3OA 2ANBA 3MMBB 3L1UA 4LJ6A 3UK7A 4X45A 4YMTA 1MTOA 3PGA1 2QLFA 4XDYA 2XHEA 1KDRA 4EJMA 1U5BA 5KCMA 1GPYA 3ONFA 3T3NA 3BSAA 1SUQA 1SJ9A 4BO1A 1Z2DA 4HDNB 2ALJA 5JT1A 1N6OA 3H3JA 2ONYA 3SZ2A 5BN3A 2O2ZA 4RVSA 3G71S 1XF1A 1KI8A 4QVIA 3GBPA 5MFPA 1KFCB 3DNMA 2ETXA 1T6NA 4BO7A 2IQ5A 4Q45A 4K46A 1WC3A 5HS6A 3W9BA 3E58A 4B47A 2O3TA 2Y9PB 1OILA 4O3FA 1PCAA 3KUGA 4LWPA 4JT8A 4FYJA 1FW8A 2HTFA 1I51A 2EOAA 1E3EA 4W5HA 1IRXA 4EMBA 4N5DA 3BWYA 5F5XA 4GKBA 3VJKA 4LF6J 4YUXA 2AOUA 2KHDA 2XSZA 4D9GA 1GPKA 3TKLA 4LMRA 4QUHA 2D9PA 1NR1A 3HD1A 3IRUA 4U39A 1AN0A 3CJ4A 3PHEA 2MZ1A 3DBHB 1MV5A 1OKKD 4CRJA 2D7SA 3FSEA 3M4ZA 5AI4A 2PU7A 2YV3A 4K0KB 2JVOA 3ICPA 1ZHFA 1VHQA 4M0CA 4ZQIA 3RRKA 1GJRA 2O57A 3H7HB 3UN5A 5D01A 4C3OB 4QSHA 1JN0A 3PDNA 4Y2SA 4X7MA 2C88A 1PL8A 1LDGA 4DLRA 3REGA 2X1FA 4FNMA 4MS4A 4N8EA 2MIIA 2I62A 5CD9A 3PI7A 4CH1A 3MEEB 2QM8A 3UXMA 1SEPA 3ZWNA 3PF9A 3RBZA 3DDWA 1NK8A 1NPRA 4AMYA 4O63O 4F5YA 3OESA 1BQNA 3N9IA 4XD7D 4FYYB 1DOHA 2A1BA 4Q9JA 4JLMA 1GUDA 3P9IA 1EBBA 2AZDA 2VNHA 1GQQA 2R5FA 3DVQX 2D5AA 2RGNC 4R9UC 1Y9JA 3DBIA 1MUUA 2A0UA 4EPWA 2WZDA 4Q8FA 2O2CA 3E22A 1X87A 1Z7YA 4C9DA 1MAVA 2YJZA 3RTVA 3WLLA 1GR0A 3NTRA 4BNMA 4J3NA 5E3CA 4HYTA 2RKIB 1WOMA 4RIEA 4UU8A 5JYCA 3G23A 4NONA 2LFVA 4RH3A 3FMPB 3KL2A 5IFLA 3IG1B 2EL9A 1SUDA 3L06A 4WLEA 4GOMD 2MJUA 1H2VZ 2JIRA 1WCWA 1U1OA 3DCAA 3BSWA 4X8HA 2IY9A 4J9VA 2HJSA 3KVRA 1SKUA 3DEIA 2WABA 5BSTA 2WJ3A 1THTA 3CONA 2BGTA 3GEDA 2Q4EA 2VHCA 2NYRA 3COWA 4K9KA 2OBXA 3EIUA 2J5KA 1R0XA 2AB0A 2FJAB 4ZJOA 4RNMA 1RT1A 2WF7A 3A05A 5CFRA 5LM3A 2CYAA 3K6KA 3QKSB 4LFAJ 5JS8A 1LK0A 3BWMA 2DBBA 1UMDB 5CT8A 3VAGA 2GBLC 2QA5A 3HUDA 1B1CA 3KR1A 1TI7A 3ND8A 5L1JA 5EJ9A 3ITKA 3BAZA 3ROZA 2WTUA 1PBNA 4BV9A 2J0XA 3RBDA 1W5EA 3LHFA 3GZNA 3CF6R 3RC9A 1BEEA 1APBA 5DLPA 3PR5B 3EEIA 4C4TA 2JH3A 4BHQA 3OZSA 1DAHA 3GLHE 2Y0SD 4QTXA 4PIVA 4G0ZA 3QGIA 2Y1EA 3O6QA 2ZRCA 4UUQA 4HDMB 1GNQA 4I50B 1X0VA 3A4LA 2DSNA 1EXDA 4LTNA 4ZP1A 1IEQA 5B3LA 1G8SA 3BE8A 3FUUA 2XUDA 1U9YA 4CL0A 1TVKA 1E63A 5IP5A 2GN9A 3M6AA 1CCWA 3NLLA 5CH3A 5A02A 3A2MA 4DJDC 5SV2A 3DOLB 4EBEA 4PC1A 1FS5A 2XVYA 2HQGA 2QYTA 4YACA 1U0HA 3LCVB 3H0EA 1LGYA 1T24A 5SY4A 5IJZA 2VF8A 1ZD2P 4MVXA 5K3CA 4P8RA 5WRFA 1QFMA 3TSCA 3CVJA 3OE7A 3QQPA 1PQYA 2JAOA 3TJAA 4ETNA 3M8PB 1U1EA 3WKCA 4RETA 1Q82T 3UJHA 5IABA 1RXEA 2NSHA 2BY4A 3V1TC 1PYDA 4P1ZA 5K3FB 3TFWA 4R71A 2LCIA 3VNBA 4DY4A 4EAAA 1JNYA 1N2OA 3P9RA 1B6TA 1A6LA 2GPNA 1OSCA 3ZV5A 3R6WA 1Z4JA 2ZAMA 3MJTA 1SHLA 1KI7A 2I22A 1AXEA 1UXGA 1BX0A 2XGSA 1Y5RA 3KQYA 4CTMA 1H65A 4HAIA 4LOIA 1Y3AA 1TF7A 1DWUA 3WIEA 1DCFA 2FCRA 2KXFA 4YRFA 4DOZA 4DR4B 2M9MA 1QHEA 3DNFA 1V0JA 1XN1A 4DSLA 5A6WA 4KIJA 2Z2KA 3L8YA 4TVKA 1GNRA 1Z0UA 4XRRA 3RV3A 3O7WA 3VR4H 3AEZA 1DINA 2R79A 2MQPA 5EYPB 3OM9A 4LF4B 5FV4A 4KBYA 4LIPD 3PQCA 2VFVA 3KQPA 4V0LA 3D2LA 4RE5A 2C5AA 3M4XA 1JLRA 4FZ5A 3T6KA 3IE0A 3FFIB 3GQBA 4YT5A 4B85A 4B3MF 1UOOA 1DRKA 1Z35A 3N5BA 1FDAA 3CJSA 3OTOJ 2RCYA 2BRUA 5D5PA 1E69A 4WLUA 3QU2A 1VK3A 5ER6A 3K15A 5GVQA 3JS5A 3B3FA 4OHVA 2I3AA 2QMUA 5J43A 2EBUA 2XNRA 1F8GA 1L3IA 4DV4J 2BQRA 4EM6A 1XT6A 2VF4X 5KTTA 4R84A 2OGSA 3D2BA 4U8HA 5TPZA 5IWAF 2HEKA 3UV7A 1T9VA 4YUAA 1SV5A 2ZE8A 1N57A 5LLSA 3BB5A 4TKVA 1U7ZA 2MJLA 3PW4A 1IQ0A 3UQYS 2NUHA 4AYBD 3OX2A 2RD5C 5K20A 2VBCA 4IKAA 2XNSA 3ZZNA 1KH2A 3FGZA 1T2VA 1AF4A 4MIYA 2K5UA 2K1RA 4I6WA 1RADB 1R3DA 4C88A 3DD1A 1QFJA 4AD6A 5I9LA 4XWOA 2LR0A 4B4UA 5IT4A 1RM5A 5FNZA 3QF4A 4MV6A 4NV3A 1IHUA 1A9QA 2NO9A 4XLTA 4NCGB 3S01A 3EJWA 4L8LA 2Q99A 4MHOA 5FULA 1JKFA 1LBQA 2IOHA 1TTPB 1JQJC 2WG2A 3NEKA 1KK2A 3EVGA 4CMGA 1OFVA 2CKWA 3LSTA 3U7HB 4ED0A 1OXVA 5IXJA 1C1BA 1ZJWA 1M2KA 5LXRA 1R6YA 4GI3A 4KXMA 3PWSA 5BYSA 4LVCA 1T3LA 1WCXA 3EXHB 3GLQA 4OV6B 4KLCA 4J7XA 4J0FA 5F7ZA 1YBFA 1T9HA 2CQPA 3Q12A 4Q1BA 4K03A 3GLGB 1JECA 4EY7A 1TAQA 2W22A 3R3VA 2XY5A 4NYIQ 1MMLA 3MCMA 4KQ9A 3IYLW 4AJLA 4EY6A 5LZ9A 1VQMS 5FOVA 1WMSA 3IT2A 5CYMA 2ET6A 3K71B 3WSTA 1MZPA 1N9GA 3LS2A 3C5WP 4AMGA 4DRXA 2FG5A 5LMNF 2UVDA 5K09A 1F6BA 3O74A 3UO0A 3LDAA 4QASA 1NMQA 4RPHA 1N33F 1QHSA 3SMQA 2NV0A 2JOQA 1OCEA 1J27A 5E7QA 2GBGA 3ZTTA 1OQ6A 4PUOB 1YFLA 5CFZA 4EUKA 2IHKA 1N6RA 3M6UA 2G88A 4LF8F 1F3FA 4IJKA 4HAWA 2M6RA 4Q9DA 5SZTA 3EQ7A 4C0LA 4S1PA 1M8PA 1THGA 5CIYA 4CT0A 1QAIA 3IT3A 2IHBA 3VTKA 2VLBA 4URVR 1AK9A 2DNKA 4LIRA 1QK5A 1FMFA 4E6EA 2ZBRA 3FOFC 2F9DA 3J80A 4F0KA 2W2XA 4CIWA 3G1WA 3WZ2A 5C34B 3CT6A 4RVHA 3ZFVA 5GY7A 4TZ0A 2QOEA 3L6CA 4LSLA 4QQNA 1KDTA 2O6LA 1ECJA 1EA5A 3ZXXA 2VP9A 3TX8A 3ID6C 4J9PA 3OHBA 1QONA 2ASJA 1M75A 5T7BA 4G1FA 1WXFA 1P1FA 1EBFA 2OCKA 1AK1A 2V4UA 2IS4A 2PX6A 5INTA 1X4DA 2E21A 1NN0A 2CQHA 4YGYA 1VFNA 4RZ3A 2W4MA 5HXAA 3MCNA 2CQ0A 2R5WA 3TJMA 3L7JA 4GR5A 4CJXA 2XWSA 1MN7A 1SC9A 5B08A 1JR4A 2GVDA 2EG2A 1Y0BA 4L28A 4FD3A 1DELA 4FB5A 2X5NA 4OQLA 1IDN1 2DAPA 3MTIA 2P3LA 3R5SA 2CDRB 1IN8A 4Q39A 3ZHYA 3CO0P 4BCDA 1PC5A 5RUBA 5JUWA 2FK7A 3F7TA 2DRIA 1OYYA 2ZIFA 3QKSA 2R62A 5KWIA 5HKOA 1G63A 1K3TA 5CNJA 4LUCA 1AZSB 3SS7X 2OB2A 3KZNA 3ZC4A 3JTPA 1NN1A 4ENQA 3W63A 3M2RA 4N41A 1SVLA 1DGQA 2DH7A 2QR2A 4LZAA 5DULA 2C2NA 3NHRA 4NU0A 1PU2A 2HHHB 4QDUA 4ZCIA 1F5BA 4O0MA 2BKPA 5J2UF 1UFLA 4OGWA 2F1RA 3P7MA 1L4YA 4B8YA 3EBOA 3ZZ1A 3V8BA 3ENAA 1Q50A 4RYLA 3DVSX 3TZZA 3OU6A 3HA3A 3QEJA 3BDPA 2PA3A 4DIEA 3K5MA 1V5EA 1F9HA 1L0BA 1S96A 4JNCA 1L4MA 4L72A 4IJWA 3V2UA 3P5TL 4DQSA 1UJMA 1M90T 1Y89A 3UWKA 4V1CB 3BKWA 4RU9A 4O29A 1A4IA 2YJTD 4RPLA 3PUKA 3IVGA 5AOVA 1HDZA 4HKQA 3I9V9 2RGEA 4LK3A 4D8VA 4EA9A 1QMPA 2ATCA 1HQKA 2JIZD 3UNXA 2GPJA 4MWGA 4YRZA 1B42A 2F8SA 4NNPA 4RX6A 1URNA 4PQFA 5DO2A 4IG0A 5T6MA 2VUHB 3OX3A 5G0TA 2W2PP 2PH7A 1RKJA 2GLTA 5HUHA 4TTTS 2HQDA 1LPMA 5B58C 5HP1A 2DHDA 5LLTA 5DOVA 3T7JA 3N2LA 2OUKA 2OBYA 1IUOA 3G0DA 1NYQA 3F9CA 3SHFA 3IJ5A 5CT9A 4P98A 3DTVA 3FWKA 2F5GA 1RKQA 4QYIB 5IDYA 3I23A 4AF7A 3EFHA 3A4NA 4TV8F 1RK8A 4L51A 1NSYA 1IJEA 3Q98A 1KZHA 4WK3A 3AXTA 1L5QA 2R4UA 4TNOA 1VBNA 2GA8A 1R4AA 4KO8A 3DFKA 1Z16A 5CVEA 4I9HA 4URSA 4DDHA 3LHIA 3UUWA 1T3HA 1QV6A 1T5OA 5L3QA 3DFUA 4GU5A 1FKOB 1HE3A 1L8XA 3S1SA 2VF5X 3ORRA 1O96A 3G9UA 2FDRA 2RNEA 4UTPA 3EX7B 1EVQA 1E2KA 3BR9A 4OJ1A 3SAJA 4WXEA 1UKEA 1PKXA 1OW3B 3K8OE 3GFPA 4FGJA 3AFIA 5B1EA 5C1DA 2J4FA 3DLBA 4MJXA 1TFYA 4MLCA 1V3ZA 4CKZA 2G25A 4MVJH 3EQZA 4BO5A 4ZODA 2J0VA 2BAGA 5H3LA 1SXGA 1KAGA 4KRWA 2O0HA 1T8TA 3Q87B 3NGTA 2P79A 5CYPA 2AYZA 2EV9A 2MGZB 1LQUA 4DWIA 4JY7A 1YKFA 3N79A 3SQLA 1K9SA 3ME5A 2W8LA 3K7EA 3ZWXA 3ZJTA 3C14A 4IFBA 3UJPA 5CLFA 5IVKA 5HVNA 1NQXA 1RDFA 1MWZA 4C4RA 3WGQA 4UZFA 3IS3A 4R31A 1NYRA 3K57A 2CE2X 4QFBA 1TXGA 3CM0A 3MJDA 3F4BA 2O8NA 1WSRA 4QZVB 1N5SA 2MINA 3IPXA 5LNK1 1IBMJ 3I31A 1UXIA 3K1JA 4AI6A 4OMDA 2X5JO 3OZEA 4HTAA 4WADA 2P0YA 5HROA 5CRIA 1U94A 3SWWA 3I2HA 3QWFA 2JHGA 3WJ1A 5FDLB 3AI7A 3E2PA 3G2KA 1YR3A 3ZJ5A 2N47A 2RQMA 4Q2MA 3QEMB 2MSDB 1O1YA 4PQYA 1SCQA 4USMA 2E4WA 5HZMA 2QL7A 2NM0A 5D6OA 2NO4A 1R7RA 2CF5A 4JFAA 1LPPA 3TEFA 3L4JA 1YDHA 4YHHB 1T5IA 2ID8A 3WL6A 1KYWA 4KXLA 1NZ8A 2R48A 1AURA 3EXAA 4YB1P 4Y34A 2D3WA 5ECYA 2MKIA 4CLRA 5I5GA 5DGBA 1ZTTA 5FUXA 3O8BA 4PCAA 4PLVA 1NK0A 5EKDA 3U62A 4DN6A 4BAGA 4OKSA 4FBUA 2ZH7A 1A1VA 3MJ4A 2WYOA 3MS7A 4YIHA 1A04A 1VKHA 2E4ZA 3HSKA 3NDBB 1A1SA 3X1JA 1SCUA 2YXEA 2VXBA 3CZPA 4JQOA 3A31A 5J2UB 2O9JA 4OI1A 1CZLA 3GGCA 4HT3B 4KG7A 1LI4A 3RIMA 3D8SA 2DNLA 1RADA 2SNIE 1VE7A 4U96A 1BQ4A 4KRXA 4MT1A 1BQEA 1YJNS 3E7WA 2CDBA 5TF0A 1XXHE 1YASA 1M5UA 3D7RA 1CETA 1Q1GA 4DR6F 1YCFA 3GFOA 3NBKA 3QBCA 4RWZA 4KO0B 1H1TA 3ZIDA 2WIJA 4ES6A 2IHR1 1RXOB 3BPSP 2P9HA 3EPPA 5A2QY 2YRXA 1ECCA 2HHHF 4RA6B 4FXOA 1JJFA 3WNQA 1OAAA 1V4BA 1NJXA 4LGVA 1ZNWA 4MW1A 2YZ2A 5EUCA 1E1MA 2BN4A 3HDSA 3R9LA 2Q3BA 1KI2A 3DZHA 3DMRA 2D4AA 4LJLA 2RVJA 3UC9A 3HB9A 3WQBA 1V26A 4M88A 4M36A 2GZ3A 3E01A 2DR6A 2DPLA 5KG2A 2OXCA 3LALA 4USKA 4ITUA 1BGVA 2RAQA 4YH1A 3L4BC 1EE1A 5FWYA 4C22A 1F17A 4YFYA 2CN1A 4MV4A 1SO8A 4PGMA 1GT91 4Y1RA 1L6IA 2E37A 3ASUA 5BXQC 1B16A 1SIZA 4F04B 2Z8YM 1X15A 4Q48A 1KEEA 4IKPA 3G82C 2DWCA 1IOLA 1KVTA 2JIPA 4XI9A 1I9CA 1C3XA 1M8JA 3RKUA 1KZ6A 3RIHA 4EO7A 1F06A 1S01A 2I6FA 1W29A 3EIWA 1EINA 4HNHA 4NE9C 3CPSA 1CUSA 4DVJA 4LJ7A 4NI2A 2ZBEA 2DUJA 1N5IA 5HTOA 1EWQA 1FDVA 5FAKA 3RU0A 4C2MA 3HB0A 3BIWA 1QAJA 1XTVA 1V25A 3FVRA 5KFKA 2J9ZB 1JT9A 4B9VA 3AR5A 3CEPB 2O8CA 3NBXX 3Q3VA 1F7VA 3BN4A 1U3DA 1UWKA 3LP5A 5DM60 2CY0A 2QPTA 1LQ2A 3I6QA 2VG8A 4RENA 2XYRA 4JUIA 1DJ0A 1RLDA 4G3IA 3VR3D 4IIFA 4L73A 4I2NA 4TKZA 3TS1A 5EWFA 4RMIA 5AW4A 1NW8A 1JDTA 4PX9A 5A0TA 3KSBC 2MHNA 5KQGA 2ZH1A 4F26A 3UCGA 4JVMA 1FJ2A 1J8MF 5CH5A 4BLRA 3JSRA 1I94B 2V2ZA 1JS1X 1LFWA 4MS4B 4GI2A 3QXGA 3ZD8A 3ZCVA 2AH5A 1BKYA 1D2RA 2VASA 1RAIA 4LDJA 4OJHA 1Z8FA 4I50A 2P2CB 4MZXA 1EXNA 4LGCA 5KYGA 4Q9AA 2JJ8A 3FW1A 4N5NA 1JPVA 2DRAA 1E3TA 1TEHA 5BRNA 4BRSA 4FXVA 3N5KA 2G40A 3TRJA 5C8XA 1WTAA 4YWHA 2EG5A 1IFXA 1NVAA 3A6PC 1BE0A 1XQXA 2C2DA 2XTJA 3BZBA 4YT2A 3IPYA 1NJFA 4HEHA 3EZOA 3DAYA 3T9FA 2E5GA 1PVOA 3CR3C 5KWVA 2OAP1 4R8RA 2FR8A 3C7CB 4DR5B 4MUHA 4OQJA 1DT3A 4YALA 3C8YA 1CRPA 4WI1A 2LEAA 2FF5A 1B15A 4Z0TA 3QXJA 2KL8A 4UZEA 1QOQB 3R6LB 3GPBA 1P91A 2G6TA 4ZJZA 5CEFA 1T5SA 3EC7A 2ZI6A 2B4RO 4J90A 1TK9A 4CMKA 5DTQA 3QYYA 1SCDA 1E1CB 4PPDA 2AWNA 3OTWA 4KXNA 3MURP 2VWHA 1J5PA 2RMKA 4DRYA 4BO2A 4QDXA 3H9UA 2HBYA 3CO0S 5EJIA 3T1YB 1QMGA 4FF2A 5ECWA 5CP8A 3M6WA 3A14A 1Z4PX 3K9WA 1ZSNA 5DT9A 3T4PA 3RAEC 1ZN2A 1Y6GA 3TUPA 2Z98A 3JZDA 2K7KA 3AF4A 5KJ1A 3S8SA 1C8LA 1ZP6A 2RH8A 2R1UA 3IIEA 1HE2A 1CJUB 1VOMA 5AVKA 1WSWA 4EFKA 2BFPA 4GKKF 1SIWB 1CJCA 4KWHA 2O8BB 3ICOA 2W9AA 1XEFA 4G0YA 1BD4A 3IUPA 1ESNA 4L8VA 3RYHA 2WMNB 4OKIA 4PE5B 4WZBA 5JARA 1ATZA 4LQCA 1PK8A 4NPOA 4OJYA 3G96A 3GV8B 2XWXA 2IV7A 2WAXA 5KYXA 1OYDA 1EP1B 4FYYA 2BJDA 4AY2A 1VL2A 4WZAE 1BQNB 3F0TA 1BA3A 5F9FA 1HE4A 3SXPA 5REQA 1TK8A 4LF5F 2G1PA 1SXLA 3IP5A 5AVSA 4UBJA 4IFVA 4X97A 2YKMB 5ARCA 1J0EA 2X2OA 2DQZA 5TXGA 2ADBA 1UVNA 1NYLA 4BU0A 4ZAXA 3TOZA 2HLDD 1PDWA 3PHGA 1JG1A 3U0VA 2H54B 1KN6A 2VRWA 4KRYA 1O4WA 4CM6A 2WTEA 1S1CA 5KKCA 4WCFC 3VAFA 3KWJA 3GJSA 1FU8A 3OQNA 4RVGA 1VHIA 1Z5WA 2IY5B 5L40A 4ANCA 5C8ZA 2AR7A 1EHIA 4A9AA 1OZGA 2IEDA 4P3NA 4RTPA 3DRXA 2EW2A 1ATIA 4EAQA 3S6JA 4XDCA 1BCRB 2LLZA 3KTFA 1JQ5A 4AJKA 3ZLTA 1RTZA 1JTFA 3UT6A 4WCVA 5DDQC 4K0RA 2D7CA 4PEVA 3P9ZA 2GZ1A 4ZI2A 1VC6A 4OL9A 2Q2VA 1X38A 1IB0A 3RVJA 3HO1A 1ZVVA 4K4UA 1BVRA 3CFYA 3UDEA 3VR3A 3LW7A 5KFSA 5LT5A 3JTOA 1QK3A 5B36A 4I9GA 2XUAA 3CLRD 4NFHA 5JAOA 2HWWA 1AHNA 2NVWA 3A04A 2HA0A 1Q1EA 1X4AA 2NZJA 2VUSA 2XITA 2ZXFA 3AAWB 1MOPA 1VQKS 1NPYA 4BNGA 4F0JA 3TO8A 4RAOA 1HA1A 1XZEA 2GYWA 4RM2A 1B7FA 1FMTA 1OY6A 1LUAA 3GT3A 3NBYC 2V6AA 1I33A 4XXHA 2QL6A 2JARA 3TMYA 2ZUUA 2D13A 4IQFA 3MINA 5AP9A 4LSZA 4RMHA 5DGTA 3V8PA 1OXXK 3L1VA 3T4EA 1SIOA 4M9CA 4ZVFA 3MR7A 1GV1A 4XPEA 4HV4A 1LLCA 4LV6A 4R1SA 4F7DA 4XJSA 1JFFB 4G63A 1A5ZA 2B0GA 1PSDA 3V1LA 3T5GA 3Q5GA 4HDKB 1SL1A 4IIJB 2K7FA 3KXKA 1U2GA 4TN1A 5I7OA 3HPOA 1J39A 4YVFA 2XVZA 3UJNA 4RULA 2A9JA 1KDNA 2DHSA 2QTAA 4DLPA 2ARKA 5LP6C 2ZRAA 1GT8A 2KLBA 3RGGA 3BVPA 1RLMA 1D2MA 1ZXBA 3RB3A 4IUFA 3TZKA 1QIDA 5D85A 1YRBA 4J0CA 1VJTA 4ZKDA 1ZW6A 4MRAA 3FPBA 1MT0A 3B54A 6AT1B 3TQRA 2P2DA 3DWGA 3PKYA 3EYZA 1V45E 2RFLA 2V2VA 4M21A 1Z7GA 4NXNB 1X0FA 1KOHA 1PL7A 3T12A 4MUYA 4PCLA 4EYQA 1RZUA 2G0IA 3QLUA 4FOPA 3HHLC 3JZIA 4H4KC 2J76E 2R6HA 1V2HE 5NULA 4EKEA 2G36A 4WFKA 3I6BA 4H9GA 3G13A 1LDMA 2AL7A 4GOOD 4E31A 5BQPA 2B36A 3PTZA 3BB4A 2ZH6A 2EIHA 2WIBA 3ZD6A 1CS0A 1NOJA 2C2RA 3PDUA 3N2IA 4BKQA 2AR0A 3DKVA 5IJWA 2FZCA 5M7EA 1AKNA 1VB5A 4IJ5A 1O5IA 4UPDA 5LDHA 2RS2A 1KFBB 5KWJA 4ZIRA 5BP7A 2JLFA 1M8FA 4BKMA 1HI8A 1AUDA 2D1QA 1NDKA 3EFOB 5F73A 1XUOA 4BMZA 3ZBUA 1R6UA 1QIIA 4JKOA 3QKUA 3GPAA 4MV7A 1P9LA 2E89A 5JISA 1YBUA 2CJYA 1XMQF 2PUDA 3ETJA 2B4AA 1P1LA 1JSRA 1SUCA 4YHBA 1Z5NA 2I3DA 1QC5A 1T8PA 2ZQYA 1TL4A 1N2HA 2B20A 2CFIA 4B76A 4PHFA 4Q4LA 2BABA 3HSZA 1Z33A 2HCTA 3IQEA 4ZVPB 1HQCA 5CGZA 4QDTA 3HBJA 3BWXA 2KSQA 2H8GA 4LVNA 4EHDA 4I1VA 5AI9A 1FFSB 2QM0A 5ILOA 4M9SA 2KH9A 2QR5A 2DBQA 4WY5A 4C06A 5CVJA 2ACYA 1JLKA 2NU7A 2VHYA 3KQHA 4BNFA 1IXRC 1YSCA 1K3UB 2ZIWB 5EZ6B 1PR3A 3QHPA 1M34E 4F4KA 2JRCA 1PX0A 3DOHA 1ADCA 3M4YA 4WECA 2NZUG 2FA9A 1FDDA 1TVEA 4LF6F 3NDPA 2EEYA 2HLNA 1UAAA 4H7PA 4LF4F 3DEAA 1IM6A 3FDIA 3TQQA 1LXCA 4HWPA 5KFTA 4JL5A 4L3VA 2BW2A 3BXZA 4IKOA 4WZZA 4OAPA 3U37A 1DRWA 1U5BB 3VPBA 2BYTA 1PLLA 1Y8QB 3QNWA 4AUKA 1PJ3A 1D9XA 1OREA 3A1TA 5IWAJ 5HIJA 2GRUA 5J63A 4D56A 1ZRSA 3HCNA 3NBPB 2HQCA 1XMVA 2WF6A 4L4SA 3N9UC 4GSYA 2OECA 3HKEA 5F2OA 2PO4A 2XZPA 4Q3LA 3AY6A 5HZHA 3PB3A 3WRXA 4BQPA 5DEIA 3CSUA 4CTKA 4UTVA 2HRYA 3TSWA 3FNHA 3C8UA 1ZCAA 1ZGAA 1N2SA 2C2OA 3STTA 3OLYA 3QPBA 2XDWA 3SXLA 4YCLA 4GKAA 3RVNA 4HI1A 4QW8A 2OC9A 3CD7A 3KVOA 5BYAA 4DLUA 1Y7LA 1SOMA 3SR3A 4HN2A 1ZUNA 1EX9A 2WUVA 2J45A 2J5BA 2OPRA 2AUNA 1Y48E 3TIIA 4DV6J 4YK7A 2M32A 2C31A 4LHYA 521PA 4ZYUA 2QW8A 1P80A 2SBTA 5K0TA 1QRSA 3IDQA 3WICA 4XA8A 5EINA 3BXEA 5HA5A 4FOTA 2NCKL 4DWVA 3B9QA 3JSAA 1OXKB 3CYFA 3N4WA 4RL4A 4FWTA 2WIFA 4JLSA 4BBPA 2RJNA 2A1UB 1I6JA 2FMXA 1NF9A 3ZI7A 2BD0A 5H02A 1FX0B 2XQVA 4HQNA 1PWYE 4RL1A 3KKLA 3PCRB 1FK9A 1NI4B 3HCBA 1SMKA 5IC6A 4ICIA 3A4VA 3EMDA 5H9VA 1Q3KA 1ZI8A 4ER6A 3FG9A 1LK7A 1S10A 4V1Ak 3F6RA 1E2IA 2HPZA 3MCAA 2DR3A 2X8WA 4M5NA 4IXDA 1VDHA 4UM7A 3RGIA 1SD2A 4XYEA 3L6OO 3LRTA 4ARCA 4C0QC 4KQGA 4PYRA 3ISJA 3DDKA 3RRXA 1DNPA 4NHEA 3GLFA 1FFGA 4C8KA 3LUCA 4FKMA 3MBOA 1TC1A 5ETOA 1UZDA 4N7RA 1U3FA 4K0KJ 3EC2A 2PMBA 3MFHA 3MVEA 3ZCQA 4B8ZA 5IRCD 1K63A 1SU6A 1YBAA 3HR7A 2FJXA 1XKLA 2F1OA 2VDVE 3W8DA 2GHPA 4GNKA 3B6EA 3KQUA 1BWVA 2W71A 4QODA 5AJXA 2VSNA 1SC3A 1XL1A 4BQEA 2I9SA 1Z0FA 1JXMA 3MPVA 5E8RA 2AT1A 5HBMA 2XYHA 1YI0A 2XCSB 2XUIA 2OXEA 1I6LA 1IBCB 3M8YA 3F71A 1JKHB 3OZXA 3HN2A 1G6Q1 1Z22A 4C6TA 3NDIA 2FSIA 1SVKA 5BV8A 2H54A 3DLGB 2VIIA 2XXJA 2Q79A 3IAFA 5C35A 4Q03A 2XCLA 4ZAFA 4DYHA 9LDBA 2MKKA 4H7JA 3FGOA 5ER9A 4C8LA 2POKA 1IWOA 1ZYQA 3FOCA 2YWHA 2J6SA 2RKOA 1JYEA 3RTAA 2F3TA 5IASA 3HNPA 3US5A 3TRHA 5IT0A 4K6OA 1NMXA 5DDOC 5K20B 1VQLS 3DLEB 4A8YA 3JQBC 3IM9A 2FR1A 2DHGA 1U4SA 3CHYA 1K89A 3AVPA 2DF8A 4OXYA 1LNSA 3MUNA 1HI1A 2XI3A 2FVRA 1U2GC 1BJRE 2I3BA 2A1TR 2ZSDA 3OKAA 4D9JA 1EKXA 4AZVA 3UOAB 2WFMA 2AFHE 3AM3A 1PG5B 1EDDA 3BYPA 4Y2QA 2PMWB 3SICE 1JDNA 5LP6A 3BQ1A 1R2QA 2XB2D 1QCDA 3M3DA 4KXWA 3ILIA 2YHUA 5KTYA 2PKXA 2FI1A 1JG7A 1YQXA 1WC1A 4HG2A 2PSHA 3DGEC 3EISA 1AZLA 4S1VA 2YINC 1PD0A 1CJUA 2XWPA 3UFXA 4CHGA 2VPPA 4EPTA 4ZVEA 3LPDA 4CFSA 3OSZA 1TPZA 3W62A 4YP1A 2V6MA 3L92A 1FHTA