2FOQA

Human carbonic anhydrase ii complexed with two-prong inhibitors
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
Knots found
sequence length
257
structure length
256
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLEVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase 2
publication title Ultrahigh resolution crystal structures of human carbonic anhydrases I and II complexed with two-prong inhibitors reveal the molecular basis of high affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 74
structure length 256
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 2foqA00
4HEWA 3RZ7A 3KONA 1CCUA 3GZ0A 4RN4A 4Q49A 3QYKA 3KWAA 3HKUA 4FU5A 3P4VA 1CVDA 3IEOA 2WD2A 2FMZA 4MDMA 1JD0A 3KLDB 3W6IA 3RYJB 3M2ZA 5JEGB 4WW6A 3MNHA 3RJ7A 4WUPA 5FNMA 5DSQA 5EKHA 3KNEA 2EU3A 3FE4A 1KOQA 1BNUA 4QSJA 4XIWA 4QJXA 5FLOA 1FQRA 5E2NA 2AX2A 4ZWXA 4PXXA 1UGCA 5DSNA 2NXSA 4Q08A 3S76A 4KUVA 5IPZA 4KUWA 4TWLA 4QIYA 5E2KA 1JCZA 4FIKA 3RYXB 1ZH9A 1BNVA 1HEBA 5EH8A 1TTMA 1CAYA 3OKUA 4HT0A 3DV7A 5EHEA 4E4AA 1TG3A 4Q6DA 3V3JA 2NNGA 4Q8ZA 3DD8A 2HNCA 4BF1A 1THKA 1YDBA 1XQ0A 3Q31A 1H4NA 4IDRX 4M2VA 2CBDA 4QEFA 4YGLA 5JDVB 3S9TA 3DVBA 2GD8A 4ETQC 3R16A 1CIMA 3MDZA 5AMLA 3KS3A 2FOUA 1RAZA 1RJ5A 4Q8YA 3F8EA 4QJPA 4Q9YA 4Q06A 1FSRA 5FL5A 1RZDA 1Z93A 1G6VA 4MLXA 5AMGA 3BL1A 1YDCA 1G4JA 1CNJA 2CA2A 4QSBA 2H4NA 4YXUA 1BN3A 1HEAA 5DVXA 3OY0A 3MNAA 1YO1A 4Q83A 3TVOX 4KP5A 3RYZA 4FRCA 5FLTA 5FLSA 3NI5A 3M98A 4R5AA 3UYQA 4FL7A 4QJ0A 3U3AX 1G52A 1I9MA 3V3FA 1XEGA 1LUGA 1BZMA 3U47A 2FOVA 1ZNCA 1CNIA 3EFIA 1I91A 4JSSA 4YGFA 1CCTA 1CAZA 1CNXA 4N0XB 5FNJA 5JESB 2FOQA 3OILA 4WL4A 3N2PA 4Q8XA 5JG3B 2Q1BA 4G0CA 4K1QA 1MOOA 3PYKA 4MDLA 4PZHA 4UOVA 1G48A 2CABA 2NXTA 1BCDA 4LHIA 3VBDA 5DSOA 4R59A 1Z9YA 2FNKA 3P3HA 1DCAA 1TEUX 3S78B 4YGKA 3S77B 1RZEA 1TBTX 2X7SA 4MDGA 4Z0QA 2Q1QA 3ZNCA 2POUA 3P5AA 1CANA 2EZ7A 3M1QA 3DCCA 3M2XA 4DZ9A 1CNKA 5E2RA 5BYIA 2HL4A 1BNQA 1MUAA 4LP6A 1T9NA 3M2NA 3P3JA 4ITOA 4TWMA 1LGDA 4Q7PA 3M04A 1TEQX 3PO6A 3IGPA 3RZ8A 1I9QA 4QIZA 4QTLA 4CACA 3OIMA 4MO8A 5JEPB 1BNMA 1TH9A 1YO2A 4E3DA 3RGEA 3KIGA 2FW4A 3S75B 3DC9A 3M5EA 3IAIA 4K13A 4L5UA 3NJ9A 4E3GA 1CAMA 1OKMA 4E3HA 5DSPA 3MHMA 3T84A 3V3IB 4CNWA 3V5GA 1BV3A 1CNHA 3CA2A 4QSIA 5G01A 5EZTX 5CACA 1RZAA 3HKQA 4R5BA 5SZ2A 3MHOA 5DOHA 4Q7VA 2H15A 1YDDA 4CNRA 3TMJA 3DBUA 4DZ7A 1HCBA 3P55A 1CVHA 3W6HA 2HD6A 3N3JA 1I9NA 4ZWYA 3HLJA 1A42A 3MHIA 4RUXA 4CQ0A 5SZ1A 3FFPX 4G7AA 3T5UA 3DAZA 1G46A 4Q7WA 5BRVA 4Z1JA 3V7XA 5SZ3A 4QJMA 4JSZA 1CINA 1I8ZA 5BRWA 3S8XA 3CZVA 1ZFKA 2CBBA 4KNNA 5DSRA 3MNJA 5DSKA 5JQTA 3RZ1B 4QK3A 2O4ZA 3MMFA 3M1JA 5JEHB 1UGAA 1BNTA 2AW1A 5FLPA 1F2WA 3MWOA 1V9IC 5A25A 5FLRA 1ZGFA 3D93A 4K0SA 5EHVA 6CA2A 4JSWA 4M2WA 1BN1A 5CLUA 4Q09A 5FNHA 2NNOA 4KNMA 4JS6A 4CNVA 4Z1NA 1CRMA 1OKNA 3U45X 2EU2A 4ZWZA 2NNVA 1CRAA 3K34A 1RZBA 3IBIA 4COQA 3ML5A 4M2UA 4X5SA 3D9ZA 5JGSB 5G0BA 4ZX0A 1IF7A 3M96A 1CVEA 3T5ZA 3DVDA 1HEDA 1RZCA 2NWPA 4PYYA 3K2FA 4ZAOA 5G03A 4KAPA 3M67A 4BCWA 1TE3X 5FL6A 5FDIA 2WEGA 4XE1A 5E2MA 3N0NA 2OSFA 4QJWA 4Y0JA 1CALA 3S72B 1CAIA 3MNKA 3M14A 1UGEA 5EKJA 4RIVA 5CA2A 5FLQA 3V3GB 2WEHA 4FVOA 4YGJA 1G1DA 2HFWA 4WUQA 5L6KA 1ZSBA 1EOUA 2FNNA 2HKKA 4RH2A 4QJOA 1AVNA 1OKLA 4Q99A 2FOYA 5CJFA 1V9EA 1KWQA 1JV0A 1CAHA 1HUHA 4L5VA 2NNSA 4YHAA 3IBUA 3KOIA 3D92A 2GEHA 1ZFQA 1CVAA 4JSAA 4KNJA 2ILIA 4Q6EA 4E5QA 4YX4A 3SBHA 3EFTA 3T82A 1HVAA 1CNYA 2X7TA 3SAPA 9CA2A 1CNWA 1BNNA 2QP6A 5L3OA 3JXFA 7CA2A 1CILA 2NMXA 1CAJA 1TB0X 1G54A 2NN7A 4LU3A 4KV0A 5FNIA 1UGGA 1CAKA 1UGBA 2NWZA 1G4OA 3CAJA 4RFDA 5EOIA 1HUGA 3RYYA 5FNLA 1G0EA 3JXGA 4L5WA 1KWRA 4MTYA 3SAXA 3MNIA 3S71B 3OYQA 3M3XA 3BL0A 3BETA 3TVNX 5JGTB 4MLTA 1CAOA 3ML2A 4E9OX 3JXHC 3T83A 3V3HB 3MHCA 3S97A 5HPJA 5FNKA 5EKMA 3NB5A 1HCAA 4XIXA 1LZVA 5SZ4A 2WEOA 2VVBX 2W2JA 4RUZA 1DMXA 4Q07A 3RG3A 4WW8A 4QY3A 4Q7SA 1CVBA 1FR7A 1IF5A 5DOGA 1CVFA 1ZSAA 3LXEA 2NWYA 3C7PA 4E3FA 1G53A 4YWPA 4WR7A 3MHLA 4N16A 4Q87A 3OIKA 2NXRA 3V2MA 1ZSCA 4KNIA 4Q81A 1I9OA 1I90A 1FR4A 3IBLA 5BRUA 4YVYA 4ITPA 5SZ6A 4KUYA 5FL4A 4K0ZA 2FNMA 1YO0A 2QOAA 3M5TA 1KOPA 5FDCA 2WD3A 5DSJA 2NWOA 3RG4A 1CZMA 3PJJA 5SZ0A 1FSQA 1IF8A 3RYVB 3RZ0B 3N4BA 4HU1A 4PQ7A 3SBIA 4ZWIA 1UGDA 4YXOA 4RUYA 3F7UA 1HECA 4YGNA 1RJ6A 3P44A 5E28A 3M5SA 4FPTA 5AMDA 1ZGEA 5SZ5A 1CNCA 2IT4A 3DC3A 4YYTA 5DSIA 1UGFA 3HS4A 3UYNA 3P5LA 3L14A 5G0CA 4HT2A 3U7CA 4HBAA 5JG5B 1CA2A 1G3ZA 1DMYA 1G45A 4RFCA 1H9QA 3OYSA 5DSMA 4M2RA 3RLDA 3P58A 3HKNA 3HKTA 5DRSA 2X7UA 2Q38A 1FQMA 3DVCA 4Z1EA 3M2YA 3IBNA 3R17B 2FMGA 4HEZA 3OKVA 1OQ5A 3D0NA 1AM6A 3F4XA 1H9NA 1I9PA 1LG5A 3DCWA 5C8IA 2WEJA 1CNBA 3KOKA 5EIJA 1LG6A 1FQLA 3DA2A 4ZX1A 3FW3A 2VVAX 3M1KA 4K0TA 5SZ7A 2HOCA 1IF4A 1CVCA 1FLJA 5E5RA 1TG9A 3MZCA 1IF6A 1I9LA 3V2JA 1XPZA 4QK2A 1BNWA 4CNXA 3MNUA 1AZMA 5JQ0A 2CBCA 5EH7A 3DD0A 5DSLA 1Z97A 2FOSA 5E5UA 1RAYA 3HFPA 3M40A 1FQNA 3S74B 2ABEA 4FVNA 2POWA 1FSNA 1ZE8A 5J8ZA 2CBAA 3ZP9A 4Q0LA 1DCBA 4Q90A 4RIUA 3MYQA 3T85A 4Z1KA 2F14A 4KP8A 1YDAA 5BNLA 1CCSA 2QO8A 3K7KA 1BICA 1IF9A 1URTA 2CBEA 3B1BA 3KKXA 1KEQA 4C3TA 4XFWA 2POVA 8CA2A 4HF3A 12CAA 4PYXA 4BF6A 5A6HA 2ZNCA 3F7BA 4HEYA 4Q78A 5LMDA 4QSAA 4CA2A 1XEVA 4QK1A 3S73B 1BN4A 4IWZA 3D8WA 5EHWA 3CYUA 2NN1A 5FNGA 4ILXA 4YXIA 1Y7WA 4E49A 4XZ5A 1CNGA 5E2SA 5EH5A 1G0FA 3B4FA 2OSMA 3M1WA 4GL1X 1CA3A 1J9WA 3RZ5A 3DCSA
chains in the Genus database with same CATH superfamily
4HEWA 3RZ7A 3KONA 1CCUA 3GZ0A 4RN4A 4Q49A 3QYKA 3KWAA 3HKUA 4FU5A 3P4VA 1CVDA 3IEOA 2WD2A 2FMZA 4MDMA 1JD0A 3KLDB 3W6IA 3RYJB 3M2ZA 5JEGB 4WW6A 3MNHA 3RJ7A 4WUPA 5FNMA 5DSQA 5EKHA 3KNEA 2EU3A 3FE4A 1KOQA 1BNUA 4QSJA 4XIWA 4QJXA 5FLOA 1FQRA 5E2NA 2AX2A 4ZWXA 4PXXA 1UGCA 5DSNA 2NXSA 4Q08A 3S76A 4KUVA 5IPZA 4KUWA 4TWLA 4QIYA 5E2KA 1JCZA 4FIKA 3RYXB 1ZH9A 1BNVA 1HEBA 5EH8A 1TTMA 1CAYA 3OKUA 4HT0A 3DV7A 5EHEA 4E4AA 1TG3A 4Q6DA 3V3JA 2NNGA 4Q8ZA 3DD8A 2HNCA 4BF1A 1THKA 1YDBA 1XQ0A 3Q31A 1H4NA 4IDRX 4M2VA 2CBDA 4QEFA 4YGLA 5JDVB 3S9TA 3DVBA 2GD8A 4ETQC 3R16A 1CIMA 3MDZA 5AMLA 3KS3A 2FOUA 1RAZA 1RJ5A 4Q8YA 3F8EA 4QJPA 4Q9YA 4Q06A 1FSRA 5FL5A 1RZDA 1Z93A 1G6VA 4MLXA 5AMGA 3BL1A 1YDCA 1G4JA 1CNJA 2CA2A 4QSBA 2H4NA 4YXUA 1BN3A 1HEAA 5DVXA 3OY0A 3MNAA 1YO1A 4Q83A 3TVOX 4KP5A 3RYZA 4FRCA 5FLTA 5FLSA 3NI5A 3M98A 4R5AA 3UYQA 4FL7A 4QJ0A 3U3AX 1G52A 1I9MA 3V3FA 1XEGA 1LUGA 1BZMA 3U47A 2FOVA 1ZNCA 1CNIA 3EFIA 1I91A 4JSSA 4YGFA 1CCTA 1CAZA 1CNXA 4N0XB 5FNJA 5JESB 2FOQA 3OILA 4WL4A 3N2PA 4Q8XA 5JG3B 2Q1BA 4G0CA 4K1QA 1MOOA 3PYKA 4MDLA 4PZHA 4UOVA 1G48A 2CABA 2NXTA 1BCDA 4LHIA 3VBDA 5DSOA 4R59A 1Z9YA 2FNKA 3P3HA 1DCAA 1TEUX 3S78B 4YGKA 3S77B 1RZEA 1TBTX 2X7SA 4MDGA 4Z0QA 2Q1QA 3ZNCA 2POUA 3P5AA 1CANA 2EZ7A 3M1QA 3DCCA 3M2XA 4DZ9A 1CNKA 5E2RA 5BYIA 2HL4A 1BNQA 1MUAA 4LP6A 1T9NA 3M2NA 3P3JA 4ITOA 4TWMA 1LGDA 4Q7PA 3M04A 1TEQX 3PO6A 3IGPA 3RZ8A 1I9QA 4QIZA 4QTLA 4CACA 3OIMA 4MO8A 5JEPB 1BNMA 1TH9A 1YO2A 4E3DA 3RGEA 3KIGA 2FW4A 3S75B 3DC9A 3M5EA 3IAIA 4K13A 4L5UA 3NJ9A 4E3GA 1CAMA 1OKMA 4E3HA 5DSPA 3MHMA 3T84A 3V3IB 4CNWA 3V5GA 1BV3A 1CNHA 3CA2A 4QSIA 5G01A 5EZTX 5CACA 1RZAA 3HKQA 4R5BA 5SZ2A 3MHOA 5DOHA 4Q7VA 2H15A 1YDDA 4CNRA 3TMJA 3DBUA 4DZ7A 1HCBA 3P55A 1CVHA 3W6HA 2HD6A 3N3JA 1I9NA 4ZWYA 3HLJA 1A42A 3MHIA 4RUXA 4CQ0A 5SZ1A 3FFPX 4G7AA 3T5UA 3DAZA 1G46A 4Q7WA 5BRVA 4Z1JA 3V7XA 5SZ3A 4QJMA 4JSZA 1CINA 1I8ZA 5BRWA 3S8XA 3CZVA 1ZFKA 2CBBA 4KNNA 5DSRA 3MNJA 5DSKA 5JQTA 3RZ1B 4QK3A 2O4ZA 3MMFA 3M1JA 5JEHB 1UGAA 1BNTA 2AW1A 5FLPA 1F2WA 3MWOA 1V9IC 5A25A 5FLRA 1ZGFA 3D93A 4K0SA 5EHVA 6CA2A 4JSWA 4M2WA 1BN1A 5CLUA 4Q09A 5FNHA 2NNOA 4KNMA 4JS6A 4CNVA 4Z1NA 1CRMA 1OKNA 3U45X 2EU2A 4ZWZA 2NNVA 1CRAA 3K34A 1RZBA 3IBIA 4COQA 3ML5A 4M2UA 4X5SA 3D9ZA 5JGSB 5G0BA 4ZX0A 1IF7A 3M96A 1CVEA 3T5ZA 3DVDA 1HEDA 1RZCA 2NWPA 4PYYA 3K2FA 4ZAOA 5G03A 4KAPA 3M67A 4BCWA 1TE3X 5FL6A 5FDIA 2WEGA 4XE1A 5E2MA 3N0NA 2OSFA 4QJWA 4Y0JA 1CALA 3S72B 1CAIA 3MNKA 3M14A 1UGEA 5EKJA 4RIVA 5CA2A 5FLQA 3V3GB 2WEHA 4FVOA 4YGJA 1G1DA 2HFWA 4WUQA 5L6KA 1ZSBA 1EOUA 2FNNA 2HKKA 4RH2A 4QJOA 1AVNA 1OKLA 4Q99A 2FOYA 5CJFA 1V9EA 1KWQA 1JV0A 1CAHA 1HUHA 4L5VA 2NNSA 4YHAA 3IBUA 3KOIA 3D92A 2GEHA 1ZFQA 1CVAA 4JSAA 4KNJA 2ILIA 4Q6EA 4E5QA 4YX4A 3SBHA 3EFTA 3T82A 1HVAA 1CNYA 2X7TA 3SAPA 9CA2A 1CNWA 1BNNA 2QP6A 5L3OA 3JXFA 7CA2A 1CILA 2NMXA 1CAJA 1TB0X 1G54A 2NN7A 4LU3A 4KV0A 5FNIA 1UGGA 1CAKA 1UGBA 2NWZA 1G4OA 3CAJA 4RFDA 5EOIA 1HUGA 3RYYA 5FNLA 1G0EA 3JXGA 4L5WA 1KWRA 4MTYA 3SAXA 3MNIA 3S71B 3OYQA 3M3XA 3BL0A 3BETA 3TVNX 5JGTB 4MLTA 1CAOA 3ML2A 4E9OX 3JXHC 3T83A 3V3HB 3MHCA 3S97A 5HPJA 5FNKA 5EKMA 3NB5A 1HCAA 4XIXA 1LZVA 5SZ4A 2WEOA 2VVBX 2W2JA 4RUZA 1DMXA 4Q07A 3RG3A 4WW8A 4QY3A 4Q7SA 1CVBA 1FR7A 1IF5A 5DOGA 1CVFA 1ZSAA 3LXEA 2NWYA 3C7PA 4E3FA 1G53A 4YWPA 4WR7A 3MHLA 4N16A 4Q87A 3OIKA 2NXRA 3V2MA 1ZSCA 4KNIA 4Q81A 1I9OA 1I90A 1FR4A 3IBLA 5BRUA 4YVYA 4ITPA 5SZ6A 4KUYA 5FL4A 4K0ZA 2FNMA 1YO0A 2QOAA 3M5TA 1KOPA 5FDCA 2WD3A 5DSJA 2NWOA 3RG4A 1CZMA 3PJJA 5SZ0A 1FSQA 1IF8A 3RYVB 3RZ0B 3N4BA 4HU1A 4PQ7A 3SBIA 4ZWIA 1UGDA 4YXOA 4RUYA 3F7UA 1HECA 4YGNA 1RJ6A 3P44A 5E28A 3M5SA 4FPTA 5AMDA 1ZGEA 5SZ5A 1CNCA 2IT4A 3DC3A 4YYTA 5DSIA 1UGFA 3HS4A 3UYNA 3P5LA 3L14A 5G0CA 4HT2A 3U7CA 4HBAA 5JG5B 1CA2A 1G3ZA 1DMYA 1G45A 4RFCA 1H9QA 3OYSA 5DSMA 4M2RA 3RLDA 3P58A 3HKNA 3HKTA 5DRSA 2X7UA 2Q38A 1FQMA 3DVCA 4Z1EA 3M2YA 3IBNA 3R17B 2FMGA 4HEZA 3OKVA 1OQ5A 3D0NA 1AM6A 3F4XA 1H9NA 1I9PA 1LG5A 3DCWA 5C8IA 2WEJA 1CNBA 3KOKA 5EIJA 1LG6A 1FQLA 3DA2A 4ZX1A 3FW3A 2VVAX 3M1KA 4K0TA 5SZ7A 2HOCA 1IF4A 1CVCA 1FLJA 5E5RA 1TG9A 3MZCA 1IF6A 1I9LA 3V2JA 1XPZA 4QK2A 1BNWA 4CNXA 3MNUA 1AZMA 5JQ0A 2CBCA 5EH7A 3DD0A 5DSLA 1Z97A 2FOSA 5E5UA 1RAYA 3HFPA 3M40A 1FQNA 3S74B 2ABEA 4FVNA 2POWA 1FSNA 1ZE8A 5J8ZA 2CBAA 3ZP9A 4Q0LA 1DCBA 4Q90A 4RIUA 3MYQA 3T85A 4Z1KA 2F14A 4KP8A 1YDAA 5BNLA 1CCSA 2QO8A 3K7KA 1BICA 1IF9A 1URTA 2CBEA 3B1BA 3KKXA 1KEQA 4C3TA 4XFWA 2POVA 8CA2A 4HF3A 12CAA 4PYXA 4BF6A 5A6HA 2ZNCA 3F7BA 4HEYA 4Q78A 5LMDA 4QSAA 4CA2A 1XEVA 4QK1A 3S73B 1BN4A 4IWZA 3D8WA 5EHWA 3CYUA 2NN1A 5FNGA 4ILXA 4YXIA 1Y7WA 4E49A 4XZ5A 1CNGA 5E2SA 5EH5A 1G0FA 3B4FA 2OSMA 3M1WA 4GL1X 1CA3A 1J9WA 3RZ5A 3DCSA
chains in the Genus database with same CATH topology
4HEWA 3RZ7A 3KONA 1CCUA 3GZ0A 4RN4A 4Q49A 3QYKA 3KWAA 3HKUA 4FU5A 3P4VA 1CVDA 3IEOA 2WD2A 2FMZA 4MDMA 1JD0A 3KLDB 3W6IA 3RYJB 3M2ZA 5JEGB 4WW6A 3MNHA 3RJ7A 4WUPA 5FNMA 5DSQA 5EKHA 3KNEA 2EU3A 3FE4A 1KOQA 1BNUA 4QSJA 4XIWA 4QJXA 5FLOA 1FQRA 5E2NA 2AX2A 4ZWXA 4PXXA 1UGCA 5DSNA 2NXSA 4Q08A 3S76A 4KUVA 5IPZA 4KUWA 4TWLA 4QIYA 5E2KA 1JCZA 4FIKA 3RYXB 1ZH9A 1BNVA 1HEBA 5EH8A 1TTMA 1CAYA 3OKUA 4HT0A 3DV7A 5EHEA 4E4AA 1TG3A 4Q6DA 3V3JA 2NNGA 4Q8ZA 3DD8A 2HNCA 4BF1A 1THKA 1YDBA 1XQ0A 3Q31A 1H4NA 4IDRX 4M2VA 2CBDA 4QEFA 4YGLA 5JDVB 3S9TA 3DVBA 2GD8A 4ETQC 3R16A 1CIMA 3MDZA 5AMLA 3KS3A 2FOUA 1RAZA 1RJ5A 4Q8YA 3F8EA 4QJPA 4Q9YA 4Q06A 1FSRA 5FL5A 1RZDA 1Z93A 1G6VA 4MLXA 5AMGA 3BL1A 1YDCA 1G4JA 1CNJA 2CA2A 4QSBA 2H4NA 4YXUA 1BN3A 1HEAA 5DVXA 3OY0A 3MNAA 1YO1A 4Q83A 3TVOX 4KP5A 3RYZA 4FRCA 5FLTA 5FLSA 3NI5A 3M98A 4R5AA 3UYQA 4FL7A 4QJ0A 3U3AX 1G52A 1I9MA 3V3FA 1XEGA 1LUGA 1BZMA 3U47A 2FOVA 1ZNCA 1CNIA 3EFIA 1I91A 4JSSA 4YGFA 1CCTA 1CAZA 1CNXA 4N0XB 5FNJA 5JESB 2FOQA 3OILA 4WL4A 3N2PA 4Q8XA 5JG3B 2Q1BA 4G0CA 4K1QA 1MOOA 3PYKA 4MDLA 4PZHA 4UOVA 1G48A 2CABA 2NXTA 1BCDA 4LHIA 3VBDA 5DSOA 4R59A 1Z9YA 2FNKA 3P3HA 1DCAA 1TEUX 3S78B 4YGKA 3S77B 1RZEA 1TBTX 2X7SA 4MDGA 4Z0QA 2Q1QA 3ZNCA 2POUA 3P5AA 1CANA 2EZ7A 3M1QA 3DCCA 3M2XA 4DZ9A 1CNKA 5E2RA 5BYIA 2HL4A 1BNQA 1MUAA 4LP6A 1T9NA 3M2NA 3P3JA 4ITOA 4TWMA 1LGDA 4Q7PA 3M04A 1TEQX 3PO6A 3IGPA 3RZ8A 1I9QA 4QIZA 4QTLA 4CACA 3OIMA 4MO8A 5JEPB 1BNMA 1TH9A 1YO2A 4E3DA 3RGEA 3KIGA 2FW4A 3S75B 3DC9A 3M5EA 3IAIA 4K13A 4L5UA 3NJ9A 4E3GA 1CAMA 1OKMA 4E3HA 5DSPA 3MHMA 3T84A 3V3IB 4CNWA 3V5GA 1BV3A 1CNHA 3CA2A 4QSIA 5G01A 5EZTX 5CACA 1RZAA 3HKQA 4R5BA 5SZ2A 3MHOA 5DOHA 4Q7VA 2H15A 1YDDA 4CNRA 3TMJA 3DBUA 4DZ7A 1HCBA 3P55A 1CVHA 3W6HA 2HD6A 3N3JA 1I9NA 4ZWYA 3HLJA 1A42A 3MHIA 4RUXA 4CQ0A 5SZ1A 3FFPX 4G7AA 3T5UA 3DAZA 1G46A 4Q7WA 5BRVA 4Z1JA 3V7XA 5SZ3A 4QJMA 4JSZA 1CINA 1I8ZA 5BRWA 3S8XA 3CZVA 1ZFKA 2CBBA 4KNNA 5DSRA 3MNJA 5DSKA 5JQTA 3RZ1B 4QK3A 2O4ZA 3MMFA 3M1JA 5JEHB 1UGAA 1BNTA 2AW1A 5FLPA 1F2WA 3MWOA 1V9IC 5A25A 5FLRA 1ZGFA 3D93A 4K0SA 5EHVA 6CA2A 4JSWA 4M2WA 1BN1A 5CLUA 4Q09A 5FNHA 2NNOA 4KNMA 4JS6A 4CNVA 4Z1NA 1CRMA 1OKNA 3U45X 2EU2A 4ZWZA 2NNVA 1CRAA 3K34A 1RZBA 3IBIA 4COQA 3ML5A 4M2UA 4X5SA 3D9ZA 5JGSB 5G0BA 4ZX0A 1IF7A 3M96A 1CVEA 3T5ZA 3DVDA 1HEDA 1RZCA 2NWPA 4PYYA 3K2FA 4ZAOA 5G03A 4KAPA 3M67A 4BCWA 1TE3X 5FL6A 5FDIA 2WEGA 4XE1A 5E2MA 3N0NA 2OSFA 4QJWA 4Y0JA 1CALA 3S72B 1CAIA 3MNKA 3M14A 1UGEA 5EKJA 4RIVA 5CA2A 5FLQA 3V3GB 2WEHA 4FVOA 4YGJA 1G1DA 2HFWA 4WUQA 5L6KA 1ZSBA 1EOUA 2FNNA 2HKKA 4RH2A 4QJOA 1AVNA 1OKLA 4Q99A 2FOYA 5CJFA 1V9EA 1KWQA 1JV0A 1CAHA 1HUHA 4L5VA 2NNSA 4YHAA 3IBUA 3KOIA 3D92A 2GEHA 1ZFQA 1CVAA 4JSAA 4KNJA 2ILIA 4Q6EA 4E5QA 4YX4A 3SBHA 3EFTA 3T82A 1HVAA 1CNYA 2X7TA 3SAPA 9CA2A 1CNWA 1BNNA 2QP6A 5L3OA 3JXFA 7CA2A 1CILA 2NMXA 1CAJA 1TB0X 1G54A 2NN7A 4LU3A 4KV0A 5FNIA 1UGGA 1CAKA 1UGBA 2NWZA 1G4OA 3CAJA 4RFDA 5EOIA 1HUGA 3RYYA 5FNLA 1G0EA 3JXGA 4L5WA 1KWRA 4MTYA 3SAXA 3MNIA 3S71B 3OYQA 3M3XA 3BL0A 3BETA 3TVNX 5JGTB 4MLTA 1CAOA 3ML2A 4E9OX 3JXHC 3T83A 3V3HB 3MHCA 3S97A 5HPJA 5FNKA 5EKMA 3NB5A 1HCAA 4XIXA 1LZVA 5SZ4A 2WEOA 2VVBX 2W2JA 4RUZA 1DMXA 4Q07A 3RG3A 4WW8A 4QY3A 4Q7SA 1CVBA 1FR7A 1IF5A 5DOGA 1CVFA 1ZSAA 3LXEA 2NWYA 3C7PA 4E3FA 1G53A 4YWPA 4WR7A 3MHLA 4N16A 4Q87A 3OIKA 2NXRA 3V2MA 1ZSCA 4KNIA 4Q81A 1I9OA 1I90A 1FR4A 3IBLA 5BRUA 4YVYA 4ITPA 5SZ6A 4KUYA 5FL4A 4K0ZA 2FNMA 1YO0A 2QOAA 3M5TA 1KOPA 5FDCA 2WD3A 5DSJA 2NWOA 3RG4A 1CZMA 3PJJA 5SZ0A 1FSQA 1IF8A 3RYVB 3RZ0B 3N4BA 4HU1A 4PQ7A 3SBIA 4ZWIA 1UGDA 4YXOA 4RUYA 3F7UA 1HECA 4YGNA 1RJ6A 3P44A 5E28A 3M5SA 4FPTA 5AMDA 1ZGEA 5SZ5A 1CNCA 2IT4A 3DC3A 4YYTA 5DSIA 1UGFA 3HS4A 3UYNA 3P5LA 3L14A 5G0CA 4HT2A 3U7CA 4HBAA 5JG5B 1CA2A 1G3ZA 1DMYA 1G45A 4RFCA 1H9QA 3OYSA 5DSMA 4M2RA 3RLDA 3P58A 3HKNA 3HKTA 5DRSA 2X7UA 2Q38A 1FQMA 3DVCA 4Z1EA 3M2YA 3IBNA 3R17B 2FMGA 4HEZA 3OKVA 1OQ5A 3D0NA 1AM6A 3F4XA 1H9NA 1I9PA 1LG5A 3DCWA 5C8IA 2WEJA 1CNBA 3KOKA 5EIJA 1LG6A 1FQLA 3DA2A 4ZX1A 3FW3A 2VVAX 3M1KA 4K0TA 5SZ7A 2HOCA 1IF4A 1CVCA 1FLJA 5E5RA 1TG9A 3MZCA 1IF6A 1I9LA 3V2JA 1XPZA 4QK2A 1BNWA 4CNXA 3MNUA 1AZMA 5JQ0A 2CBCA 5EH7A 3DD0A 5DSLA 1Z97A 2FOSA 5E5UA 1RAYA 3HFPA 3M40A 1FQNA 3S74B 2ABEA 4FVNA 2POWA 1FSNA 1ZE8A 5J8ZA 2CBAA 3ZP9A 4Q0LA 1DCBA 4Q90A 4RIUA 3MYQA 3T85A 4Z1KA 2F14A 4KP8A 1YDAA 5BNLA 1CCSA 2QO8A 3K7KA 1BICA 1IF9A 1URTA 2CBEA 3B1BA 3KKXA 1KEQA 4C3TA 4XFWA 2POVA 8CA2A 4HF3A 12CAA 4PYXA 4BF6A 5A6HA 2ZNCA 3F7BA 4HEYA 4Q78A 5LMDA 4QSAA 4CA2A 1XEVA 4QK1A 3S73B 1BN4A 4IWZA 3D8WA 5EHWA 3CYUA 2NN1A 5FNGA 4ILXA 4YXIA 1Y7WA 4E49A 4XZ5A 1CNGA 5E2SA 5EH5A 1G0FA 3B4FA 2OSMA 3M1WA 4GL1X 1CA3A 1J9WA 3RZ5A 3DCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HEW A;  3RZ7 A;  3KON A;  1CCU A;  3GZ0 A;  4RN4 A;  4Q49 A;  3QYK A;  3KWA A;  3HKU A;  4FU5 A;  3P4V A;  1CVD A;  3IEO A;  2WD2 A;  2FMZ A;  4MDM A;  1JD0 A;  3KLD B;  3W6I A;  3RYJ B;  3M2Z A;  5JEG B;  4WW6 A;  3MNH A;  3RJ7 A;  4WUP A;  5FNM A;  5DSQ A;  5EKH A;  3KNE A;  2EU3 A;  3FE4 A;  1KOQ A;  1BNU A;  4QSJ A;  4XIW A;  4QJX A;  5FLO A;  1FQR A;  5E2N A;  2AX2 A;  4ZWX A;  4PXX A;  1UGC A;  5DSN A;  2NXS A;  4Q08 A;  3S76 A;  4KUV A;  5IPZ A;  4KUW A;  4TWL A;  4QIY A;  5E2K A;  1JCZ A;  4FIK A;  3RYX B;  1ZH9 A;  1BNV A;  1HEB A;  5EH8 A;  1TTM A;  1CAY A;  3OKU A;  4HT0 A;  3DV7 A;  5EHE A;  4E4A A;  1TG3 A;  4Q6D A;  3V3J A;  2NNG A;  4Q8Z A;  3DD8 A;  2HNC A;  4BF1 A;  1THK A;  1YDB A;  1XQ0 A;  3Q31 A;  1H4N A;  4IDR X;  4M2V A;  2CBD A;  4QEF A;  4YGL A;  5JDV B;  3S9T A;  3DVB A;  2GD8 A;  4ETQ C;  3R16 A;  1CIM A;  3MDZ A;  5AML A;  3KS3 A;  2FOU A;  1RAZ A;  1RJ5 A;  4Q8Y A;  3F8E A;  4QJP A;  4Q9Y A;  4Q06 A;  1FSR A;  5FL5 A;  1RZD A;  1Z93 A;  1G6V A;  4MLX A;  5AMG A;  3BL1 A;  1YDC A;  1G4J A;  1CNJ A;  2CA2 A;  4QSB A;  2H4N A;  4YXU A;  1BN3 A;  1HEA A;  5DVX A;  3OY0 A;  3MNA A;  1YO1 A;  4Q83 A;  3TVO X;  4KP5 A;  3RYZ A;  4FRC A;  5FLT A;  5FLS A;  3NI5 A;  3M98 A;  4R5A A;  3UYQ A;  4FL7 A;  4QJ0 A;  3U3A X;  1G52 A;  1I9M A;  3V3F A;  1XEG A;  1LUG A;  1BZM A;  3U47 A;  2FOV A;  1ZNC A;  1CNI A;  3EFI A;  1I91 A;  4JSS A;  4YGF A;  1CCT A;  1CAZ A;  1CNX A;  4N0X B;  5FNJ A;  5JES B;  2FOQ A;  3OIL A;  4WL4 A;  3N2P A;  4Q8X A;  5JG3 B;  2Q1B A;  4G0C A;  4K1Q A;  1MOO A;  3PYK A;  4MDL A;  4PZH A;  4UOV A;  1G48 A;  2CAB A;  2NXT A;  1BCD A;  4LHI A;  3VBD A;  5DSO A;  4R59 A;  1Z9Y A;  2FNK A;  3P3H A;  1DCA A;  1TEU X;  3S78 B;  4YGK A;  3S77 B;  1RZE A;  1TBT X;  2X7S A;  4MDG A;  4Z0Q A;  2Q1Q A;  3ZNC A;  2POU A;  3P5A A;  1CAN A;  2EZ7 A;  3M1Q A;  3DCC A;  3M2X A;  4DZ9 A;  1CNK A;  5E2R A;  5BYI A;  2HL4 A;  1BNQ A;  1MUA A;  4LP6 A;  1T9N A;  3M2N A;  3P3J A;  4ITO A;  4TWM A;  1LGD A;  4Q7P A;  3M04 A;  1TEQ X;  3PO6 A;  3IGP A;  3RZ8 A;  1I9Q A;  4QIZ A;  4QTL A;  4CAC A;  3OIM A;  4MO8 A;  5JEP B;  1BNM A;  1TH9 A;  1YO2 A;  4E3D A;  3RGE A;  3KIG A;  2FW4 A;  3S75 B;  3DC9 A;  3M5E A;  3IAI A;  4K13 A;  4L5U A;  3NJ9 A;  4E3G A;  1CAM A;  1OKM A;  4E3H A;  5DSP A;  3MHM A;  3T84 A;  3V3I B;  4CNW A;  3V5G A;  1BV3 A;  1CNH A;  3CA2 A;  4QSI A;  5G01 A;  5EZT X;  5CAC A;  1RZA A;  3HKQ A;  4R5B A;  5SZ2 A;  3MHO A;  5DOH A;  4Q7V A;  2H15 A;  1YDD A;  4CNR A;  3TMJ A;  3DBU A;  4DZ7 A;  1HCB A;  3P55 A;  1CVH A;  3W6H A;  2HD6 A;  3N3J A;  1I9N A;  4ZWY A;  3HLJ A;  1A42 A;  3MHI A;  4RUX A;  4CQ0 A;  5SZ1 A;  3FFP X;  4G7A A;  3T5U A;  3DAZ A;  1G46 A;  4Q7W A;  5BRV A;  4Z1J A;  3V7X A;  5SZ3 A;  4QJM A;  4JSZ A;  1CIN A;  1I8Z A;  5BRW A;  3S8X A;  3CZV A;  1ZFK A;  2CBB A;  4KNN A;  5DSR A;  3MNJ A;  5DSK A;  5JQT A;  3RZ1 B;  4QK3 A;  2O4Z A;  3MMF A;  3M1J A;  5JEH B;  1UGA A;  1BNT A;  2AW1 A;  5FLP A;  1F2W A;  3MWO A;  1V9I C;  5A25 A;  5FLR A;  1ZGF A;  3D93 A;  4K0S A;  5EHV A;  6CA2 A;  4JSW A;  4M2W A;  1BN1 A;  5CLU A;  4Q09 A;  5FNH A;  2NNO A;  4KNM A;  4JS6 A;  4CNV A;  4Z1N A;  1CRM A;  1OKN A;  3U45 X;  2EU2 A;  4ZWZ A;  2NNV A;  1CRA A;  3K34 A;  1RZB A;  3IBI A;  4COQ A;  3ML5 A;  4M2U A;  4X5S A;  3D9Z A;  5JGS B;  5G0B A;  4ZX0 A;  1IF7 A;  3M96 A;  1CVE A;  3T5Z A;  3DVD A;  1HED A;  1RZC A;  2NWP A;  4PYY A;  3K2F A;  4ZAO A;  5G03 A;  4KAP A;  3M67 A;  4BCW A;  1TE3 X;  5FL6 A;  5FDI A;  2WEG A;  4XE1 A;  5E2M A;  3N0N A;  2OSF A;  4QJW A;  4Y0J A;  1CAL A;  3S72 B;  1CAI A;  3MNK A;  3M14 A;  1UGE A;  5EKJ A;  4RIV A;  5CA2 A;  5FLQ A;  3V3G B;  2WEH A;  4FVO A;  4YGJ A;  1G1D A;  2HFW A;  4WUQ A;  5L6K A;  1ZSB A;  1EOU A;  2FNN A;  2HKK A;  4RH2 A;  4QJO A;  1AVN A;  1OKL A;  4Q99 A;  2FOY A;  5CJF A;  1V9E A;  1KWQ A;  1JV0 A;  1CAH A;  1HUH A;  4L5V A;  2NNS A;  4YHA A;  3IBU A;  3KOI A;  3D92 A;  2GEH A;  1ZFQ A;  1CVA A;  4JSA A;  4KNJ A;  2ILI A;  4Q6E A;  4E5Q A;  4YX4 A;  3SBH A;  3EFT A;  3T82 A;  1HVA A;  1CNY A;  2X7T A;  3SAP A;  9CA2 A;  1CNW A;  1BNN A;  2QP6 A;  5L3O A;  3JXF A;  7CA2 A;  1CIL A;  2NMX A;  1CAJ A;  1TB0 X;  1G54 A;  2NN7 A;  4LU3 A;  4KV0 A;  5FNI A;  1UGG A;  1CAK A;  1UGB A;  2NWZ A;  1G4O A;  3CAJ A;  4RFD A;  5EOI A;  1HUG A;  3RYY A;  5FNL A;  1G0E A;  3JXG A;  4L5W A;  1KWR A;  4MTY A;  3SAX A;  3MNI A;  3S71 B;  3OYQ A;  3M3X A;  3BL0 A;  3BET A;  3TVN X;  5JGT B;  4MLT A;  1CAO A;  3ML2 A;  4E9O X;  3JXH C;  3T83 A;  3V3H B;  3MHC A;  3S97 A;  5HPJ A;  5FNK A;  5EKM A;  3NB5 A;  1HCA A;  4XIX A;  1LZV A;  5SZ4 A;  2WEO A;  2VVB X;  2W2J A;  4RUZ A;  1DMX A;  4Q07 A;  3RG3 A;  4WW8 A;  4QY3 A;  4Q7S A;  1CVB A;  1FR7 A;  1IF5 A;  5DOG A;  1CVF A;  1ZSA A;  3LXE A;  2NWY A;  3C7P A;  4E3F A;  1G53 A;  4YWP A;  4WR7 A;  3MHL A;  4N16 A;  4Q87 A;  3OIK A;  2NXR A;  3V2M A;  1ZSC A;  4KNI A;  4Q81 A;  1I9O A;  1I90 A;  1FR4 A;  3IBL A;  5BRU A;  4YVY A;  4ITP A;  5SZ6 A;  4KUY A;  5FL4 A;  4K0Z A;  2FNM A;  1YO0 A;  2QOA A;  3M5T A;  1KOP A;  5FDC A;  2WD3 A;  5DSJ A;  2NWO A;  3RG4 A;  1CZM A;  3PJJ A;  5SZ0 A;  1FSQ A;  1IF8 A;  3RYV B;  3RZ0 B;  3N4B A;  4HU1 A;  4PQ7 A;  3SBI A;  4ZWI A;  1UGD A;  4YXO A;  4RUY A;  3F7U A;  1HEC A;  4YGN A;  1RJ6 A;  3P44 A;  5E28 A;  3M5S A;  4FPT A;  5AMD A;  1ZGE A;  5SZ5 A;  1CNC A;  2IT4 A;  3DC3 A;  4YYT A;  5DSI A;  1UGF A;  3HS4 A;  3UYN A;  3P5L A;  3L14 A;  5G0C A;  4HT2 A;  3U7C A;  4HBA A;  5JG5 B;  1CA2 A;  1G3Z A;  1DMY A;  1G45 A;  4RFC A;  1H9Q A;  3OYS A;  5DSM A;  4M2R A;  3RLD A;  3P58 A;  3HKN A;  3HKT A;  5DRS A;  2X7U A;  2Q38 A;  1FQM A;  3DVC A;  4Z1E A;  3M2Y A;  3IBN A;  3R17 B;  2FMG A;  4HEZ A;  3OKV A;  1OQ5 A;  3D0N A;  1AM6 A;  3F4X A;  1H9N A;  1I9P A;  1LG5 A;  3DCW A;  5C8I A;  2WEJ A;  1CNB A;  3KOK A;  5EIJ A;  1LG6 A;  1FQL A;  3DA2 A;  4ZX1 A;  3FW3 A;  2VVA X;  3M1K A;  4K0T A;  5SZ7 A;  2HOC A;  1IF4 A;  1CVC A;  1FLJ A;  5E5R A;  1TG9 A;  3MZC A;  1IF6 A;  1I9L A;  3V2J A;  1XPZ A;  4QK2 A;  1BNW A;  4CNX A;  3MNU A;  1AZM A;  5JQ0 A;  2CBC A;  5EH7 A;  3DD0 A;  5DSL A;  1Z97 A;  2FOS A;  5E5U A;  1RAY A;  3HFP A;  3M40 A;  1FQN A;  3S74 B;  2ABE A;  4FVN A;  2POW A;  1FSN A;  1ZE8 A;  5J8Z A;  2CBA A;  3ZP9 A;  4Q0L A;  1DCB A;  4Q90 A;  4RIU A;  3MYQ A;  3T85 A;  4Z1K A;  2F14 A;  4KP8 A;  1YDA A;  5BNL A;  1CCS A;  2QO8 A;  3K7K A;  1BIC A;  1IF9 A;  1URT A;  2CBE A;  3B1B A;  3KKX A;  1KEQ A;  4C3T A;  4XFW A;  2POV A;  8CA2 A;  4HF3 A;  12CA A;  4PYX A;  4BF6 A;  5A6H A;  2ZNC A;  3F7B A;  4HEY A;  4Q78 A;  5LMD A;  4QSA A;  4CA2 A;  1XEV A;  4QK1 A;  3S73 B;  1BN4 A;  4IWZ A;  3D8W A;  5EHW A;  3CYU A;  2NN1 A;  5FNG A;  4ILX A;  4YXI A;  1Y7W A;  4E49 A;  4XZ5 A;  1CNG A;  5E2S A;  5EH5 A;  1G0F A;  3B4F A;  2OSM A;  3M1W A;  4GL1 X;  1CA3 A;  1J9W A;  3RZ5 A;  3DCS A; 
#chains in the Genus database with same CATH topology
 4HEW A;  3RZ7 A;  3KON A;  1CCU A;  3GZ0 A;  4RN4 A;  4Q49 A;  3QYK A;  3KWA A;  3HKU A;  4FU5 A;  3P4V A;  1CVD A;  3IEO A;  2WD2 A;  2FMZ A;  4MDM A;  1JD0 A;  3KLD B;  3W6I A;  3RYJ B;  3M2Z A;  5JEG B;  4WW6 A;  3MNH A;  3RJ7 A;  4WUP A;  5FNM A;  5DSQ A;  5EKH A;  3KNE A;  2EU3 A;  3FE4 A;  1KOQ A;  1BNU A;  4QSJ A;  4XIW A;  4QJX A;  5FLO A;  1FQR A;  5E2N A;  2AX2 A;  4ZWX A;  4PXX A;  1UGC A;  5DSN A;  2NXS A;  4Q08 A;  3S76 A;  4KUV A;  5IPZ A;  4KUW A;  4TWL A;  4QIY A;  5E2K A;  1JCZ A;  4FIK A;  3RYX B;  1ZH9 A;  1BNV A;  1HEB A;  5EH8 A;  1TTM A;  1CAY A;  3OKU A;  4HT0 A;  3DV7 A;  5EHE A;  4E4A A;  1TG3 A;  4Q6D A;  3V3J A;  2NNG A;  4Q8Z A;  3DD8 A;  2HNC A;  4BF1 A;  1THK A;  1YDB A;  1XQ0 A;  3Q31 A;  1H4N A;  4IDR X;  4M2V A;  2CBD A;  4QEF A;  4YGL A;  5JDV B;  3S9T A;  3DVB A;  2GD8 A;  4ETQ C;  3R16 A;  1CIM A;  3MDZ A;  5AML A;  3KS3 A;  2FOU A;  1RAZ A;  1RJ5 A;  4Q8Y A;  3F8E A;  4QJP A;  4Q9Y A;  4Q06 A;  1FSR A;  5FL5 A;  1RZD A;  1Z93 A;  1G6V A;  4MLX A;  5AMG A;  3BL1 A;  1YDC A;  1G4J A;  1CNJ A;  2CA2 A;  4QSB A;  2H4N A;  4YXU A;  1BN3 A;  1HEA A;  5DVX A;  3OY0 A;  3MNA A;  1YO1 A;  4Q83 A;  3TVO X;  4KP5 A;  3RYZ A;  4FRC A;  5FLT A;  5FLS A;  3NI5 A;  3M98 A;  4R5A A;  3UYQ A;  4FL7 A;  4QJ0 A;  3U3A X;  1G52 A;  1I9M A;  3V3F A;  1XEG A;  1LUG A;  1BZM A;  3U47 A;  2FOV A;  1ZNC A;  1CNI A;  3EFI A;  1I91 A;  4JSS A;  4YGF A;  1CCT A;  1CAZ A;  1CNX A;  4N0X B;  5FNJ A;  5JES B;  2FOQ A;  3OIL A;  4WL4 A;  3N2P A;  4Q8X A;  5JG3 B;  2Q1B A;  4G0C A;  4K1Q A;  1MOO A;  3PYK A;  4MDL A;  4PZH A;  4UOV A;  1G48 A;  2CAB A;  2NXT A;  1BCD A;  4LHI A;  3VBD A;  5DSO A;  4R59 A;  1Z9Y A;  2FNK A;  3P3H A;  1DCA A;  1TEU X;  3S78 B;  4YGK A;  3S77 B;  1RZE A;  1TBT X;  2X7S A;  4MDG A;  4Z0Q A;  2Q1Q A;  3ZNC A;  2POU A;  3P5A A;  1CAN A;  2EZ7 A;  3M1Q A;  3DCC A;  3M2X A;  4DZ9 A;  1CNK A;  5E2R A;  5BYI A;  2HL4 A;  1BNQ A;  1MUA A;  4LP6 A;  1T9N A;  3M2N A;  3P3J A;  4ITO A;  4TWM A;  1LGD A;  4Q7P A;  3M04 A;  1TEQ X;  3PO6 A;  3IGP A;  3RZ8 A;  1I9Q A;  4QIZ A;  4QTL A;  4CAC A;  3OIM A;  4MO8 A;  5JEP B;  1BNM A;  1TH9 A;  1YO2 A;  4E3D A;  3RGE A;  3KIG A;  2FW4 A;  3S75 B;  3DC9 A;  3M5E A;  3IAI A;  4K13 A;  4L5U A;  3NJ9 A;  4E3G A;  1CAM A;  1OKM A;  4E3H A;  5DSP A;  3MHM A;  3T84 A;  3V3I B;  4CNW A;  3V5G A;  1BV3 A;  1CNH A;  3CA2 A;  4QSI A;  5G01 A;  5EZT X;  5CAC A;  1RZA A;  3HKQ A;  4R5B A;  5SZ2 A;  3MHO A;  5DOH A;  4Q7V A;  2H15 A;  1YDD A;  4CNR A;  3TMJ A;  3DBU A;  4DZ7 A;  1HCB A;  3P55 A;  1CVH A;  3W6H A;  2HD6 A;  3N3J A;  1I9N A;  4ZWY A;  3HLJ A;  1A42 A;  3MHI A;  4RUX A;  4CQ0 A;  5SZ1 A;  3FFP X;  4G7A A;  3T5U A;  3DAZ A;  1G46 A;  4Q7W A;  5BRV A;  4Z1J A;  3V7X A;  5SZ3 A;  4QJM A;  4JSZ A;  1CIN A;  1I8Z A;  5BRW A;  3S8X A;  3CZV A;  1ZFK A;  2CBB A;  4KNN A;  5DSR A;  3MNJ A;  5DSK A;  5JQT A;  3RZ1 B;  4QK3 A;  2O4Z A;  3MMF A;  3M1J A;  5JEH B;  1UGA A;  1BNT A;  2AW1 A;  5FLP A;  1F2W A;  3MWO A;  1V9I C;  5A25 A;  5FLR A;  1ZGF A;  3D93 A;  4K0S A;  5EHV A;  6CA2 A;  4JSW A;  4M2W A;  1BN1 A;  5CLU A;  4Q09 A;  5FNH A;  2NNO A;  4KNM A;  4JS6 A;  4CNV A;  4Z1N A;  1CRM A;  1OKN A;  3U45 X;  2EU2 A;  4ZWZ A;  2NNV A;  1CRA A;  3K34 A;  1RZB A;  3IBI A;  4COQ A;  3ML5 A;  4M2U A;  4X5S A;  3D9Z A;  5JGS B;  5G0B A;  4ZX0 A;  1IF7 A;  3M96 A;  1CVE A;  3T5Z A;  3DVD A;  1HED A;  1RZC A;  2NWP A;  4PYY A;  3K2F A;  4ZAO A;  5G03 A;  4KAP A;  3M67 A;  4BCW A;  1TE3 X;  5FL6 A;  5FDI A;  2WEG A;  4XE1 A;  5E2M A;  3N0N A;  2OSF A;  4QJW A;  4Y0J A;  1CAL A;  3S72 B;  1CAI A;  3MNK A;  3M14 A;  1UGE A;  5EKJ A;  4RIV A;  5CA2 A;  5FLQ A;  3V3G B;  2WEH A;  4FVO A;  4YGJ A;  1G1D A;  2HFW A;  4WUQ A;  5L6K A;  1ZSB A;  1EOU A;  2FNN A;  2HKK A;  4RH2 A;  4QJO A;  1AVN A;  1OKL A;  4Q99 A;  2FOY A;  5CJF A;  1V9E A;  1KWQ A;  1JV0 A;  1CAH A;  1HUH A;  4L5V A;  2NNS A;  4YHA A;  3IBU A;  3KOI A;  3D92 A;  2GEH A;  1ZFQ A;  1CVA A;  4JSA A;  4KNJ A;  2ILI A;  4Q6E A;  4E5Q A;  4YX4 A;  3SBH A;  3EFT A;  3T82 A;  1HVA A;  1CNY A;  2X7T A;  3SAP A;  9CA2 A;  1CNW A;  1BNN A;  2QP6 A;  5L3O A;  3JXF A;  7CA2 A;  1CIL A;  2NMX A;  1CAJ A;  1TB0 X;  1G54 A;  2NN7 A;  4LU3 A;  4KV0 A;  5FNI A;  1UGG A;  1CAK A;  1UGB A;  2NWZ A;  1G4O A;  3CAJ A;  4RFD A;  5EOI A;  1HUG A;  3RYY A;  5FNL A;  1G0E A;  3JXG A;  4L5W A;  1KWR A;  4MTY A;  3SAX A;  3MNI A;  3S71 B;  3OYQ A;  3M3X A;  3BL0 A;  3BET A;  3TVN X;  5JGT B;  4MLT A;  1CAO A;  3ML2 A;  4E9O X;  3JXH C;  3T83 A;  3V3H B;  3MHC A;  3S97 A;  5HPJ A;  5FNK A;  5EKM A;  3NB5 A;  1HCA A;  4XIX A;  1LZV A;  5SZ4 A;  2WEO A;  2VVB X;  2W2J A;  4RUZ A;  1DMX A;  4Q07 A;  3RG3 A;  4WW8 A;  4QY3 A;  4Q7S A;  1CVB A;  1FR7 A;  1IF5 A;  5DOG A;  1CVF A;  1ZSA A;  3LXE A;  2NWY A;  3C7P A;  4E3F A;  1G53 A;  4YWP A;  4WR7 A;  3MHL A;  4N16 A;  4Q87 A;  3OIK A;  2NXR A;  3V2M A;  1ZSC A;  4KNI A;  4Q81 A;  1I9O A;  1I90 A;  1FR4 A;  3IBL A;  5BRU A;  4YVY A;  4ITP A;  5SZ6 A;  4KUY A;  5FL4 A;  4K0Z A;  2FNM A;  1YO0 A;  2QOA A;  3M5T A;  1KOP A;  5FDC A;  2WD3 A;  5DSJ A;  2NWO A;  3RG4 A;  1CZM A;  3PJJ A;  5SZ0 A;  1FSQ A;  1IF8 A;  3RYV B;  3RZ0 B;  3N4B A;  4HU1 A;  4PQ7 A;  3SBI A;  4ZWI A;  1UGD A;  4YXO A;  4RUY A;  3F7U A;  1HEC A;  4YGN A;  1RJ6 A;  3P44 A;  5E28 A;  3M5S A;  4FPT A;  5AMD A;  1ZGE A;  5SZ5 A;  1CNC A;  2IT4 A;  3DC3 A;  4YYT A;  5DSI A;  1UGF A;  3HS4 A;  3UYN A;  3P5L A;  3L14 A;  5G0C A;  4HT2 A;  3U7C A;  4HBA A;  5JG5 B;  1CA2 A;  1G3Z A;  1DMY A;  1G45 A;  4RFC A;  1H9Q A;  3OYS A;  5DSM A;  4M2R A;  3RLD A;  3P58 A;  3HKN A;  3HKT A;  5DRS A;  2X7U A;  2Q38 A;  1FQM A;  3DVC A;  4Z1E A;  3M2Y A;  3IBN A;  3R17 B;  2FMG A;  4HEZ A;  3OKV A;  1OQ5 A;  3D0N A;  1AM6 A;  3F4X A;  1H9N A;  1I9P A;  1LG5 A;  3DCW A;  5C8I A;  2WEJ A;  1CNB A;  3KOK A;  5EIJ A;  1LG6 A;  1FQL A;  3DA2 A;  4ZX1 A;  3FW3 A;  2VVA X;  3M1K A;  4K0T A;  5SZ7 A;  2HOC A;  1IF4 A;  1CVC A;  1FLJ A;  5E5R A;  1TG9 A;  3MZC A;  1IF6 A;  1I9L A;  3V2J A;  1XPZ A;  4QK2 A;  1BNW A;  4CNX A;  3MNU A;  1AZM A;  5JQ0 A;  2CBC A;  5EH7 A;  3DD0 A;  5DSL A;  1Z97 A;  2FOS A;  5E5U A;  1RAY A;  3HFP A;  3M40 A;  1FQN A;  3S74 B;  2ABE A;  4FVN A;  2POW A;  1FSN A;  1ZE8 A;  5J8Z A;  2CBA A;  3ZP9 A;  4Q0L A;  1DCB A;  4Q90 A;  4RIU A;  3MYQ A;  3T85 A;  4Z1K A;  2F14 A;  4KP8 A;  1YDA A;  5BNL A;  1CCS A;  2QO8 A;  3K7K A;  1BIC A;  1IF9 A;  1URT A;  2CBE A;  3B1B A;  3KKX A;  1KEQ A;  4C3T A;  4XFW A;  2POV A;  8CA2 A;  4HF3 A;  12CA A;  4PYX A;  4BF6 A;  5A6H A;  2ZNC A;  3F7B A;  4HEY A;  4Q78 A;  5LMD A;  4QSA A;  4CA2 A;  1XEV A;  4QK1 A;  3S73 B;  1BN4 A;  4IWZ A;  3D8W A;  5EHW A;  3CYU A;  2NN1 A;  5FNG A;  4ILX A;  4YXI A;  1Y7W A;  4E49 A;  4XZ5 A;  1CNG A;  5E2S A;  5EH5 A;  1G0F A;  3B4F A;  2OSM A;  3M1W A;  4GL1 X;  1CA3 A;  1J9W A;  3RZ5 A;  3DCS A; 
#chains in the Genus database with same CATH homology
 4HEW A;  3RZ7 A;  3KON A;  1CCU A;  3GZ0 A;  4RN4 A;  4Q49 A;  3QYK A;  3KWA A;  3HKU A;  4FU5 A;  3P4V A;  1CVD A;  3IEO A;  2WD2 A;  2FMZ A;  4MDM A;  1JD0 A;  3KLD B;  3W6I A;  3RYJ B;  3M2Z A;  5JEG B;  4WW6 A;  3MNH A;  3RJ7 A;  4WUP A;  5FNM A;  5DSQ A;  5EKH A;  3KNE A;  2EU3 A;  3FE4 A;  1KOQ A;  1BNU A;  4QSJ A;  4XIW A;  4QJX A;  5FLO A;  1FQR A;  5E2N A;  2AX2 A;  4ZWX A;  4PXX A;  1UGC A;  5DSN A;  2NXS A;  4Q08 A;  3S76 A;  4KUV A;  5IPZ A;  4KUW A;  4TWL A;  4QIY A;  5E2K A;  1JCZ A;  4FIK A;  3RYX B;  1ZH9 A;  1BNV A;  1HEB A;  5EH8 A;  1TTM A;  1CAY A;  3OKU A;  4HT0 A;  3DV7 A;  5EHE A;  4E4A A;  1TG3 A;  4Q6D A;  3V3J A;  2NNG A;  4Q8Z A;  3DD8 A;  2HNC A;  4BF1 A;  1THK A;  1YDB A;  1XQ0 A;  3Q31 A;  1H4N A;  4IDR X;  4M2V A;  2CBD A;  4QEF A;  4YGL A;  5JDV B;  3S9T A;  3DVB A;  2GD8 A;  4ETQ C;  3R16 A;  1CIM A;  3MDZ A;  5AML A;  3KS3 A;  2FOU A;  1RAZ A;  1RJ5 A;  4Q8Y A;  3F8E A;  4QJP A;  4Q9Y A;  4Q06 A;  1FSR A;  5FL5 A;  1RZD A;  1Z93 A;  1G6V A;  4MLX A;  5AMG A;  3BL1 A;  1YDC A;  1G4J A;  1CNJ A;  2CA2 A;  4QSB A;  2H4N A;  4YXU A;  1BN3 A;  1HEA A;  5DVX A;  3OY0 A;  3MNA A;  1YO1 A;  4Q83 A;  3TVO X;  4KP5 A;  3RYZ A;  4FRC A;  5FLT A;  5FLS A;  3NI5 A;  3M98 A;  4R5A A;  3UYQ A;  4FL7 A;  4QJ0 A;  3U3A X;  1G52 A;  1I9M A;  3V3F A;  1XEG A;  1LUG A;  1BZM A;  3U47 A;  2FOV A;  1ZNC A;  1CNI A;  3EFI A;  1I91 A;  4JSS A;  4YGF A;  1CCT A;  1CAZ A;  1CNX A;  4N0X B;  5FNJ A;  5JES B;  2FOQ A;  3OIL A;  4WL4 A;  3N2P A;  4Q8X A;  5JG3 B;  2Q1B A;  4G0C A;  4K1Q A;  1MOO A;  3PYK A;  4MDL A;  4PZH A;  4UOV A;  1G48 A;  2CAB A;  2NXT A;  1BCD A;  4LHI A;  3VBD A;  5DSO A;  4R59 A;  1Z9Y A;  2FNK A;  3P3H A;  1DCA A;  1TEU X;  3S78 B;  4YGK A;  3S77 B;  1RZE A;  1TBT X;  2X7S A;  4MDG A;  4Z0Q A;  2Q1Q A;  3ZNC A;  2POU A;  3P5A A;  1CAN A;  2EZ7 A;  3M1Q A;  3DCC A;  3M2X A;  4DZ9 A;  1CNK A;  5E2R A;  5BYI A;  2HL4 A;  1BNQ A;  1MUA A;  4LP6 A;  1T9N A;  3M2N A;  3P3J A;  4ITO A;  4TWM A;  1LGD A;  4Q7P A;  3M04 A;  1TEQ X;  3PO6 A;  3IGP A;  3RZ8 A;  1I9Q A;  4QIZ A;  4QTL A;  4CAC A;  3OIM A;  4MO8 A;  5JEP B;  1BNM A;  1TH9 A;  1YO2 A;  4E3D A;  3RGE A;  3KIG A;  2FW4 A;  3S75 B;  3DC9 A;  3M5E A;  3IAI A;  4K13 A;  4L5U A;  3NJ9 A;  4E3G A;  1CAM A;  1OKM A;  4E3H A;  5DSP A;  3MHM A;  3T84 A;  3V3I B;  4CNW A;  3V5G A;  1BV3 A;  1CNH A;  3CA2 A;  4QSI A;  5G01 A;  5EZT X;  5CAC A;  1RZA A;  3HKQ A;  4R5B A;  5SZ2 A;  3MHO A;  5DOH A;  4Q7V A;  2H15 A;  1YDD A;  4CNR A;  3TMJ A;  3DBU A;  4DZ7 A;  1HCB A;  3P55 A;  1CVH A;  3W6H A;  2HD6 A;  3N3J A;  1I9N A;  4ZWY A;  3HLJ A;  1A42 A;  3MHI A;  4RUX A;  4CQ0 A;  5SZ1 A;  3FFP X;  4G7A A;  3T5U A;  3DAZ A;  1G46 A;  4Q7W A;  5BRV A;  4Z1J A;  3V7X A;  5SZ3 A;  4QJM A;  4JSZ A;  1CIN A;  1I8Z A;  5BRW A;  3S8X A;  3CZV A;  1ZFK A;  2CBB A;  4KNN A;  5DSR A;  3MNJ A;  5DSK A;  5JQT A;  3RZ1 B;  4QK3 A;  2O4Z A;  3MMF A;  3M1J A;  5JEH B;  1UGA A;  1BNT A;  2AW1 A;  5FLP A;  1F2W A;  3MWO A;  1V9I C;  5A25 A;  5FLR A;  1ZGF A;  3D93 A;  4K0S A;  5EHV A;  6CA2 A;  4JSW A;  4M2W A;  1BN1 A;  5CLU A;  4Q09 A;  5FNH A;  2NNO A;  4KNM A;  4JS6 A;  4CNV A;  4Z1N A;  1CRM A;  1OKN A;  3U45 X;  2EU2 A;  4ZWZ A;  2NNV A;  1CRA A;  3K34 A;  1RZB A;  3IBI A;  4COQ A;  3ML5 A;  4M2U A;  4X5S A;  3D9Z A;  5JGS B;  5G0B A;  4ZX0 A;  1IF7 A;  3M96 A;  1CVE A;  3T5Z A;  3DVD A;  1HED A;  1RZC A;  2NWP A;  4PYY A;  3K2F A;  4ZAO A;  5G03 A;  4KAP A;  3M67 A;  4BCW A;  1TE3 X;  5FL6 A;  5FDI A;  2WEG A;  4XE1 A;  5E2M A;  3N0N A;  2OSF A;  4QJW A;  4Y0J A;  1CAL A;  3S72 B;  1CAI A;  3MNK A;  3M14 A;  1UGE A;  5EKJ A;  4RIV A;  5CA2 A;  5FLQ A;  3V3G B;  2WEH A;  4FVO A;  4YGJ A;  1G1D A;  2HFW A;  4WUQ A;  5L6K A;  1ZSB A;  1EOU A;  2FNN A;  2HKK A;  4RH2 A;  4QJO A;  1AVN A;  1OKL A;  4Q99 A;  2FOY A;  5CJF A;  1V9E A;  1KWQ A;  1JV0 A;  1CAH A;  1HUH A;  4L5V A;  2NNS A;  4YHA A;  3IBU A;  3KOI A;  3D92 A;  2GEH A;  1ZFQ A;  1CVA A;  4JSA A;  4KNJ A;  2ILI A;  4Q6E A;  4E5Q A;  4YX4 A;  3SBH A;  3EFT A;  3T82 A;  1HVA A;  1CNY A;  2X7T A;  3SAP A;  9CA2 A;  1CNW A;  1BNN A;  2QP6 A;  5L3O A;  3JXF A;  7CA2 A;  1CIL A;  2NMX A;  1CAJ A;  1TB0 X;  1G54 A;  2NN7 A;  4LU3 A;  4KV0 A;  5FNI A;  1UGG A;  1CAK A;  1UGB A;  2NWZ A;  1G4O A;  3CAJ A;  4RFD A;  5EOI A;  1HUG A;  3RYY A;  5FNL A;  1G0E A;  3JXG A;  4L5W A;  1KWR A;  4MTY A;  3SAX A;  3MNI A;  3S71 B;  3OYQ A;  3M3X A;  3BL0 A;  3BET A;  3TVN X;  5JGT B;  4MLT A;  1CAO A;  3ML2 A;  4E9O X;  3JXH C;  3T83 A;  3V3H B;  3MHC A;  3S97 A;  5HPJ A;  5FNK A;  5EKM A;  3NB5 A;  1HCA A;  4XIX A;  1LZV A;  5SZ4 A;  2WEO A;  2VVB X;  2W2J A;  4RUZ A;  1DMX A;  4Q07 A;  3RG3 A;  4WW8 A;  4QY3 A;  4Q7S A;  1CVB A;  1FR7 A;  1IF5 A;  5DOG A;  1CVF A;  1ZSA A;  3LXE A;  2NWY A;  3C7P A;  4E3F A;  1G53 A;  4YWP A;  4WR7 A;  3MHL A;  4N16 A;  4Q87 A;  3OIK A;  2NXR A;  3V2M A;  1ZSC A;  4KNI A;  4Q81 A;  1I9O A;  1I90 A;  1FR4 A;  3IBL A;  5BRU A;  4YVY A;  4ITP A;  5SZ6 A;  4KUY A;  5FL4 A;  4K0Z A;  2FNM A;  1YO0 A;  2QOA A;  3M5T A;  1KOP A;  5FDC A;  2WD3 A;  5DSJ A;  2NWO A;  3RG4 A;  1CZM A;  3PJJ A;  5SZ0 A;  1FSQ A;  1IF8 A;  3RYV B;  3RZ0 B;  3N4B A;  4HU1 A;  4PQ7 A;  3SBI A;  4ZWI A;  1UGD A;  4YXO A;  4RUY A;  3F7U A;  1HEC A;  4YGN A;  1RJ6 A;  3P44 A;  5E28 A;  3M5S A;  4FPT A;  5AMD A;  1ZGE A;  5SZ5 A;  1CNC A;  2IT4 A;  3DC3 A;  4YYT A;  5DSI A;  1UGF A;  3HS4 A;  3UYN A;  3P5L A;  3L14 A;  5G0C A;  4HT2 A;  3U7C A;  4HBA A;  5JG5 B;  1CA2 A;  1G3Z A;  1DMY A;  1G45 A;  4RFC A;  1H9Q A;  3OYS A;  5DSM A;  4M2R A;  3RLD A;  3P58 A;  3HKN A;  3HKT A;  5DRS A;  2X7U A;  2Q38 A;  1FQM A;  3DVC A;  4Z1E A;  3M2Y A;  3IBN A;  3R17 B;  2FMG A;  4HEZ A;  3OKV A;  1OQ5 A;  3D0N A;  1AM6 A;  3F4X A;  1H9N A;  1I9P A;  1LG5 A;  3DCW A;  5C8I A;  2WEJ A;  1CNB A;  3KOK A;  5EIJ A;  1LG6 A;  1FQL A;  3DA2 A;  4ZX1 A;  3FW3 A;  2VVA X;  3M1K A;  4K0T A;  5SZ7 A;  2HOC A;  1IF4 A;  1CVC A;  1FLJ A;  5E5R A;  1TG9 A;  3MZC A;  1IF6 A;  1I9L A;  3V2J A;  1XPZ A;  4QK2 A;  1BNW A;  4CNX A;  3MNU A;  1AZM A;  5JQ0 A;  2CBC A;  5EH7 A;  3DD0 A;  5DSL A;  1Z97 A;  2FOS A;  5E5U A;  1RAY A;  3HFP A;  3M40 A;  1FQN A;  3S74 B;  2ABE A;  4FVN A;  2POW A;  1FSN A;  1ZE8 A;  5J8Z A;  2CBA A;  3ZP9 A;  4Q0L A;  1DCB A;  4Q90 A;  4RIU A;  3MYQ A;  3T85 A;  4Z1K A;  2F14 A;  4KP8 A;  1YDA A;  5BNL A;  1CCS A;  2QO8 A;  3K7K A;  1BIC A;  1IF9 A;  1URT A;  2CBE A;  3B1B A;  3KKX A;  1KEQ A;  4C3T A;  4XFW A;  2POV A;  8CA2 A;  4HF3 A;  12CA A;  4PYX A;  4BF6 A;  5A6H A;  2ZNC A;  3F7B A;  4HEY A;  4Q78 A;  5LMD A;  4QSA A;  4CA2 A;  1XEV A;  4QK1 A;  3S73 B;  1BN4 A;  4IWZ A;  3D8W A;  5EHW A;  3CYU A;  2NN1 A;  5FNG A;  4ILX A;  4YXI A;  1Y7W A;  4E49 A;  4XZ5 A;  1CNG A;  5E2S A;  5EH5 A;  1G0F A;  3B4F A;  2OSM A;  3M1W A;  4GL1 X;  1CA3 A;  1J9W A;  3RZ5 A;  3DCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...