2I6DA

The structure of a putative rna methyltransferase of the trmh family from porphyromonas gingivalis.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
255
structure length
251
Chain Sequence
AMLSANQIKFLRSLRERKYRLREQAFAVEGPKLVGEMLPFYRCRMLVGTAAMLRAVSTPHDAEVVELPESFDFKRISTQTTPQPLMAVFDLPAEPEPVVEGLTLLLDGVQDPGNVGTILRTADWFGIRHVWLGTGSADVFSPKVVQASMGALARVQPTPLKNTVDTLAYFRRQGIPVYGAFLDGQSLYEAPLPNFTEPAILVLGSEGRGISPEVAAEITDRLTIPASGLSVESLNVAIATAILCSEWRRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA methyltransferase, TrmH family
publication title The structure of a putative RNA methyltransferase of the TrmH family from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
molecule tags Transferase
total genus 73
structure length 251
sequence length 255
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2i6dA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 2i6dA02
4YQ3A 3N4KA 4TZZA 1N8RH 1ZWZA 1V6ZA 2BO1A 3NK6A 2QEXF 2LBXA 4YQ1A 1VQ8F 4YQKA 3NVKE 4XBOA 4YPXA 4CNGA 1JJ2F 1YIJF 4H3YA 4JAKA 4YQ6A 4YQJA 3ONPA 5A2QM 3SIUA 1W2BF 3PLAC 4YQTA 1NJIH 3OBWA 3CD6F 2HVYD 1PXWA 3CXCF 3LWOC 2QA4F 1K8AH 2OTLF 4YVHA 1W41A 3N4ZA 1TO0A 1Z85A 3CC4F 1OY5A 1YJNF 3ON1A 3SIVA 2O3AA 4YQCA 4JALA 4YQAA 1RLGA 4CNEA 2KG4A 2VGMA 3JAMM 2QI2A 3CCJF 3DCMX 3KY7A 4YVGA 4YQOA 1Q81H 3CPWF 4PZKA 3CCEF 2ALEA 3CCMF 3J81M 1K73H 1UALA 4KDZA 4CNDA 3I56F 3IR9A 3MCAB 4YQ0A 3N4YA 3NVIB 2WALA 3O85A 2LBWA 3CCLF 1QVGF 1VQ6F 3CCSF 1VHKA 2CX8A 5GAPK 1VQOF 1DT9A 3KW2A 4FAKA 4YQRA 1YI2F 3VI6A 1ZJRA 1VQKF 4YPWA 1CK2A 1VQMF 3CPQA 5GIOC 1VQNF 3WXMB 1M1KH 2HA8A 4YQPA 3NMUC 1UAKA 1W3EX 3ILKA 1NS5A 3V7QA 4YVIA 1YJ9F 3BBDA 3CMAF 5GANK 3E5YA 3JCMM 1YHQF 3LWVC 1T0KB 2OTJF 1W40A 2YY8A 4X3MA 4YQ7A 3J7AR 3HAXD 5GM8A 3CG6A 4YVKA 1YITF 1K3RA 4MCBA 4YQGA 2QWVA 4YQ9A 3O7BA 3HJWC 3LWQC 2OZBA 4H3ZA 3I55F 1XBIA 3NK7A 3CMEF 3VMFB 1QVFF 3J80M 1V2XA 1S72F 1VQ9F 1GO0A 1H7MA 2V3JA 3BBHA 3KTYA 1IPAA 5DCVA 1E7KA 5D9FA 4YQ5A 1VQ7F 1GZ0A 4LCKA 3AXZA 3LWRC 3G4SF 2CZWA 4YQSA 3CCUF 1VHYA 4E8BA 1UAMA 4C4WC 2I6DA 3CCVF 1RA4A 4L69A 1CN7A 1VQ5F 2EGWA 2KTUA 3N4JA 4YQDA 4MCDA 3AGKA 2OHWA 4X3LA 3CCQF 5G4UC 1UAJA 4YQIA 1MXIA 5GMBA 3PAFA 5G4VC 3OIJA 4CNFA 3V7EA 3AI9X 3LFOA 5FLXM 3GYQA 1Q7YH 1NXZA 1Q82H 3LWPC 3OIIA 3IEFA 4IG6A 2Z0YA 3E20B 4J3CA 4YPYA 5GINC 3G6EF 1KC8H 3KNUA 4YQQA 5GMCA 4YQBA 2V3KA 4YQ8A 1VH0A 1KD1H 2EGVA 1VQPF 2KTVA 5CO4A 1Q86H 1GO1A 3CC2F 4YPZA 1YJWF 5FJ4C 4BW0B 1VQ4F 4MCCA 4YQLA 1X52A 1X7OA 1J85A 4YQNA 3OBYA 4NUTA 3AIAA 3L8UA 5FAIA 2FC3A 2JNBA 3CCRF 1M90H 1VQLF 5EO3A 2AIFA 2VGNA 3OW2F 3IC6A 1P9PA 1NMUB 1X7PA 3BBEA 3E1YA 3CC7F 3OINA 4KGNA 4RG1A 3FFMA 1W42A 4BY9D 5IT9M 1O6DA 4YQ4A 2QMMA 3RA6A 1KQSF 5EWRA 1SDSA 4YVJA 5GIPC 3RA5A 1K9MH 3QUVA 4YQ2A 3G71F
chains in the Genus database with same CATH superfamily
1VHAA 4TZZA 3N4KA 3NK6A 3HKBB 4TV8A 4YQKA 5LYJA 4XBOA 4X1YA 4BVTA 4FFBB 2Z1UA 5HXUA 4YQJA 1RQ2A 5A2QM 3PLAC 1NJIH 3OBWA 3CD6F 3FD6A 2OTLF 1K8AH 4YVHA 2L26A 1TO0A 1Z85A 4C82A 2HS0A 3CC4F 1OY5A 4YQCA 1X25A 3ON1A 2O3AA 4B45A 4DRXB 4CNEA 2KG4A 3JAMM 2RHLA 4JWGA 4R40B 3WGLA 3CCEF 3ELCA 1K73H 3IKEA 2ZVZA 2H6LA 3MCAB 1R1MA 4O4LB 3N2GA 3HKBA 1QVGF 1VQ6F 5IJ0A 4U3JB 5GAPK 3WJPA 1DT9A 2UYKA 4ZK7A 3R0PA 1VQNF 4LNUA 1UAKA 2Z1FA 3VCZA 1TVKB 1NS5A 3V7QA 1NQ3A 4B62A 3CMAF 4M8IA 3C9UA 5GANK 1IV3A 1YHQF 2K1SA 3ESJA 2OTJF 5GM8A 3EORA 1XV2A 4YQGA 3IEQA 3HJWC 3NK7A 3VYTC 5HXZA 3QUWA 4C81A 3WGMA 4ZI7A 2RHOA 1S72F 2N48A 1IPAA 1JFFB 3RE3A 3DC2A 1E7KA 5DCVA 1VQVA 2V9YA 5EIBD 2CZWA 5IJ9B 5KMGB 3CCVF 1CN7A 1VQ5F 5JCOA 2OHWA 5CA0B 5G4UC 2VXYA 4LNUB 1MXIA 3AI9X 3RYHA 5KX5A 2GZLA 4BT6A 3TD3A 4O4IA 5FLXM 3GYQA 1W581 3LWPC 3OIIA 3S02A 4X1YB 4J3CA 3G6EF 1KC8H 4JWFA 4YQBA 5HY4A 4DXDA 4TV9B 4YQ8A 2HP0A 3IKFA 4O4JA 5EZYA 4RQOA 2R751 3HKEB 5ITZA 1QU9A 3KJKA 2HS4A 3I7TA 4FFBA 3B6NA 1X52A 2IAFA 1X7OA 3K12A 3AIAA 1JFFA 1M90H 1VQLF 5EYPA 3S06A 3MDOA 3P0ZA 3OW2F 3IC6A 2HX0A 3BBEA 4BVQA 3CC7F 3OINA 5LOVA 4KGNA 2ZOVA 5CA0A 4BY9D 4YQ4A 4F6RB 1KQSF 2HP3A 3F0DA 4FMWA 3RA5A 4BT7A 4O4HB 4YJ3B 5HY2A 4TV9A 4X1KB 3G71F 2CSLA 2EWCA 3RYCB 1N8RH 1V6ZA 2BO1A 2QEXF 1VQ8F 5MN6A 3FD5A 3NVKE 1W5FA 1YIJF 1VH8A 5CB4A 3K0TA 4YQTA 1PXWA 3LWOC 2W8BC 1W41A 3N4ZA 3ZP7A 1FSZA 1W5EA 1YJNF 3SIVA 3MQWA 2BTQB 4IIJB 3WPWA 3ZOPA 3HKCA 2UZHA 2KGWA 1W57A 4ZHQA 1Q81H 4I55A 3CPWF 4PZKA 2PHNA 5HP7A 3J81M 4KDZA 2HQSC 1Q8RA 4CNDA 2HRYA 3LMEA 3IR9A 4YQ0A 5LOVB 2CX8A 3CCLF 5IJ9A 3CCSF 1VHKA 4HNAA 2PMPA 4BT3A 4EI7A 1CK2A 1U3PA 1VQMF 3WXMB 3NMUC 1W3EX 5J2TB 4YVIA 3M1XA 3BBDA 3JAWB 3K14A 2DT4A 3WGJA 5J2UB 1T0KB 1W40A 4O4JB 2YYEA 4YQ7A 4YVKA 3VOAA 2QWVA 3LWQC 3BBHA 3JALA 4BVRA 2V3JA 5D9FA 3E22A 1VQ7F 1GZ0A 4LCKA 2Z01A 3G4SF 3CCUF 3F0GA 5IJ0B 3JATA 4YQDA 2BTUA 3AGKA 4MCDA 1JN1A 1DBFA 4B5CA 2QTPA 5EYPB 5G4VC 4G4YA 3OIJA 2Z1EA 3JASB 4JWHA 2R6R1 4HNAB 4XCQA 3IEFA 4TUYB 2Z0YA 3E20B 1IV4A 3KNUA 4YQQA 1IV2A 1W5BA 4O2BB 1RQ7A 3JALB 3RYCA 2EGVA 1COMA 1VQPF 2F9ZC 4YPZA 1YJWF 5FJ4C 3VOBA 4YQLA 1VK3A 1FFXB 4NQ3A 4B46A 3OBYA 4ZHQB 2Q1XA 3HWUA 2FC3A 2JNBA 4ERHA 3S0WA 3CCRF 1YGYA 4BT2A 2AIFA 2VGNA 1H47A 4O4IB 2RHJA 3WJRA 4O2AB 3HKDB 1U43A 1W59A 3JAKB 3L7QA 5CA1B 1W42A 3JVHA 4I55B 1TUBB 3GTZA 3M84A 4X20B 5EWRA 1SZQA 3HTNA 1XHOA 4YQ2A 4G4WA 1FNJA 2HP0B 1ZWZA 4YQ1A 4RHAA 1CLIA 3D54A 3MCQA 5LA6A 4YPXA 1OAPA 4CNGA 4H3YA 4YQ6A 3ONPA 4O2BA 3SIUA 3KHNA 2NMUA 3D00A 3JAWA 4BT5A 4I50A 2P6YA 3DDNA 4ZHYB 1QAHA 4JALA 4NWOB 4YQAA 3HKDA 3JAKA 3KY7A 5LP6B 2DYYA 5FNVA 3UT5B 1XRGA 4JWJA 3VO8A 3CCMF 5BMVA 4EI9A 2LBWA 2RB9A 3WJQA 1VQOF 3KW2A 2BTOA 5LA6B 1YI2F 2HRUA 3VI6A 1ZJRA 4YQOA 4X20A 3P4EA 2HA8A 3V4DA 4O4HA 4EB6B 3ILKA 3QHDA 1YJ9F 3E5YA 2OTMA 3JARB 5JH7B 3IMPA 3ZP4A 3RYIB 3LWVC 2CHSA 2MQEA 3CG6A 4DRXA 5CB4B 3T80A 4IIJA 2UYJA 3S0YA 1K3RA 4MCBA 2G9IA 5JVDB 2UYNA 3WGKA 4IHJA 3O7BA 2OZBA 4H3ZA 1XBIA 5FNVB 3UT5A 3CMEF 3LYBA 1QVFF 3J80M 3C9RA 1GO0A 1VQ9F 1V2XA 1H7MA 3KTYA 5BMVB 4U39A 4YQ5A 1PF5A 5LXTB 3LWRC 3FBAA 4O4LA 4YQSA 1VHYA 1UAMA 2I6DA 4O2AA 4L69A 1JY8A 2KTUA 3N4JA 3VTIC 3GHZA 1UAJA 1JD1A 5MN4A 5GMBA 3PAFA 5EIBC 5J2TA 2CWJA 3S0HA 2H8EA 4ZOLB 1NXZA 2LCAA 1Q82H 4IG6A 1IV1A 4F6RA 2Z1TA 1TUBA 3C9TA 3ZO8A 5JVDA 4BT4A 5GINC 5GONB 2V3KA 4ZI7B 1VH0A 3RYIA 4I4TB 5JCOC 5C8YA 4TV8B 2KTVA 3KE1A 1UI9A 3V3TA 1GO1A 1J7HA 2UYNB 4BVSA 1VQ4F 2RHHA 1SA0A 4MCCA 3IEWA 5LP6A 4ZHWA 1J85A 4YQNA 4NUTA 3L8UA 3QTYA 5JQGA 5IYZA 5EB0A 5MN5A 5HWEA 3LDTA 1P9PA 3E1YA 5B8FA 4G88A 2CW4A 2AIZP 4TUYA 4G4ZA 4U3JA 3WGNA 2ZODA 3RA6A 5GONA 1SDSA 3RYHB 5KX5B 5AVMA 1K9MH 2AMTA 3QUVA 4YQ3A 4EB6A 1KNKA 3KIZA 2ZAUA 3ERNA 2LBXA 3Q8HA 3JARA 5JH7A 4EI8A 3D01A 3VYSC 1JJ2F 1ONIA 4JAKA 1SA0B 2ZVYA 1W2BF 4E6EA 2HVYD 3KJJA 3CXCF 2QA4F 5JQGB 4WBNB 2VAWA 3CYQA 3E22B 3U0OA 1RLGA 2Q1YA 2VGMA 3C9SA 3CCJF 2QI2A 3DCMX 3FPIA 4YVGA 4C8IA 1T0AA 2VAMA 1QD9A 2ALEA 3I3FA 5IYZB 2IQQA 2IG8A 1UALA 3RYFB 4C8EA 3I56F 5LXTA 3N4YA 1U40A 2WALA 3O85A 3NVIB 4FAKA 3JATB 2I6RA 4YQRA 3MBMA 1VQKF 4YPWA 3CPQA 3M4SA 5GIOC 1M1KH 4YQPA 1KNJA 3CYPB 4X1KA 1Z5VA 3JCMM 3VIUA 4I50B 2H8CA 5HP8A 4WBNA 2YY8A 4I4TA 4X3MA 3J7AR 3HAXD 5EZYB 2YXZA 2UYPA 1YITF 3N2KB 3S03A 4YQ9A 2ZF8A 3I55F 2FGYA 3F6MA 3VMFB 3OONA 4G4VA 1FFXA 1GX1A 2LBTA 5C8YB 1FNKA 3HKEA 5ITZB 3AXZA 4E8BA 3CB2A 2HS3A 3HKCB 4C4WC 1RA4A 2B33A 2CVLA 2EGWA 4YJ2B 4X3LA 3CCQF 4YQIA 3C8LA 2GVIA 5EB1B 3VYUC 4CNFA 1TVKA 2CHTA 3WPXA 3LFOA 3V7EA 1Q7YH 1ODEA 1W55A 3P10A 4X1IA 5LYJB 5CA1A 1Z5WA 1UFYA 5HY1A 4YPYA 4IHJB 4G4XA 5GMCA 3F0EA 3BYQA 4ZHVA 4KWEA 4YJ3A 3TD4A 3K2XA 5J2UA 1KD1H 1H48A 1RLUA 5CO4A 1Q86H 3N2KA 3CC2F 4BW0B 3TD5A 4PWTA 1OFUA 5FAIA 5EAZA 5HY0A 1YQNA 5EO3A 3JASA 4ZOLA 2VAPA 1NMUB 1X7PA 5LP6C 5KMGA 3N2GB 4YJ2A 1W5AA 4X1IB 1U3LA 4RG1A 3FFMA 5IT9M 1O6DA 2GLZA 2QMMA 3F0FA 4YVJA 5GIPC 4C8GA 3RYFA
chains in the Genus database with same CATH topology
4YQ3A 3N4KA 4TZZA 1N8RH 1ZWZA 1V6ZA 2BO1A 3NK6A 2QEXF 2LBXA 4YQ1A 1VQ8F 4YQKA 3NVKE 4XBOA 4EI8A 4YPXA 4BVTA 1JJ2F 4CNGA 1YIJF 4H3YA 4JAKA 4YQ6A 5HXUA 4YQJA 3ONPA 5A2QM 3SIUA 1W2BF 3PLAC 4YQTA 1NJIH 3OBWA 3CD6F 3D00A 2HVYD 1PXWA 3CXCF 3LWOC 2QA4F 1K8AH 2OTLF 4YVHA 1W41A 3N4ZA 1TO0A 1Z85A 3CC4F 1OY5A 1YJNF 3ON1A 3SIVA 2O3AA 4YQCA 4JALA 4YQAA 1RLGA 4CNEA 2KG4A 2VGMA 3JAMM 2QI2A 3CCJF 3DCMX 3KY7A 4JWJA 4JWGA 1Q81H 4YVGA 3CPWF 4PZKA 3CCEF 2ALEA 3CCMF 3J81M 1K73H 4EI9A 1UALA 4KDZA 4CNDA 3I56F 3IR9A 3MCAB 4YQ0A 3N4YA 3NVIB 2WALA 3O85A 2LBWA 3CCLF 1QVGF 1VQ6F 3CCSF 1VHKA 2CX8A 5GAPK 1VQOF 1DT9A 3KW2A 4FAKA 4YQRA 1YI2F 3VI6A 1ZJRA 1VQKF 4EI7A 1CK2A 1VQMF 3CPQA 5GIOC 1VQNF 3WXMB 1M1KH 2HA8A 4YPWA 3NMUC 1UAKA 4YQPA 1W3EX 3ILKA 1NS5A 3V7QA 4YVIA 1YJ9F 3BBDA 3CMAF 5GANK 3E5YA 3JCMM 1YHQF 3LWVC 1T0KB 2OTJF 1W40A 2YY8A 4X3MA 4YQ7A 3J7AR 3HAXD 5GM8A 3CG6A 4YVKA 1YITF 1K3RA 4MCBA 4YQGA 2QWVA 4YQ9A 3O7BA 3HJWC 3LWQC 2OZBA 4H3ZA 3I55F 1XBIA 2FGYA 3NK7A 5HXZA 3VMFB 3CMEF 1QVFF 3J80M 1V2XA 1S72F 1VQ9F 1GO0A 4BVRA 1H7MA 2V3JA 3BBHA 3KTYA 1IPAA 5DCVA 1E7KA 5D9FA 4YQ5A 1VQ7F 1GZ0A 4LCKA 3AXZA 3LWRC 3G4SF 2CZWA 4YQSA 3CCUF 1VHYA 4E8BA 1UAMA 4C4WC 2I6DA 3CCVF 1RA4A 4L69A 1CN7A 1VQ5F 2EGWA 2KTUA 3N4JA 4YQDA 4MCDA 3AGKA 2OHWA 4X3LA 3CCQF 5G4UC 1UAJA 4YQIA 1MXIA 5GMBA 3PAFA 5G4VC 3OIJA 4CNFA 3V7EA 3AI9X 3LFOA 5FLXM 3GYQA 1Q7YH 1NXZA 4JWHA 1Q82H 4XCQA 3LWPC 3OIIA 3IEFA 4IG6A 2Z0YA 3E20B 3QUVA 4J3CA 5HY1A 4YPYA 5GINC 3G6EF 1KC8H 3KNUA 4JWFA 4YQQA 5GMCA 4YQBA 5HY4A 2V3KA 4YQ8A 1VH0A 1KD1H 2EGVA 1VQPF 2KTVA 5CO4A 2F9ZC 3V3TA 1GO1A 3CC2F 1Q86H 4YPZA 1YJWF 4BVSA 5FJ4C 4BW0B 1VQ4F 4MCCA 4YQLA 1X52A 4NQ3A 1X7OA 1J85A 4YQNA 3OBYA 4NUTA 3AIAA 3L8UA 5FAIA 2FC3A 2JNBA 3CCRF 1M90H 1VQLF 4YQOA 5HY0A 5EO3A 2AIFA 2VGNA 5HWEA 3OW2F 3IC6A 1P9PA 1NMUB 1X7PA 3BBEA 3E1YA 4BVQA 3CC7F 3OINA 4KGNA 4RG1A 3FFMA 1W42A 4BY9D 2GLZA 5IT9M 1O6DA 4YQ4A 2QMMA 3RA6A 1KQSF 5EWRA 1SDSA 4YVJA 5GIPC 4FMWA 3RA5A 1K9MH 5HY2A 4YQ2A 3G71F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQ3 A;  3N4K A;  4TZZ A;  1N8R H;  1ZWZ A;  1V6Z A;  2BO1 A;  3NK6 A;  2QEX F;  2LBX A;  4YQ1 A;  1VQ8 F;  4YQK A;  3NVK E;  4XBO A;  4YPX A;  4CNG A;  1JJ2 F;  1YIJ F;  4H3Y A;  4JAK A;  4YQ6 A;  4YQJ A;  3ONP A;  5A2Q M;  3SIU A;  1W2B F;  3PLA C;  4YQT A;  1NJI H;  3OBW A;  3CD6 F;  2HVY D;  1PXW A;  3CXC F;  3LWO C;  2QA4 F;  1K8A H;  2OTL F;  4YVH A;  1W41 A;  3N4Z A;  1TO0 A;  1Z85 A;  3CC4 F;  1OY5 A;  1YJN F;  3ON1 A;  3SIV A;  2O3A A;  4YQC A;  4JAL A;  4YQA A;  1RLG A;  4CNE A;  2KG4 A;  2VGM A;  3JAM M;  2QI2 A;  3CCJ F;  3DCM X;  3KY7 A;  4YVG A;  4YQO A;  1Q81 H;  3CPW F;  4PZK A;  3CCE F;  2ALE A;  3CCM F;  3J81 M;  1K73 H;  1UAL A;  4KDZ A;  4CND A;  3I56 F;  3IR9 A;  3MCA B;  4YQ0 A;  3N4Y A;  3NVI B;  2WAL A;  3O85 A;  2LBW A;  3CCL F;  1QVG F;  1VQ6 F;  3CCS F;  1VHK A;  2CX8 A;  5GAP K;  1VQO F;  1DT9 A;  3KW2 A;  4FAK A;  4YQR A;  1YI2 F;  3VI6 A;  1ZJR A;  1VQK F;  4YPW A;  1CK2 A;  1VQM F;  3CPQ A;  5GIO C;  1VQN F;  3WXM B;  1M1K H;  2HA8 A;  4YQP A;  3NMU C;  1UAK A;  1W3E X;  3ILK A;  1NS5 A;  3V7Q A;  4YVI A;  1YJ9 F;  3BBD A;  3CMA F;  5GAN K;  3E5Y A;  3JCM M;  1YHQ F;  3LWV C;  1T0K B;  2OTJ F;  1W40 A;  2YY8 A;  4X3M A;  4YQ7 A;  3J7A R;  3HAX D;  5GM8 A;  3CG6 A;  4YVK A;  1YIT F;  1K3R A;  4MCB A;  4YQG A;  2QWV A;  4YQ9 A;  3O7B A;  3HJW C;  3LWQ C;  2OZB A;  4H3Z A;  3I55 F;  1XBI A;  3NK7 A;  3CME F;  3VMF B;  1QVF F;  3J80 M;  1V2X A;  1S72 F;  1VQ9 F;  1GO0 A;  1H7M A;  2V3J A;  3BBH A;  3KTY A;  1IPA A;  5DCV A;  1E7K A;  5D9F A;  4YQ5 A;  1VQ7 F;  1GZ0 A;  4LCK A;  3AXZ A;  3LWR C;  3G4S F;  2CZW A;  4YQS A;  3CCU F;  1VHY A;  4E8B A;  1UAM A;  4C4W C;  2I6D A;  3CCV F;  1RA4 A;  4L69 A;  1CN7 A;  1VQ5 F;  2EGW A;  2KTU A;  3N4J A;  4YQD A;  4MCD A;  3AGK A;  2OHW A;  4X3L A;  3CCQ F;  5G4U C;  1UAJ A;  4YQI A;  1MXI A;  5GMB A;  3PAF A;  5G4V C;  3OIJ A;  4CNF A;  3V7E A;  3AI9 X;  3LFO A;  5FLX M;  3GYQ A;  1Q7Y H;  1NXZ A;  1Q82 H;  3LWP C;  3OII A;  3IEF A;  4IG6 A;  2Z0Y A;  3E20 B;  4J3C A;  4YPY A;  5GIN C;  3G6E F;  1KC8 H;  3KNU A;  4YQQ A;  5GMC A;  4YQB A;  2V3K A;  4YQ8 A;  1VH0 A;  1KD1 H;  2EGV A;  1VQP F;  2KTV A;  5CO4 A;  1Q86 H;  1GO1 A;  3CC2 F;  4YPZ A;  1YJW F;  5FJ4 C;  4BW0 B;  1VQ4 F;  4MCC A;  4YQL A;  1X52 A;  1X7O A;  1J85 A;  4YQN A;  3OBY A;  4NUT A;  3AIA A;  3L8U A;  5FAI A;  2FC3 A;  2JNB A;  3CCR F;  1M90 H;  1VQL F;  5EO3 A;  2AIF A;  2VGN A;  3OW2 F;  3IC6 A;  1P9P A;  1NMU B;  1X7P A;  3BBE A;  3E1Y A;  3CC7 F;  3OIN A;  4KGN A;  4RG1 A;  3FFM A;  1W42 A;  4BY9 D;  5IT9 M;  1O6D A;  4YQ4 A;  2QMM A;  3RA6 A;  1KQS F;  5EWR A;  1SDS A;  4YVJ A;  5GIP C;  3RA5 A;  1K9M H;  3QUV A;  4YQ2 A;  3G71 F; 
#chains in the Genus database with same CATH topology
 1VHA A;  4TZZ A;  3N4K A;  3NK6 A;  3HKB B;  4TV8 A;  4YQK A;  5LYJ A;  4XBO A;  4X1Y A;  4BVT A;  4FFB B;  2Z1U A;  5HXU A;  4YQJ A;  1RQ2 A;  5A2Q M;  3PLA C;  1NJI H;  3OBW A;  3CD6 F;  3FD6 A;  2OTL F;  1K8A H;  4YVH A;  2L26 A;  1TO0 A;  1Z85 A;  4C82 A;  2HS0 A;  3CC4 F;  1OY5 A;  4YQC A;  1X25 A;  3ON1 A;  2O3A A;  4B45 A;  4DRX B;  4CNE A;  2KG4 A;  3JAM M;  2RHL A;  4JWG A;  4R40 B;  3WGL A;  3CCE F;  3ELC A;  1K73 H;  3IKE A;  2ZVZ A;  2H6L A;  3MCA B;  1R1M A;  4O4L B;  3N2G A;  3HKB A;  1QVG F;  1VQ6 F;  5IJ0 A;  4U3J B;  5GAP K;  3WJP A;  1DT9 A;  2UYK A;  4ZK7 A;  3R0P A;  1VQN F;  4LNU A;  1UAK A;  2Z1F A;  3VCZ A;  1TVK B;  1NS5 A;  3V7Q A;  1NQ3 A;  4B62 A;  3CMA F;  4M8I A;  3C9U A;  5GAN K;  1IV3 A;  1YHQ F;  2K1S A;  3ESJ A;  2OTJ F;  5GM8 A;  3EOR A;  1XV2 A;  4YQG A;  3IEQ A;  3HJW C;  3NK7 A;  3VYT C;  5HXZ A;  3QUW A;  4C81 A;  3WGM A;  4ZI7 A;  2RHO A;  1S72 F;  2N48 A;  1IPA A;  1JFF B;  3RE3 A;  3DC2 A;  1E7K A;  5DCV A;  1VQV A;  2V9Y A;  5EIB D;  2CZW A;  5IJ9 B;  5KMG B;  3CCV F;  1CN7 A;  1VQ5 F;  5JCO A;  2OHW A;  5CA0 B;  5G4U C;  2VXY A;  4LNU B;  1MXI A;  3AI9 X;  3RYH A;  5KX5 A;  2GZL A;  4BT6 A;  3TD3 A;  4O4I A;  5FLX M;  3GYQ A;  1W58 1;  3LWP C;  3OII A;  3S02 A;  4X1Y B;  4J3C A;  3G6E F;  1KC8 H;  4JWF A;  4YQB A;  5HY4 A;  4DXD A;  4TV9 B;  4YQ8 A;  2HP0 A;  3IKF A;  4O4J A;  5EZY A;  4RQO A;  2R75 1;  3HKE B;  5ITZ A;  1QU9 A;  3KJK A;  2HS4 A;  3I7T A;  4FFB A;  3B6N A;  1X52 A;  2IAF A;  1X7O A;  3K12 A;  3AIA A;  1JFF A;  1M90 H;  1VQL F;  5EYP A;  3S06 A;  3MDO A;  3P0Z A;  3OW2 F;  3IC6 A;  2HX0 A;  3BBE A;  4BVQ A;  3CC7 F;  3OIN A;  5LOV A;  4KGN A;  2ZOV A;  5CA0 A;  4BY9 D;  4YQ4 A;  4F6R B;  1KQS F;  2HP3 A;  3F0D A;  4FMW A;  3RA5 A;  4BT7 A;  4O4H B;  4YJ3 B;  5HY2 A;  4TV9 A;  4X1K B;  3G71 F;  2CSL A;  2EWC A;  3RYC B;  1N8R H;  1V6Z A;  2BO1 A;  2QEX F;  1VQ8 F;  5MN6 A;  3FD5 A;  3NVK E;  1W5F A;  1YIJ F;  1VH8 A;  5CB4 A;  3K0T A;  4YQT A;  1PXW A;  3LWO C;  2W8B C;  1W41 A;  3N4Z A;  3ZP7 A;  1FSZ A;  1W5E A;  1YJN F;  3SIV A;  3MQW A;  2BTQ B;  4IIJ B;  3WPW A;  3ZOP A;  3HKC A;  2UZH A;  2KGW A;  1W57 A;  4ZHQ A;  1Q81 H;  4I55 A;  3CPW F;  4PZK A;  2PHN A;  5HP7 A;  3J81 M;  4KDZ A;  2HQS C;  1Q8R A;  4CND A;  2HRY A;  3LME A;  3IR9 A;  4YQ0 A;  5LOV B;  2CX8 A;  3CCL F;  5IJ9 A;  3CCS F;  1VHK A;  4HNA A;  2PMP A;  4BT3 A;  4EI7 A;  1CK2 A;  1U3P A;  1VQM F;  3WXM B;  3NMU C;  1W3E X;  5J2T B;  4YVI A;  3M1X A;  3BBD A;  3JAW B;  3K14 A;  2DT4 A;  3WGJ A;  5J2U B;  1T0K B;  1W40 A;  4O4J B;  2YYE A;  4YQ7 A;  4YVK A;  3VOA A;  2QWV A;  3LWQ C;  3BBH A;  3JAL A;  4BVR A;  2V3J A;  5D9F A;  3E22 A;  1VQ7 F;  1GZ0 A;  4LCK A;  2Z01 A;  3G4S F;  3CCU F;  3F0G A;  5IJ0 B;  3JAT A;  4YQD A;  2BTU A;  3AGK A;  4MCD A;  1JN1 A;  1DBF A;  4B5C A;  2QTP A;  5EYP B;  5G4V C;  4G4Y A;  3OIJ A;  2Z1E A;  3JAS B;  4JWH A;  2R6R 1;  4HNA B;  4XCQ A;  3IEF A;  4TUY B;  2Z0Y A;  3E20 B;  1IV4 A;  3KNU A;  4YQQ A;  1IV2 A;  1W5B A;  4O2B B;  1RQ7 A;  3JAL B;  3RYC A;  2EGV A;  1COM A;  1VQP F;  2F9Z C;  4YPZ A;  1YJW F;  5FJ4 C;  3VOB A;  4YQL A;  1VK3 A;  1FFX B;  4NQ3 A;  4B46 A;  3OBY A;  4ZHQ B;  2Q1X A;  3HWU A;  2FC3 A;  2JNB A;  4ERH A;  3S0W A;  3CCR F;  1YGY A;  4BT2 A;  2AIF A;  2VGN A;  1H47 A;  4O4I B;  2RHJ A;  3WJR A;  4O2A B;  3HKD B;  1U43 A;  1W59 A;  3JAK B;  3L7Q A;  5CA1 B;  1W42 A;  3JVH A;  4I55 B;  1TUB B;  3GTZ A;  3M84 A;  4X20 B;  5EWR A;  1SZQ A;  3HTN A;  1XHO A;  4YQ2 A;  4G4W A;  1FNJ A;  2HP0 B;  1ZWZ A;  4YQ1 A;  4RHA A;  1CLI A;  3D54 A;  3MCQ A;  5LA6 A;  4YPX A;  1OAP A;  4CNG A;  4H3Y A;  4YQ6 A;  3ONP A;  4O2B A;  3SIU A;  3KHN A;  2NMU A;  3D00 A;  3JAW A;  4BT5 A;  4I50 A;  2P6Y A;  3DDN A;  4ZHY B;  1QAH A;  4JAL A;  4NWO B;  4YQA A;  3HKD A;  3JAK A;  3KY7 A;  5LP6 B;  2DYY A;  5FNV A;  3UT5 B;  1XRG A;  4JWJ A;  3VO8 A;  3CCM F;  5BMV A;  4EI9 A;  2LBW A;  2RB9 A;  3WJQ A;  1VQO F;  3KW2 A;  2BTO A;  5LA6 B;  1YI2 F;  2HRU A;  3VI6 A;  1ZJR A;  4YQO A;  4X20 A;  3P4E A;  2HA8 A;  3V4D A;  4O4H A;  4EB6 B;  3ILK A;  3QHD A;  1YJ9 F;  3E5Y A;  2OTM A;  3JAR B;  5JH7 B;  3IMP A;  3ZP4 A;  3RYI B;  3LWV C;  2CHS A;  2MQE A;  3CG6 A;  4DRX A;  5CB4 B;  3T80 A;  4IIJ A;  2UYJ A;  3S0Y A;  1K3R A;  4MCB A;  2G9I A;  5JVD B;  2UYN A;  3WGK A;  4IHJ A;  3O7B A;  2OZB A;  4H3Z A;  1XBI A;  5FNV B;  3UT5 A;  3CME F;  3LYB A;  1QVF F;  3J80 M;  3C9R A;  1GO0 A;  1VQ9 F;  1V2X A;  1H7M A;  3KTY A;  5BMV B;  4U39 A;  4YQ5 A;  1PF5 A;  5LXT B;  3LWR C;  3FBA A;  4O4L A;  4YQS A;  1VHY A;  1UAM A;  2I6D A;  4O2A A;  4L69 A;  1JY8 A;  2KTU A;  3N4J A;  3VTI C;  3GHZ A;  1UAJ A;  1JD1 A;  5MN4 A;  5GMB A;  3PAF A;  5EIB C;  5J2T A;  2CWJ A;  3S0H A;  2H8E A;  4ZOL B;  1NXZ A;  2LCA A;  1Q82 H;  4IG6 A;  1IV1 A;  4F6R A;  2Z1T A;  1TUB A;  3C9T A;  3ZO8 A;  5JVD A;  4BT4 A;  5GIN C;  5GON B;  2V3K A;  4ZI7 B;  1VH0 A;  3RYI A;  4I4T B;  5JCO C;  5C8Y A;  4TV8 B;  2KTV A;  3KE1 A;  1UI9 A;  3V3T A;  1GO1 A;  1J7H A;  2UYN B;  4BVS A;  1VQ4 F;  2RHH A;  1SA0 A;  4MCC A;  3IEW A;  5LP6 A;  4ZHW A;  1J85 A;  4YQN A;  4NUT A;  3L8U A;  3QTY A;  5JQG A;  5IYZ A;  5EB0 A;  5MN5 A;  5HWE A;  3LDT A;  1P9P A;  3E1Y A;  5B8F A;  4G88 A;  2CW4 A;  2AIZ P;  4TUY A;  4G4Z A;  4U3J A;  3WGN A;  2ZOD A;  3RA6 A;  5GON A;  1SDS A;  3RYH B;  5KX5 B;  5AVM A;  1K9M H;  2AMT A;  3QUV A;  4YQ3 A;  4EB6 A;  1KNK A;  3KIZ A;  2ZAU A;  3ERN A;  2LBX A;  3Q8H A;  3JAR A;  5JH7 A;  4EI8 A;  3D01 A;  3VYS C;  1JJ2 F;  1ONI A;  4JAK A;  1SA0 B;  2ZVY A;  1W2B F;  4E6E A;  2HVY D;  3KJJ A;  3CXC F;  2QA4 F;  5JQG B;  4WBN B;  2VAW A;  3CYQ A;  3E22 B;  3U0O A;  1RLG A;  2Q1Y A;  2VGM A;  3C9S A;  3CCJ F;  2QI2 A;  3DCM X;  3FPI A;  4YVG A;  4C8I A;  1T0A A;  2VAM A;  1QD9 A;  2ALE A;  3I3F A;  5IYZ B;  2IQQ A;  2IG8 A;  1UAL A;  3RYF B;  4C8E A;  3I56 F;  5LXT A;  3N4Y A;  1U40 A;  2WAL A;  3O85 A;  3NVI B;  4FAK A;  3JAT B;  2I6R A;  4YQR A;  3MBM A;  1VQK F;  4YPW A;  3CPQ A;  3M4S A;  5GIO C;  1M1K H;  4YQP A;  1KNJ A;  3CYP B;  4X1K A;  1Z5V A;  3JCM M;  3VIU A;  4I50 B;  2H8C A;  5HP8 A;  4WBN A;  2YY8 A;  4I4T A;  4X3M A;  3J7A R;  3HAX D;  5EZY B;  2YXZ A;  2UYP A;  1YIT F;  3N2K B;  3S03 A;  4YQ9 A;  2ZF8 A;  3I55 F;  2FGY A;  3F6M A;  3VMF B;  3OON A;  4G4V A;  1FFX A;  1GX1 A;  2LBT A;  5C8Y B;  1FNK A;  3HKE A;  5ITZ B;  3AXZ A;  4E8B A;  3CB2 A;  2HS3 A;  3HKC B;  4C4W C;  1RA4 A;  2B33 A;  2CVL A;  2EGW A;  4YJ2 B;  4X3L A;  3CCQ F;  4YQI A;  3C8L A;  2GVI A;  5EB1 B;  3VYU C;  4CNF A;  1TVK A;  2CHT A;  3WPX A;  3LFO A;  3V7E A;  1Q7Y H;  1ODE A;  1W55 A;  3P10 A;  4X1I A;  5LYJ B;  5CA1 A;  1Z5W A;  1UFY A;  5HY1 A;  4YPY A;  4IHJ B;  4G4X A;  5GMC A;  3F0E A;  3BYQ A;  4ZHV A;  4KWE A;  4YJ3 A;  3TD4 A;  3K2X A;  5J2U A;  1KD1 H;  1H48 A;  1RLU A;  5CO4 A;  1Q86 H;  3N2K A;  3CC2 F;  4BW0 B;  3TD5 A;  4PWT A;  1OFU A;  5FAI A;  5EAZ A;  5HY0 A;  1YQN A;  5EO3 A;  3JAS A;  4ZOL A;  2VAP A;  1NMU B;  1X7P A;  5LP6 C;  5KMG A;  3N2G B;  4YJ2 A;  1W5A A;  4X1I B;  1U3L A;  4RG1 A;  3FFM A;  5IT9 M;  1O6D A;  2GLZ A;  2QMM A;  3F0F A;  4YVJ A;  5GIP C;  4C8G A;  3RYF A; 
#chains in the Genus database with same CATH homology
 4YQ3 A;  3N4K A;  4TZZ A;  1N8R H;  1ZWZ A;  1V6Z A;  2BO1 A;  3NK6 A;  2QEX F;  2LBX A;  4YQ1 A;  1VQ8 F;  4YQK A;  3NVK E;  4XBO A;  4EI8 A;  4YPX A;  4BVT A;  1JJ2 F;  4CNG A;  1YIJ F;  4H3Y A;  4JAK A;  4YQ6 A;  5HXU A;  4YQJ A;  3ONP A;  5A2Q M;  3SIU A;  1W2B F;  3PLA C;  4YQT A;  1NJI H;  3OBW A;  3CD6 F;  3D00 A;  2HVY D;  1PXW A;  3CXC F;  3LWO C;  2QA4 F;  1K8A H;  2OTL F;  4YVH A;  1W41 A;  3N4Z A;  1TO0 A;  1Z85 A;  3CC4 F;  1OY5 A;  1YJN F;  3ON1 A;  3SIV A;  2O3A A;  4YQC A;  4JAL A;  4YQA A;  1RLG A;  4CNE A;  2KG4 A;  2VGM A;  3JAM M;  2QI2 A;  3CCJ F;  3DCM X;  3KY7 A;  4JWJ A;  4JWG A;  1Q81 H;  4YVG A;  3CPW F;  4PZK A;  3CCE F;  2ALE A;  3CCM F;  3J81 M;  1K73 H;  4EI9 A;  1UAL A;  4KDZ A;  4CND A;  3I56 F;  3IR9 A;  3MCA B;  4YQ0 A;  3N4Y A;  3NVI B;  2WAL A;  3O85 A;  2LBW A;  3CCL F;  1QVG F;  1VQ6 F;  3CCS F;  1VHK A;  2CX8 A;  5GAP K;  1VQO F;  1DT9 A;  3KW2 A;  4FAK A;  4YQR A;  1YI2 F;  3VI6 A;  1ZJR A;  1VQK F;  4EI7 A;  1CK2 A;  1VQM F;  3CPQ A;  5GIO C;  1VQN F;  3WXM B;  1M1K H;  2HA8 A;  4YPW A;  3NMU C;  1UAK A;  4YQP A;  1W3E X;  3ILK A;  1NS5 A;  3V7Q A;  4YVI A;  1YJ9 F;  3BBD A;  3CMA F;  5GAN K;  3E5Y A;  3JCM M;  1YHQ F;  3LWV C;  1T0K B;  2OTJ F;  1W40 A;  2YY8 A;  4X3M A;  4YQ7 A;  3J7A R;  3HAX D;  5GM8 A;  3CG6 A;  4YVK A;  1YIT F;  1K3R A;  4MCB A;  4YQG A;  2QWV A;  4YQ9 A;  3O7B A;  3HJW C;  3LWQ C;  2OZB A;  4H3Z A;  3I55 F;  1XBI A;  2FGY A;  3NK7 A;  5HXZ A;  3VMF B;  3CME F;  1QVF F;  3J80 M;  1V2X A;  1S72 F;  1VQ9 F;  1GO0 A;  4BVR A;  1H7M A;  2V3J A;  3BBH A;  3KTY A;  1IPA A;  5DCV A;  1E7K A;  5D9F A;  4YQ5 A;  1VQ7 F;  1GZ0 A;  4LCK A;  3AXZ A;  3LWR C;  3G4S F;  2CZW A;  4YQS A;  3CCU F;  1VHY A;  4E8B A;  1UAM A;  4C4W C;  2I6D A;  3CCV F;  1RA4 A;  4L69 A;  1CN7 A;  1VQ5 F;  2EGW A;  2KTU A;  3N4J A;  4YQD A;  4MCD A;  3AGK A;  2OHW A;  4X3L A;  3CCQ F;  5G4U C;  1UAJ A;  4YQI A;  1MXI A;  5GMB A;  3PAF A;  5G4V C;  3OIJ A;  4CNF A;  3V7E A;  3AI9 X;  3LFO A;  5FLX M;  3GYQ A;  1Q7Y H;  1NXZ A;  4JWH A;  1Q82 H;  4XCQ A;  3LWP C;  3OII A;  3IEF A;  4IG6 A;  2Z0Y A;  3E20 B;  3QUV A;  4J3C A;  5HY1 A;  4YPY A;  5GIN C;  3G6E F;  1KC8 H;  3KNU A;  4JWF A;  4YQQ A;  5GMC A;  4YQB A;  5HY4 A;  2V3K A;  4YQ8 A;  1VH0 A;  1KD1 H;  2EGV A;  1VQP F;  2KTV A;  5CO4 A;  2F9Z C;  3V3T A;  1GO1 A;  3CC2 F;  1Q86 H;  4YPZ A;  1YJW F;  4BVS A;  5FJ4 C;  4BW0 B;  1VQ4 F;  4MCC A;  4YQL A;  1X52 A;  4NQ3 A;  1X7O A;  1J85 A;  4YQN A;  3OBY A;  4NUT A;  3AIA A;  3L8U A;  5FAI A;  2FC3 A;  2JNB A;  3CCR F;  1M90 H;  1VQL F;  4YQO A;  5HY0 A;  5EO3 A;  2AIF A;  2VGN A;  5HWE A;  3OW2 F;  3IC6 A;  1P9P A;  1NMU B;  1X7P A;  3BBE A;  3E1Y A;  4BVQ A;  3CC7 F;  3OIN A;  4KGN A;  4RG1 A;  3FFM A;  1W42 A;  4BY9 D;  2GLZ A;  5IT9 M;  1O6D A;  4YQ4 A;  2QMM A;  3RA6 A;  1KQS F;  5EWR A;  1SDS A;  4YVJ A;  5GIP C;  4FMW A;  3RA5 A;  1K9M H;  5HY2 A;  4YQ2 A;  3G71 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...