The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
44
|
Knots found |
|
sequence length |
159
|
structure length |
159
|
Chain Sequence |
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVALIRISSIMPPEAEIVPLPKLPMGALVPTAYGYIISDVPGETISAAISVAIPKDKSLCGLIMEYEGKCSKKEAEKTVREMAKIGFEMRGWELDRIESIAVEHTVEKLGCAFAAAALWYK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structures of the N47A and E109Q mutant proteins of pyruvoyl-dependent arginine decarboxylase from Methanococcus jannaschii.
pubmed doi rcsb |
molecule tags |
Lyase
|
source organism |
Methanocaldococcus jannaschii
|
molecule keywords |
Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (Pvl
|
total genus |
44
|
structure length |
159
|
sequence length |
159
|
chains with identical sequence |
F, G, H
|
other databases |
KnotProt 2.0: S +31
|
ec nomenclature |
ec
4.1.1.19: Arginine decarboxylase. |
pdb deposition date | 2007-07-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
C | PF01862 | PvlArgDC | Pyruvoyl-dependent arginine decarboxylase (PvlArgDC) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(bba) Sandwich | Pyruvoyl-Dependent Histidine Decarboxylase; Chain B | Pyruvoyl-Dependent Histidine Decarboxylase, subunit B |
#chains in the Genus database with same CATH superfamily 1N2M A; 1MT1 B; 1IBW B; 1N13 B; 1IBT B; 2QQD C; 1HQ6 B; 2QQD B; 1IBV B; 1IBU B; 1PYA B; 2QQC B; #chains in the Genus database with same CATH topology 1N2M A; 1MT1 B; 2NMM A; 2OZW A; 1IBW B; 1N13 B; 1IBT B; 2OZX A; 2QQD C; 1HQ6 B; 2QQD B; 1IBV B; 1IBU B; 1PYA B; 2AI6 A; 2HW4 A; 2QQC B; #chains in the Genus database with same CATH homology 1N2M A; 1MT1 B; 1IBW B; 1N13 B; 1IBT B; 2QQD C; 1HQ6 B; 2QQD B; 1IBV B; 1IBU B; 1PYA B; 2QQC B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...