2RH3A

Crystal structure of plasmid ptic58 virc2
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
Knots found
sequence length
121
structure length
121
Chain Sequence
IQVFLSARPPAPEVSKIYDNLILQYSPSKSLQMILRRALGDFENMLADGSFRAAPKSYPIPHTAFEKSIIVQTSRMFPVSLIEAARNHFDPLGLETARAFGHKLATAALACFFAREKATNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein virC2
publication title Agrobacterium tumefaciens VirC2 enhances T-DNA transfer and virulence through its C-terminal ribbon-helix-helix DNA-binding fold
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Dna binding protein
total genus 36
structure length 121
sequence length 121
other databases KnotProt 2.0: K -31
ec nomenclature
pdb deposition date 2007-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1760 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rh3A00
2RH3A
chains in the Genus database with same CATH superfamily
1NB2A 1LWCB 2XWXA 4IRCA 2CADA 2MY8A 2YNIB 4Q2LA 3U7JA 1S7IA 1VRUA 2EBGA 4H4KC 4A46A 4B17A 2L41A 2HLUA 5EHHA 2HSEB 1OS5A 3MXHP 2AX1A 1S9EB 2GVZA 4LSNA 4JI7J 2VBXA 2B3TB 2QX0A 3AB2B 3NS5A 1IR2A 2ASLA 3NS6A 2DNYA 3DGPA 4CLFA 3AQOA 3EZOA 1SL0A 1CPZA 1BQNA 2EFGA 3MM8B 2CPXA 3MM6B 3KLGB 2R8GA 4U7UK 5LOQA 3C46A 4L75A 1XN9A 5KFPA 2VONA 2OEJA 4DV2J 4DV6J 2QLBB 2IFXA 4OZ5A 1I94F 1JJCB 1R6YA 1YKWA 3BDEA 3IWNC 4O3OA 2FLNA 3MEEB 5E3RA 2BV3A 3IXQA 1SV5B 2ALZA 2QSFA 4ZLPA 4DV3F 4FKXA 3DOLA 4ITSA 3WC2A 4V1Ak 1W26A 3QJPA 2IM3A 3ICLA 4E98A 4DX8H 2IVYA 1YSJA 3OFEA 4C7QA 3FSIA 4ZPTR 1J5EF 2W9CA 2XMVA 2XZWA 3OTEA 4HT5A 2LP4A 4CLSA 5HP1A 5F8NA 1M5OC 3QJJA 2KJVA 2C1EB 1ZTTA 2X3DA 5KFGA 2XNQA 5HQLA 3KXDA 4ECXA 3OXLA 4OIXA 4UF4A 2OPRA 2HWTA 5K8OA 3L7PA 4OYPA 1I6JA 2A18A 3H2VE 4WFYA 2DR7A 2C3YA 3H5XA 4G1IA 4PEOA 2MQQA 4RW8B 1BQNB 2F7VA 1FRKA 5DETA 1UZDA 2GIQA 2L9DA 1HNIB 2HURA 1FDBA 5CYQB 3PX0A 3EDQB 4UQTA 3HDSA 1QSSA 4ED8A 3JYTA 2C2OB 1U7LA 2GW8A 4QZVB 4WYLA 4DZDA 4F4KA 4OZLA 3I32A 4O3NA 4DV6F 3GP9A 1LV5A 3CB4A 4OX7A 4DUYJ 3NLCA 2X1AA 1IQZA 2B9YA 1IBMJ 2YNIA 4WWSA 4YMEA 4ZLJA 4B3MJ 3CD6S 5L39A 2B8QA 3N6MA 2NQPA 4LF2A 1RQ0A 4Q2MA 3TZZA 5T7LB 1HBUA 3WX8A 2P6SA 4DUZJ 3PR5B 3T1HF 4B9VA 3VQSA 4HH1A 3GE9A 4ECQA 3RB6A 2CPIA 4CCHA 4W90B 4ES3A 1WG4A 5CZXA 1SQFA 5H9EK 2Y0SD 1U1NA 3TA2A 1SL1A 4WYWA 1LK7A 5KFKA 1TUWA 2JFDA 2QRRA 2VFRA 2W2MP 3VVUA 1Q86T 5I3UB 1FDNA 5IOLA 2KXFA 3OL7A 3AFGA 4USIA 3G8SA 2LA4A 3HHLD 5DG7A 2JC1A 1O5JA 1EAYC 3PYDA 3ZTSA 4M5LA 2DGTA 2D7SA 3UDVA 4LFBF 3KG4A 2W01A 3HVTB 1FESA 1I51B 2YNHB 3EXYA 4JI4F 3BSAA 3MI7X 1MWQA 1HNVB 1HMVA 3BSOA 1VBYA 2KFYA 4C98A 3B6BA 2F5GA 1SQGA 3CSKA 3MR7A 1HHSA 3BKFA 3TP2A 1R8PA 4PUOB 5FIIA 3J7AN 4DPWA 3AXMA 2DVIA 4NLRA 1CG2A 5J1NA 1LW2B 4K7QA 3DU6A 2BJ3A 1GMWD 3M30B 1IR1A 2I38A 2YNFB 2UU9J 5CYMA 1RAGB 3AOAA 3T5HA 3ILJA 2YPYA 3EE3A 2FJWA 3CCJS 1RBAA 2YY3A 1Q82T 3QIPB 2K7KA 2ZBIA 3A8IA 3PACA 5IQ6A 5KT4A 2ADBA 1YBTA 3CJ2A 3QNWB 2W2NP 3RAXA 3DKDA 3MHYA 2J0WA 2OFGX 1YBUA 4MFBB 4ELVA 2JWNA 4QPXA 3C15B 4RUBA 3TAMB 1WF1A 2BACA 3HJFA 3U02A 4WKRA 3PM9A 4PWDA 4NYOA 4X66J 1I94J 2QMUB 3VV2B 3KG0A 2PE8A 1U0HA 1WI8A 1X4GA 1N32J 4W98A 2K7JA 2B9XA 4K4ZA 4GMKA 1UA1A 1RJJA 4RR5A 4KJIA 4NEYA 1CC7A 4EU0A 2F8HA 1L3UA 2HVHA 3FCHA 2IRYA 2D69A 2KG1A 1JB0C 1UVJA 4USWA 3QT7A 4CT8A 4EBDA 2KT2A 2YWFA 5HROA 3D1HA 3R7NB 2PA3A 2YQ0A 2FDNA 1X5SA 2MKCA 1IWGA 4F4AA 5HJYA 4FVMA 2UXBF 3CDAA 2AWZA 2OHDA 4ZP7A 4ECZA 3HZEA 2H51B 4HHJA 5L1LA 1HQ2A 2UV8A 1JLBB 4ZLNA 2LU1A 4I7FA 2NREA 1K1QA 4I1TA 2CA9A 1VK3A 2PGCA 4J5OA 4U7CA 1GTEA 4MIBA 1K73T 2B4VA 3BV8A 3UVJB 4ECTA 5AE3A 3MR2A 1HI0P 2NXEA 2OAUA 3NP5A 4Y6IA 4WJBA 2MGZA 1UVNA 2OH2A 1EZZB 1X4FA 3BKUA 1BC6A 1MROB 4ED0A 4AQYF 3MUVP 4JI1F 4DR2F 1UVLA 3R2DJ 4HT7A 2HVZA 1JLQB 4ZVGA 4DSKA 2HK3A 3MEGA 3R1LA 2YQ1A 4NLUA 4LF9J 1DFDA 1E6YB 3MM5B 4U67Q 2BJ8A 1NB7A 1N56A 2J6UA 4OI2A 2DHXA 2RDIA 2RB7A 1UFLA 4GVBA 5KT7A 3IM8A 3MUTP 1QD1A 2PA8D 2X3GA 2XYGB 5KG6A 1ZM4A 1YWXA 3ZZ0A 3G86A 5BJRA 4NX9A 1N32F 1KVKA 2NYHA 1QTMA 5KTQA 3K0JA 4KE5A 5KFUA 4ZP6A 1HD0A 2H5JB 3RU0A 4J9KA 3KLEB 4ICLB 1WC4A 2KDOA 3D0HE 1Z1ZA 4ECWA 1JQGA 3OFHA 4H4OA 3LWMA 4ZHRB 3ULHA 1I5OB 1WDTA 3KLIB 1W25A 2HNZB 3M8RA 1X4EA 2KYXA 4ZVUB 1HBOB 2JLGA 3O1LA 3FBCA 4C11A 3PVXA 1K8AT 1HA1A 3FRZA 3SBMA 5F3ZA 5B0GA 1RWXB 5KFZA 4BHQA 1RI7A 4ANEA 3FQKA 5C24B 1JLEB 4YFUA 3IMQJ 4IH5A 3VQTA 4PR6A 1FI4A 1RWWB 2AP6A 3V4MA 3CJKB 4JI7F 2WONB 4DR6F 3B82A 5AXMA 8ATCB 2UUWA 3PRDA 4J90A 4USUA 1T9TA 3UFCX 1VS3A 2HQGA 1HARA 4F2SA 5JMNA 4B3SJ 2RH3A 5L38A 2DO0A 2XB2D 3IAM9 2WW8A 1G3OA 2ZZNA 4WFBQ 2E44A 3GJSB 3TQEA 1TZ0A 2CJ9A 2PFDA 2J9DE 2VPWB 2ZC3A 4OFZA 4ZPBA 4DWIA 1NH8A 3ITHB 2H5EA 1QSLA 2E5LF 2W2QP 1NU4A 3KLIA 4OV6A 2BE2A 4RWXA 5DG8A 2VQFF 2AJ4A 2PMZD 5K8PA 3H40A 1A9NB 1H7XA 2ZC4A 5HAOA 2BJ7A 1RT4A 4EBCA 5K20B 5I42B 2QLXA 1C1CB 1SJ1A 5J2QB 1PILA 1ZM2A 3EICA 1AROP 3T41A 2QZ8A 4DX6A 3V5RA 2R2TA 1QVGR 1UVIA 2GO9A 3R27A 1NDLA 2LXIA 2PT0A 2BQRA 2J76E 2W8LA 3DOMB 3Q8QB 4G6VB 5SUHA 3MEKA 4IUFA 3T1HJ 1GXTA 2FVCA 3PO4A 4A8WA 4ZVPB 3FGVA 3KLFB 5D3GB 4QWCA 4OZ2A 1EP4A 3ETOA 3OLAA 3HVAA 3A8KA 4X84A 2R9LA 2QMWA 5LSLA 2LEPA 2JVRA 4FF3A 1IBMF 1LOUA 2GNKA 3HSGA 3MR3A 3R5AA 3LOUA 5GMEA 4QQBA 3K2YA 3N28A 4TXSA 5CCMA 1IR0A 4IFVB 3J81U 2EEYA 4KKOB 3KLHA 4ED4A 2I2YA 2IM0A 2LMIA 4RUCA 2HFUA 2GMLA 4I64A 1SC3B 4X4RA 5L1KA 1RTDB 1M0SA 3LPYA 3M2RB 3AXKA 1L3TA 4JI5J 3DU5A 4DL3A 3TVYA 2K8GA 1H2UX 2CNNB 4UZCA 1N5VA 5E41A 2DH8A 3K57A 5L1IA 4PUOA 5C7PA 3NWGA 5LL6d 2EBEA 4F36A 1FERA 1BY9A 4Q8FA 1LWXA 3NL0A 1CQMA 5A8KB 2M8DB 3ZTRA 4UUWA 4FYVB 4O4GB 1FDDA 1RHQB 2FHJD 3P5BP 3WDOA 4ZN1A 3G82A 2GIFA 1ELOA 4DV2F 4C8NA 1B64A 4CO1A 3PDNA 7AT1B 3UPFA 1GXLA 3D28A 1PC5A 3D6HB 4FDFA 3KK2B 3PKMA 2H4WB 3RBZA 3LA0A 3V81A 3S6EA 1VQ7S 2QN6B 4V19J 4ES1A 2WOMB 4PWDB 1P1TA 2XMMA 2C2RA 1S7HA 1B70B 1A6LA 3CJRA 1VQYA 4O3PA 4Z7CA 1KN6A 3SZ2A 2EPIA 3SFUA 2HS4A 4ILLA 2DCLA 3AT1B 1FVSA 4ILRA 1RLDA 2ZKTA 1YTYA 4LBHA 4XO0A 3VAMA 1NEEA 4NLGA 1RTHB 4HKQA 1NPRA 3FCVA 1IBCB 3FDSA 3N4WA 1AUDA 1RT3B 3CW2C 2F3JA 2KRRA 3QT8A 2VG7B 4PQAA 2YH1A 3ILOA 3R7SB 1S72S 3IS9B 2B8PA 5JVHQ 3PYFA 3RB3A 4DOZA 2DNRA 3DN9A 4FXDA 1ITPA 2J8AA 2QIFA 1VIXA 4JI4J 1S0MA 4DR4J 3A13A 4HI1A 3LALA 4F3QA 5KAKA 1T03B 3UQSA 3CCES 3THTA 3I0RA 2ZUAA 4WZMA 1NSQA 5E3AA 3GFZA 3T5KA 3KJNB 5CYQA 3ZZOA 1ZM9A 1U47A 1HWLA 4IRDA 1RK8A 2FJAB 3BF4A 4CNZA 1J5OB 2RQMA 2E29A 4M5NA 3DFEA 3DGVA 1N0UA 1ZPWX 3M32B 4CDIA 4ZLLA 2R2RA 1H74A 2ZBCA 1K44A 5HI7A 1FF2A 3A3NB 1ZA1B 2B4OA 2AF6A 3I82A 4I7FB 5K14B 3J80Y 2R8IA 2RQCA 1SXLA 4ID5A 3PIOQ 5DLFA 4OX9J 1NK0A 3UNYA 2GV1A 3US5A 3KJVA 4CO2A 5K14A 3IR7B 1PBAA 4F02A 2NPFA 3P3DA 5F8JA 5HP1B 4F50A 2HLTA 1A7GE 4I2QB 4EZ9A 2EFOA 1FWPA 4IOAQ 4OJHA 2XSFA 5I3PA 4CYUB 2M5YA 2ZH2A 4FXWA 2F4FA 3GIRA 2MSSA 4RJVA 4K8RA 1MWYA 1RWMB 2YWGA 4O23A 3UWTA 2M9KA 3BPSP 3QSYB 1TKDA 4DUTA 4UY85 4C97A 1VISA 1VQLS 1KTQA 2COLA 2F1FA 1H7WA 1XMBA 2FHKA 3MTJA 2VBYA 3C66A 2XY6A 2ROEA 1YHQS 2X51A 2EG2A 2RRNA 2DYAA 1KNZA 4EZ6A 1FE0A 2FIUA 4A48A 3GIIA 4YS2A 1RHJB 3DOKB 4XPCA 1R31A 4P2SA 1IKWB 2SXLA 1RWNB 3ILIA 3I6PA 4NZ7A 1UJ4A 1RA7A 3POTB 4FXVA 4DFJA 1HPZB 2WBRA 5GADI 1XMOF 1TVRB 1NK7A 1HHQA 3UN5A 1ZS6A 3PW2A 1YJ9S 3QFWA 2GA7A 2ASYA 1PYSB 4P6QA 3PW4A 4NMLA 2CQGA 1S99A 1RT2B 2AZ1A 2FD2A 4LSNB 2U2FA 4DXLA 1M1GA 4LR7A 2ZJPQ 2W1BA 2HW3A 4K59A 3FCWA 1HW9A 2YNFA 2XHWA 2P8IA 5HVGA 2EC0A 3MM9B 4XAKA 3W2WB 1XMQJ 1HBMB 4LRCA 5B0AA 2QYCA 1S49A 2BANB 1WC3A 3EVOA 2HMIB 1EETB 3A12A 3WZ0A 4FZVA 1S1XA 1JLFA 2FY8A 5HBMB 2BJEA 4WU3A 4X4TA 1NK6A 2C3OA 2VA2A 1O8BA 2WB4A 3QPIA 3LW5C 3P5TL 2A10A 2MDAA 1NHKL 4AYBD 4DR3J 1U48A 1R89A 4Y0FA 4NLTA 4WK3A 1XNRF 3D4JA 1NJZA 1WC5A 4DX7A 2DNGA 2QFIA 4USKA 1XTZA 3VTIA 1RT6A 3LP0B 3PG9A 4C2MA 4TU7A 2G0IA 3FQLA 5FDLB 2XO6A 4QYZJ 3F0NA 3Q8RB 3DXSX 3M2RA 3EDRB 3KHGA 2M70A 3Q86A 2VDIA 3HI9A 5DO2A 3PJ9A 2RU9A 3MZIA 5E7OB 2UUAJ 1OPZA 3N5FA 5I3UA 7FDRA 4KC5A 2ATLA 3TZWA 3H59A 2RJZA 3Q8PB 2NZ4A 1AXQA 2DTJA 3TQ1A 2HQIA 4GRSA 1FFWB 1VMBA 2CQIA 4L3NA 2L9NA 2R42A 4Q45A 2WSFC 5KT3A 3C2PA 4RBTA 2HBRB 3JSMB 2B4PA 1XBWA 4TQRA 2R7WA 3V4IA 5DM7Q 2UVUA 2X1FA 2R7TA 4IG3A 3BEGB 2AYEA 2GS8A 3VF0B 1NSPA 2XYPB 1PJ7A 4QIGA 4OHZA 5A6WA 3J7A1 4CO4A 3QO9B 2DGWA 4AD6A 4C6AA 4RUAA 4CH1A 2Y9HA 4AE5A 1Z4UA 2MKJA 3Q8SB 4DS4A 1NJIT 3CCMS 3EUNA 4ZJLA 1HI8A 4N76A 3C6UA 1NDCA 5D78A 3I4HX 3M2UA 3TX0A 5GAGU 1N33J 1X5TA 3GYXB 1LEOA 1KOHA 4ZHRA 1SUQA 2MKSA 2CWKA 2EFNA 3VR1A 1PC4A 4X4QA 1VC6A 2PN6A 2MHEA 2J0QD 1R6VA 3HP6A 4DFMA 5CD4A 3CMAS 4AL6A 3ADAC 3CXCR 2FHMA 5JVGQ 3V81B 4I2PA 4A8QA 2MZTA 1N33F 4MMOA 3CTRA 1RWVB 2YKQA 2Q6BA 4YB1P 2F4VJ 2ZH8A 1NSKL 2VHGA 3NXZA 2ZUGA 4K5RA 4P2FA 3W62A 5A8RB 5MLCV 5D4OA 3IM9A 3PRBA 4EO8A 1T05B 4LF4J 2D3OR 4RU2A 4D3HA 3VHQA 4KH1B 5JUMA 3PYGA 4OHVA 4JI6J 3VGTA 1KKHA 4C8MA 4P2MA 5LMUF 4DR2J 3BBFA 3LP1B 4CLTA 4LT6A 2GVDB 2QA4G 2HWHA 4RU9A 2HZCA 2Y1JA 2P5VA 1S10A 3KMQA 1HBMA 2J0XA 3NGUA 2B9EA 4MIAA 3M8ZA 2PD1A 1V9OA 4F0KA 4Y2MA 2HFOA 2Z56B 4RNHA 3KLHB 3MAAB 1RE1B 3QLHB 3U1LA 5C2CA 1OJ4A 2NXJA 4MYTA 4QPTA 3MCMA 4OZJA 1WC0A 4O44B 4I2PB 1IM6A 3CMES 1FNMA 4X65J 4RW9A 3CDEA 3D67A 2DRAA 1WOSA 2E9ZA 3MM6A 1RXOB 3KLGA 1T3OA 4N7TA 1X4HA 2DK2A 2D3O1 1RLCL 4CP5A 4KHPF 4PQUB 3H7HB 3GIKA 2BXJA 3DNCA 4RL1A 1HR0F 2RIJA 2WAQD 1M5SA 1FEEA 4USMA 1VQPS 1AZSB 1WORA 3BM7A 4RBUA 4U95A 3MR5A 4OYIA 3G8QA 1QUVA 1EJ7L 4I4BA 4ZCKA 1NK4A 3Q83A 1B3TA 4LFBJ 3CT9A 1KFDA 2BVZA 2DPIA 2VG7A 4BWMA 5DM6Q 2ZM6J 4F26A 1S79A 3BQ2A 1R43A 5BR8F 1RYSA 4N8OA 2H65B 1PJ6A 2CAJA 4DLGA 1DTTA 1S6OA 2E5GA 2MKHA 2LDIA 3DM2B 3KMSA 3MPUB 2ZJQQ 2WHOA 4ES2A 3J7Z5 2ALYB 4NXNJ 1HKAA 4Y65A 2CDRB 3OFFA 2VKZG 1WD6A 2CJYB 2OPRB 6FD1A 5C5JA 4JYAJ 4IFYA 1WTBA 5K8MA 1YJNS 2E5HA 2NXNA 3P8BB 4YHHF 2IDEA 4RW6A 1T9WA 2NLWA 4WXOA 1WC1A 2RDJA 3FSXA 4AFFA 1PO6A 5F8LA 4K4YA 4DF4A 4QBUA 3KDNA 3PR4A 2NXCA 2P2CB 2PMWA 4KHRA 4URSA 4YY3J 3AJ2A 3FJ2A 3LP1A 4P71A 2BRKA 4KBIA 4DS5A 2X1BA 3UDCA 1MG7A 2C42A 3R1HA 3T1YJ 3EVMA 2HBYB 2E7XA 1MMLA 4LFAJ 4QR2A 1XWLA 2BJDA 2F9JA 3R3TA 4JI2J 2CQ4A 4C11B 1EETA 2ILYA 3HULA 3LQVA 4DL5A 3OL9A 3C16B 1VHFA 4F3OA 1NBEB 1Q79A 1VHIA 2V5HG 3G2XA 1TELA 2BOPA 2CPHA 4ZPAA 1NSAA 1RT5A 1SI9A 2OPSB 2N3LA 2OPPA 2DR5A 1RTHA 4DN0A 1RT2A 2XNRA 3NEKA 4ZCIA 3RB4A 1U1LA 1WKLA 3TUPA 3MTKA 3OSNA 5J2NA 4C8KA 4X4VA 2LCWA 3DMJB 4ZJOA 1GMWA 2JFKA 3MPVA 1KQFB 1HYSB 2HFSA 2K06A 2R7OA 2D41A 3IC1A 3RW7A 2QLWA 4PWUA 3J7YI 3G8TA 2VH7A 3D5MA 1AYEA 2AYGA 2QEXS 2DGXA 2MLYA 4OYBA 1S5ZA 1UEUA 2UUBJ 4PPDA 1VFJA 2KVQE 3NAHA 1P9QC 4FS1A 3PX4A 2D9OA 3D6TB 4UTGA 2UUBF 3QAEA 1WI6A 2HQFA 4G1QA 4I6AA 2DR9A 1NH7A 4NRUA 4QOTA 2HFNA 3KJQB 3ZTPA 2Z30B 2POKA 5KT6A 2R8KA 1F3VA 3DLGA 3R9LA 1JJHA 3JSMA 2A2DA 5GAGI 2MTLA 3QRQA 1E6VA 2KYZA 4KO0B 1TP7A 2C2NA 4AL7A 2R7VA 4DG1A 1EB0A 3T1YF 3D66A 1TKXB 1UVKA 2UZAA 2RSQA 1RWUA 3QGIA 9RUBA 2KM8C 4UW2A 3ENAA 2NUHA 3DRPB 1VGYA 5A76A 3IWLA 1V6HA 2DNPA 3MURP 3R5BA 1LW0A 3H25A 3T6BA 2I1RA 2OKQA 3RGIA 2FGCA 2IMWP 3HHLB 1RT1A 3MF5A 5CABA 1UVMA 1T95A 2BJ1A 3Q2SC 1F5CA 3GSIA 2V4QA 3GILA 2VOOA 5H9EJ 1C4CA 1NNDA 5I3QA 1U4BA 4PG6A 2UXCF 2ZDOA 4OI0A 3ZTOA 4PCQA 4USJC 1VK8A 1U0HB 4ZDNA 2DIUA 2WONA 3IA0A 3JQKA 1SV5A 2KT5A 1B4SA 5IM0B 3I5BA 3OL6A 2DXFA 2XLJA 4HEA9 3IR5B 4K5SA 1VYAA 2V8VA 1N8RT 3M8YA 2E9RX 2VC1A 3DC2A 5FLXU 4DR5F 1S6PB 2Z4PA 2BW2A 4NXNF 3JYTB 3THPA 1N6QB 3KK3A 4V19X 3MMJA 4Q0BB 1R8BA 3OHBA 2BM1A 1HNIA 3CCZA 1YLXA 3SQGA 2FHOB 2V34A 2JZ5A 3MD1A 2FVSA 1TAUA 2CZ9A 4HHHA 4QYZK 1S1UA 5KG4A 6AT1B 2G2YA 4FBUA 3DRXA 1FNXH 4HDGA 5DS7A 1NZ8A 5MAOA 1RDRA 3X3UA 4ZK7M 1IQTA 2VF3A 1NK5A 1TMJA 5B09A 3TWZA 4IR9A 5J1EA 3UCGA 2CQ1A 2D74B 3I0SB 4WPAA 7FD1A 3IWXA 2W2OP 3SCIE 2IYGA 2YTCA 4KYZA 5J1PA 5A8WB 4WFNQ 3U27A 4DV0J 3EGZA 1HWJA 4NA1A 2VG5A 1WF0A 2FLOA 2AZ3A 2B7CB 3HHKA 1P9YA 2HPUA 1JNRB 3N6LA 2G0JA 1WDDA 5F0UA 2YH0A 2KU7A 4CIOA 2XLKA 2DY1A 4HTIA 5GAHI 3BH7B 4CWBA 2JL9A 2GMJA 4F8RA 2BQUA 2IJRA 2DGSA 1GX5A 1OSCA 2YKMB 2YQ3A 3N5BA 3MDFA 4WIIA 5IWAF 1I1GA 4S0MA 4X65F 3MD3A 1VC0A 4DQIA 1FCAA 1FJ7A 4DL7A 1FRJA 2F8EX 2XY7A 2DPJA 2XBPA 1YIJS 4RZRA 4TYAA 2CUYA 4OMFG 3VAHA 3SEOA 2VPXB 3LWLA 2AGQA 1RADB 2UVVA 4IOCQ 2OP5A 3FZBA 3OTBA 4OJ1A 2KH9A 3J81Y 4I0WA 1TL3A 3AAWB 2HBZB 2XI3A 1RHKB 1T94A 3P4UB 4NCGA 5EWEA 3TEGA 4K4WA 4ECSA 4E0DA 3OTOF 1U24A 2I8EA 2KB2A 2AEMA 2DGUA 2N82B 5E3QA 5J2PB 5C25B 4IRKA 1R0AA 2AHOB 3BO3A 2YKAA 2AX0A 4O3SA 2BKPA 2YKOA 9ATCB 4P9SA 3FVYA 3DLGB 3HSZA 1S48A 3HKZD 4IYQA 1EQ0A 1VLOA 4NZ0A 4NI2B 3OTCA 1XNQJ 1N5TA 1Q7LB 1U25A 1X5OA 3M8WA 4OYZA 2JH3A 4PQUA 1Y10A 3WIUA 3MM9A 3TAMA 3UN3A 3W1YC 4J9RA 2UUCF 1MMDA 3ISND 3CGIA 4HH0A 2A6OA 2R4FA 1OYEA 2FQQB 2BOAA 4IQMA 1RB0A 3LAMA 1H98A 3LF0A 2DNMA 2VKRA 3M6UA 1A0OB 1LWFA 5DRKA 4F25A 1FHTA 3G6ES 1RABB 2MPUA 2W4PA 3HT3A 1NO8A 2OSRA 2J7UA 3AOBA 2EXUA 2V4JA 3H20A 5K9FA 4C0OC 4NYZA 3GIJA 4DEZA 2OPSA 4RNMA 3CCQS 2DRBA 2HNDB 4I6WA 4O3RA 1JLCA 2MB0B 2Y8YA 3HHDA 5FDLA 2CG8A 2DH9A 2GAGC 1UP1A 2YWKA 4OI1A 1RT6B 2RE1A 3A3OB 4C3LA 4ZIWA 5AXNA 2QFJA 3K5LA 2OLWA 1RAHB 2Z8QA 4Z2XA 2GGPA 4EYHB 1AB8A 4DCJB 5B0CA 1X4CA 1MSWD 3DLJA 1HWUA 2V50A 3NRBA 4URGA 4DX5A 2LKZA 4LSLB 3R6LB 3EPGA 4DR7J 3GG0A 3NCRA 3AHPA 2WBMA 4K2JA 3EGNA 3SCJE 3OUYB 3VAGA 3DLBA 3CJ3A 3V6DA 2X1GA 3DHWC 3W2WA 3WIVA 1FO1A 2FHJA 3EYZA 1BXNA 3CWJA 4HACB 2VDHA 3I96A 2HGMA 2ZBRA 4B3MF 1CULB 2HQDA 3MFIA 2ZH3A 4UQGA 2DB1A 3PZPA 1UCNA 1HYSA 3MAHA 2DNZA 3MPDA 4CI0B 3A4TA 5DGBA 3OJSA 3TUZC 2ATCB 2VASA 2ZZTA 4DHVA 1CULA 1Y3KA 4E2FB 4BWJA 4UY8T 3GONA 2LVWA 1SPBP 3PFOA 4UT4A 5KFNA 3KKFA 2C3PA 3DOKA 3BYRA 1D09B 1Q5YA 4R0JA 1SC6A 4ILMA 1B7FA 5KFOA 1S59A 3CJ8A 1YG0A 1VJWA 1T8EA 2OJ3A 1S1TA 1Y5NB 4LRBA 3E3XA 4DV1J 1AW0A 1DQAA 1T9XA 4PG7A 4ZP9A 1OY8A 4ZVOB 4NCBA 1HLWA 2FC8A 3UDLA 1S1TB 1TL4A 4KGVB 2QT7A 2XO7A 4DQRA 5LMNJ 2QSWA 3KHLA 2XY5A 1Q7YT 2AJ0A 3TUJC 4J37A 1G6BA 1WWHA 3U1MA 4TLQA 4YR3A 3SCLE 4DR1F 2LECA 2OELA 4KGXB 4X62F 2JLEA 2NXUA 4J9LA 1D9DA 2EFVA 4NLQA 4IH6A 4OYAA 1VQ8S 1GH8A 3LTOA 1F5BA 4RW6B 1KD1T 1ICEB 2DISA 1C0UB 2AW0A 1ZAWA 5B08A 2C3UA 4TY9A 2J8SA 2JEJA 3H90A 1CJVA 1LWFB 2RRBA 2OI2A 2VV5A 3OR2A 4YQWA 1UWAA 4NWBA 3BO2A 4MJKA 4WFAQ 1HNWJ 2UU9F 1N34F 1XMQF 2RF2A 5D0RA 4ZPCA 2GAHC 1QAJA 1Q8LA 3DLHA 1D3WA 4XDCA 4ATNA 1D9FA 3LGHA 1VJQA 3R2CJ 3ISNC 1P8GA 4M5HA 4EI2A 4YY3F 3G96A 3CJ4A 1KOOA 2MZ1A 2A0FB 4HLBA 3W5XA 5A8KA 1S6UA 1UPPA 3OQ2A 5G0RB 2WK4A 3TR5A 4A8XA 2PI5A 4AT1B 3CDBA 3B8HA 3I0SA 1Q4RA 2DH7A 2Q3PA 1FXRA 3EGVA 1FX4A 2ZH5A 2CPZA 5DLGA 2CQPA 1NPKA 1OIAA 3E8OA 4F4WA 4B9TA 2CQ3A 1BD6A 3KLEA 1IUJA 3RR7A 2C2KB 2ZZMA 2VZ9A 3TOQA 1VBXA 1JNZB 2M7SA 4ZJQA 5CCLA 1FKPB 3MM7B 1IBKJ 1ZZFA 2R7UA 1S4FA 2HFVA 1ZOTA 1H2VZ 3C19A 1SBRA 1F9HA 2DHAA 4IFVA 2OMOA 3LANA 3QIPA 2ZM6F 1N5YB 2Q1LA 1X4BA 1PBUA 1H72C 1RAJA 2G2ZA 4X66F 3IGNA 1JJ2R 3DLKA 2DHSA 1ZAXA 3HK2A 1V3ZA 2DY9A 1DTQA 3TVKA 4MIWA 3ZZZA 3KUEA 4PXEA 4FF1A 2N4CA 3TA0A 2P6TA 4DSFA 2O01C 2Q43A 1TAQA 1EKSA 2CKWA 2IDLA 2MQLA 2RNEA 4ER8A 3UR0A 5B0FA 4X4UA 3HM9A 1PGZA 5CXTA 2FC9A 2DCUB 2RILA 4KHMA 4NLXA 4QR0A 4USHA 3SMZA 4ZPVR 3FZ2A 2W2PP 4DUYF 1X9MA 4M1KA 3OSPA 2C3MA 2ZH7A 1H73A 2FZKB 3LAKA 1PIEA 1HL6A 3IBFB 2MJNA 2I6WA 5CAAA 3J80U 5J2PA 4K4UA 3ELHA 4U96A 2VJVA 4OV1A 1RSCA 4DMZA 4JYAF 1C4AA 1Y3JA 3HT0A 1TL3B 4JBCA 4C0BA 1RTIA 2BDPA 5LSRA 3WQPA 3H8YA 3P49B 2QJ3A 3JXOA 4LVOP 5BYSA 1YITS 2DNQA 2AV5A 1YGYA 4ICLA 1XEZA 4QIWD 4UUXA 4ZA1A 3I56S 2E9TA 3OTOJ 3QZ8A 1BLUA 3K89A 1C1BB 3M2UB 4LIWA 1XR7A 5AT1B 5HQMA 1N6QA 4C3MA 4MH8A 3EX7B 2MQNA 1ULRA 4J9NA 1PSDA 1FDAA 2VG6B 3C8YA 2IBOA 4ETZA 2MQOA 4BDPA 4X4NA 1HBUB 3J7YU 3M8SA 3KTQA 4KV8B 4M94A 4LF7F 3QGGA 2GJIA 2IJFA 2KHCA 3BPDA 3BS9A 3BSCA 1X60A 3KOAA 1S9FA 3CJKA 3I55S 3KLFA 5D3GA 2JJ4D 1UPMB 4QWEA 3T9ZA 2ZFHA 3Q8VA 3D7SB 4PWWA 2OD6A 3WC0A 4G1PA 1UW4A 3GMGA 4P74A 1LQ9A 2I9SA 4LFAF 1VLYA 3OPKA 4F7VA 2XC9A 1R7IA 1WG5A 5IT9U 3G9CA 4B3TJ 4DBQA 1VQMS 3NY0A 4FBTA 1I3OB 5HQ8A 4KIAA 2KKHA 2CJBA 4LFCF 1FRIA 5EGYA 3HZGA 1HPZA 1F60B 2CPFA 1NM2A 3P96A 5CHCB 1SKUB 2X7IA 5GAEI 4WTOB 2LU2A 1AUSL 4P72A 1DLOA 1CJTA 2I0XA 3Q0AA 4OZ3A 4QU6A 3MPWA 3CNQP 2LFVA 5F0WA 3OHAA 2PO4A 4F3MA 3FMWA 5HVFA 4DG1B 3BGOP 1NMEB 4OQJA 3UD5A 2VQFJ 2XS2A 1TKTA 1B0PA 4TN2A 1QE1B 1Y0HA 2G0CA 4IO1A 4GVBB 1JKHA 2W9CB 4R25A 4GC6A 3CCWA 3G6XA 2O5DA 1RU2A 2YKMA 5LXRA 2C22A 2ZHOA 4URQU 4X64J 2Q66A 1R8AA 1ROFA 2BE9B 3V6JA 1JLFB 2MSTA 1DBDA 4LREA 5BR8J 2EKNA 1FKAF 1U6ZA 3RUBL 2IIHA 2ZNZA 1M5HA 1DTQB 4RW4A 5D4LA 2Z2MA 3FFIB 3M7VA 3W7BA 2XQCA 3KK1A 3M6VA 1Y7PA 3QMQA 1SH2A 4RPFA 1XJWB 3DDKA 1HBOA 4W92B 3W61A 1LW0B 4CLKA 4XPEA 5RUBA 1FWLA 2J7WA 3BGFA 4DI6A 4DF8A 1N5YA 1N36F 4B9SA 4LF6J 3DRPA 3I4PA 2HVIA 1XNRJ 2ZITA 4CM0A 3H0PA 3MEDB 4EWTA 2WB1D 3HX9A 2HQCA 2WRMA 5AXKA 3EGWB 5FD1A 3ZO7A 5L1JA 4L76A 1CJKB 4ZVRB 5JXSA 3JAMU 2W9BA 3HFKA 5KFVA 1F5AA 2MZQA 4X4OA 3T5JA 2GQCA 4P73A 3NGSA 5LSOA 2W9AA 3D9BA 4L72B 3CJ0A 4YB5A 4ED2A 5KFYA 5LXYA 1WNEA 2PFFB 1P27B 4KHPJ 1QM9A 4A8SA 4HVZA 4X64F 3W2VA 1PYTA 1OY9A 2DNHA 3G6VA 1U49A 3C14B 2APOA 5KFSA 2QLFB 5KFFA 4X62J 2E1CA 3QIDA 1Q16B 2YWWA 2CIMA 3HSDA 1KS2A 4NE9C 3GIMA 4NASA 2XCAA 4QWAA 2DR6A 4JP8A 4LMZA 4KFBB 3CD0A 4DUZF 2HKEA 2RKIA 3M8QB 1FKOB 1MMNA 2GFFA 3DMJA 3D3BJ 3H2LA 4QIEA 3M05A 4RNFA 1URNA 2ACMA 5HJXA 2OUGA 4A8KA 4ERDA 2AJFE 1GTHA 3A8EA 3MGJA 1NJYA 1FKOA 1VC5A 2RDDA 3QZ7A 1DHMA 1NJWA 5KG5A 4ZVEA 4M8LA 4J7CA 3LPEA 1G7CB 2HHSA 1J5OA 1GK8A 3TARA 3AJDA 2OTJS 2BR0A 1UFKA 1N52B 1YVFA 4OJ3A 4FF2A 1UTAA 2L48A 3QQCD 1SJRA 1H6KX 5ETSA 2JHEA 4A8YA 4CLWA 1TK5A 4ZMMA 2ACYA 1R3NA 2ZVIA 1BHNA 4JI0F 1HHTP 2IMOA 5HL7Q 4WF9Q 1GMVA 2PSZA 4UOHA 5ETMA 1JMTA 5GVQA 1TK8A 2HNZA 2Z57B 2ZVSA 1VIOA 4I69A 4IG0B 3SI8A 2XMUA 2JEFA 1VRTA 3GJRB 2EI5A 4OI3A 5KFDA 1HNZF 1JIHA 3CJTA 3H5SA 2MY7A 4DQSA 1RKJA 1RP5A 3OXFA 2IYIA 1QJHA 5J2NB 5EWFA 4PXBA 1YI2S 2M88A 4HTJA 4F0HA 2M0GB 4F67A 1U2CA 2BX6A 3HSJA 2JEIA 3KK1B 4K4VA 1SL2A 2H4YB 2O66A 4DFKA 1NRKA 4NEZA 5T14A 4NLPA 2N3OA 1HWIA 2AEFA 3N0VA 4P7VA 1NHVA 2J6TA 4DL6A 4N41A 1QVFR 4LF8J 1RTJB 4QR1A 3EXCX 2ASJA 3KK3B 1U09A 1ZETA 3LO3A 4IG3B 3MECB 1AZSA 2L08A 2XCPA 4KQZA 1SJ4P 1TL7A 1Q5VA 3AODA 4ZVFA 4Q7AA 1QAXA 2AKWB 4OX8A 5GMDA 1PAUB 2ABYA 2HS3A 1HFEL 2UVRA 3CVKA 4JV2A 5B0EA 3R5JB 3AD9C 5A8RA 4C48A 2IRUA 1TFYA 3TEHB 1KTVA 2BE7D 5J2QA 2VFVA 3MMAA 4RW8A 2QC3A 5A6PA 5I42A 3CJ5A 1DLOB 4OJGA 3D2WA 2PC6A 4NXMF 3NNCA 3OR1B 2DXDA 4IQXA 2HHXA 3MWBA 2HAIA 5K5MA 2BE2B 3IG1B 4Y28C 4O44A 1V3SA 4IFYB 1TUGB 4N56A 1Q8IA 4ID5B 3CF5Q 3ITHA 5EDWA 4DV4J 1IBKF 3DGPB 4LF6F 4FF4A 2R3VA 2CQBA 2CZ4A 1WTFA 2ZOFA 4YB6A 3JAMY 2W7OA 4BS2A 2QV6A 4KFBA 5ETLA 2VL1A 4EK2A 1Q0NA 1TL7B 2FUG9 1ZBTA 2MMYA 4K4XA 1KHVA 1SH3A 1VQKS 4N8NA 1F3FA 3GV8B 1S0VA 2QLJB 4G1QB 1B7YB 2HMIA 3FK4A 3L9ZA 4YDXA 4DPOA 1L3SA 1S6QB 5L9XA 1YJ7A 1S1VA 4CLZA 2Y1LB 2NPIA 5A2QU 2VG6A 2J9CA 4B3OA 2LLZA 1FFSB 1SQEA 3CDWA 2ZDPA 1NPPA 5F9LA 2ZWPA 4JV5J 1S57A 2B6AB 5B0DA 2AQ4A 1U1MA 1FRHA 3UNGC 3OBIA 2QL7B 4HYKA 1FNOA 3K8VA 1NHUA 4QIVA 5DDPC 5DJBA 3LGNA 1AT1B 3POTA 1WKKA 3SFGA 2G9OA 1HBNA 3C3LA 2F4VF 3CJQA 5A0YB 3M1VA 4OHYA 2V8PA 5AE1A 1K0TA 1U1QA 2A6MA 1T11A 2LEAA 3MCSA 4N77A 4CTAB 1HWKA 2JOQA 3MAQA 1DZ5A 5KFIA 1BWEA 2FGOA 2OPQA 3F44A 4HR2A 1TR0A 3NKYA 3PEJA 3DRRA 4HHUA 2QE5A 4Y2CA 4DL2A 1CLFA 2GQQA 5HN0A 2CG4A 4MT1A 2YX1A 4O4GA 3ZZTA 3QRPA 3QWPA 4OYOA 2CQ0A 4DV1F 3UO0A 5H9FK 2RS2A 2RF2B 5KG2A 1X31C 3L3CA 4KGKA 1JKHB 4B9MA 3J7ZT 2VFUA 5GAEU 4IH7A 1KVIA 4B9NA 3RYLA 2DT9A 2JNJA 1RBLA 3SDEA 3N9UC 3H4DA 4FYDA 2KG0A 1UWBB 2CQHA 2E1MC 1ZA2B 4KH0B 5A0YA 1D9AA 4CO5A 1CJTB 3TZXA 3VAIA 4FKYA 4JB8B 3A3PB 4Y3CA 3MMBB 1SIWB 2XG8A 2P9GA 3MR6A 1T02A 1X7VA 2FVQA 1JXVA 4M5DA 2BRLA 2BKOA 2GX8A 1FD2A 2VODA 4DV3J 2UV8G 3FNNA 2VPZB 1IBLJ 4LR9A 4ANCA 4O3QA 4A8OA 3S8SA 1FJGF 1VI7A 3FC9A 3PRVA 3M8PA 3I0RB 1Q53A 1F2HA 5CH7B 1XC9A 5G0RA 4DPXA 4DR7F 4LRFA 4WP3A 1XNQF 5AJ3F 2HFZA 4NI2A 1L5UA 2ZE2A 3HF5A 2RT3A 1QAYA 2V6AA 3HD2A 2Y1IA 2EKYA 4BC9A 2UVWA 1WOPA 1YJTA 3I5AA 4KTQA 5H9FJ 1N34J 4C8ZA 2CPEA 2RMLA 2BEFA 4M5MA 5I4MA 2XSJA 4JV0A 3VZIA 3UCZP 5HLFA 2E5IA 3DYAB 4EBEA 1PAEX 3M4XA 5CZVA 1VRTB 2HRTA 3BJYA 4KT0C 1RT7A 1YRXA 3GLJA 4GC7A 2FLPA 4RW4B 5E3PA 4P52A 1H0HB 4ZS6A 3B54A 3GFXA 1UAWA 1VQSA 3O6QA 4DQPA 2XWYA 4NA2A 4H4MA 3LH2S 3ONQA 2XGPA 2V8DA 1PG5B 4N5SA 2YKPA 5KOXA 3AY0A 4M5IA 1MLAA 3MCOA 4PYDA 4L74A 1P1LA 1IKXA 6FDRA 2VD3A 2Z2LA 2AYBA 3W65A 2FZCB 3D6MB 3PXGa 4ZITA 4PXCA 4N47A 5A8WA 2DKOB 5D0EA 1RZMA 3ILLA 1DARA 4Y2AA 2MKYA 1OMSA 1N5SA 3OFGA 2V8GA 4ANDA 2AGOA 4X4SA 4P10A 1X0FA 3BKTA 4OHXA 1VQ4S 2NR0A 1FXLA 2WZ1A 1X0PA 3RZAA 1KVJA 2DXEA 1TVRA 2HVEA 3BZQA 2CJAA 2LQ8A 2M4MA 3DLEB 1WEXA 4K2XA 4ZOSA 1U26A 1VCTA 4GO7X 2QTWA 2AJ1A 5CYMB 3IO1A 5U47A 3SSQA 2OFHX 3KLVA 3W63A 1XQIA 2HNYB 5LMNF 3H2UB 4OI4A 2ZD1A 1G4CA 1NZAA 3HCXA 4YN3B 2ZE2B 2QL9B 2VUGA 2XULA 3IR6B 5D15A 5IWAJ 1GX6A 3JTNA 1SKRA 1TL1A 4Z37A 1U8WA 1TK0A 1NUEA 1RCXB 4XK8C 1FT8A 1RA6A 3EZUA 4JI3J 1WSVA 4YUDA 1CJKA 2RQ4A 3DLLQ 4IDKB 3CO9A 4NLOA 5CD4H 2KI2A 4KRWA 3THVA 5J2MA 4LF5F 2QGFB 3PY8A 1RAIB 2R2UA 3CCSS 1RT7B 1GXUA 2VFSA 1IXKA 3CD7A 1RHRB 3S1TA 5GMKa 4PG5A 3G71S 3EZ5A 2FJXA 3AH6A 3SV4A 2RHSB 2D1CA 3LUYA 3SV3A 3TJ9A 1BUXA 1WSRA 1H2TZ 1IVZA 1HIYA 4R5PB 1U0SA 1H3DA 1S77D 2IM2A 2LQJA 3FFIA 2BABA 2HGNA 4LRDA 3GTYX 4AL5A 1TMMA 4Y00A 4AUKA 4DPUA 1M90T 2GVDA 4DR6J 4LF8F 5DDQC 3SSSA 3KYLA 2HHVA 2WVCA 4KO0A 4J9SA 2VQEF 2JSXA 1REVA 3MFHA 5LMUJ 2I5JB 3DOLB 3OW2R 4DSLA 1XR6A 2HAFA 3D0GE 3GCWP 5F8HA 3PW7A 2BKNA 3HFVA 3AA8A 2MZJA 3R5CA 4MK8A 1LNQA 3QT6A 3CDUA 2W7PA 2CQ2A 3DI6A 4ZVSB 4K0KF 4QYRA 2G13A 2V8HA 2UXCJ 3EM1A 1UL3A 1MU2A 1RAAB 1NXIA 3B4MA 3IRXB 2XMJA 3MMCB 4ZCMA 2MXYA 4F04B 2ZH9A 3GB0A 3F41A 2EG1A 1DRZA 1C1CA 3JS9A 1RT3A 1FE4A 2CPJA 3QFHA 5AXLA 3W8GA 2BQ3A 2EFQA 1LWEA 1MW7A 3DLEA 1EIYB 2D9PA 1RHUB 1TV6A 4QWDA 3JSYA 2HHPA 4J9VA 1FTRA 1R0BG 1UWBA 3RBXA 1X4DA 1H38A 4A8FA 4OL8A 3TA1A 1S6PA 4E8UA 1S76D 2CPYA 5ETNA 1P6TA 3CCVS 3BGLA 2IC3A 2Z2YB 5KFEA 4DR3F 2G1HA 3KJFB 4TY8A 5D0HA 5KG7A 3JB9k 4O4RA 4Q0BA 3C16A 1D0EA 2J9DA 1FK9B 3LP2A 2G1DA 3QAUA 3UDEA 3OVAA 1K0VA 4C8OA 1MNEA 4PPZA 3CUNA 1KLNA 2YVSA 3I87A 4KSEB 4LSLA 2AEJA 4CYUA 1KFSA 4LUBA 3DRYA 1M1KT 4OYXA 4PABA 3WHIA 2G2OA 3QYYA 4B9LA 3Q89A 2B43A 1QY7A 3PW5A 1IKVB 4DN9A 3I9ZA 4JI3F 1WUUA 3PTWA 5SZTA 2GCFA 5FJ4A 4BC7A 2BBEA 2R2SA 1JLAB 1ZZNA 4I67A 1YZ6A 1HBNB 1WEYA 1RT4B 2DNNA 5ETKA 3VZHA 2MLXA 4DV5J 2R7RA 3GCXP 4K4SA 1QTNB 2OO4A 1S1UB 1U2FA 1SIZA 2L9WA 1KBRA 5AE2A 5HO4A 2LQ5A 3EVWA 1JLAA 2HRYA 3MCNA 1L3VA 4WCEQ 4ECYA 1APSA 4U8YA 4QJVA 1RGVA 1M5PC 5CYJA 4LF4F 1Q78A 3GSDA 4ALZA 5C42A 2GVZB 1S9EA 1U6FA 2IAJB 1SB6A 1T9VA 2YWEA 1NK8A 1UJ6A 3JSBA 1S9GB 1TTHB 3MOJB 2WSEC 5EN1A 1FXDA 1T7PA 1S6QA 3SXLA 5HATA 2HWIA 3OXGA 2C2ZB 4JI2F 3BQ0A 4WZQA 3VVTA 1GEHA 5HMXA 3R7BB 1U2RA 1URRA 1XR5A 2DHGA 3I31A 3L4BC 4ZVHA 4J91A 1RWPB 1Y9OA 4TY8B 3HPOA 1MROA 1JLEA 5IT0A 1HQEB 1REGX 3E01B 2VJUA 4OZNA 4RKUC 4TVAB 3DOMA 1RISA 2KZMA 2ZOMA 5KFCA 2YX4A 1JLGB 2GJFA 2LA6A 5C25A 1RACB 3NGRA 2UP1A 1N36J 5E3CA 1SJQA 3CO0P 3BO4A 1QAIA 2J5AA 2R8JA 4ZKAA 3ZXWA 4GO5X 4H54A 3H5UA 3GV7B 2CVIA 4NL5A 3HHNB 1K47A 4GKKF 2ZHBA 2IY5B 2XZDB 3K7RA 3TUIC 2RAQA 1ZTWA 3VAFA 2WOMA 1FJGJ 3JSRA 5KG0A 1RHMB 2DNOA 1UKUA 1FRLA 1TL5A 4YOEA 4PXDA 1CSJA 5B7WA 2V2KA 1E6VB 3DXBA 2XMWA 2ZWOA 3CCTA 4ZPDA 3UE2A 4YEAA 3QBCA 1YQHA 5IT4A 1S0OA 1WG1A 5IS2A 4ED3A 3NS7B 2AT1B 2Y1RI 4A4JA 3MECA 2W7AA 1X4AA 3NBPA 3GJTB 4K4TA 5T41A 4I56A 1G2EA 1ZH5A 1FK9A 2DEJA 4BLGA 2Z0GA 3HVWA 1V5VA 2VBWA 4LF1A 5ITHA 1DJ0A 2NUUG 2OPQB 2D3ZA 2QG9B 2V63A 2KO1A 2YKNA 4O0IA 1O51A 5AJ3J 2XEXA 2CJQA 4UZBA 2PIIA 1YRTA 2ZBPA 4JI1J 5KG3A 3EPIA 5THWA 4KPYA 4OHWA 4DQQA 5H1SV 2EFPA 1KONA 1RWOB 3GU0A 3RAMA 2HHHF 3M32A 5D77A 3Q2TC 2W24A 4RBVA 3VALA 4D3GA 3QGPA 1DQ8A 4DZ6A 3R5GA 2CVEA 2CJKA 1XERA 3CULA 1NK9A 1Z2LA 4LFCJ 3OVBA 2Q79A 5E5NA 4IO9Q 4EEYA 1R8HA 1U45A 1AFJA 1VQOS 1T0TV 2KVIA 1W2BR 5F3TA 1K9MT 1OQ3A 4JI6F 3DI6B 4MK7A 1YJRA 1S1VB 4PYAA 2JC0A 4DCOB 1E6YA 1XK8A 3MM5A 1S1WB 5G4DA 2XS5A 4W4MA 4NLYA 1KRPA 2AYMA 3HVTA 2UXDF 4YB7A 5GAHU 3FRYA 4A8MP 1S12A 3N79A 3NWRA 5ETTA 5KFAA 3TRGA 1C0TB 1NCLA 2PEHA 5IV3A 2R8HA 2HK2A 3T19A 3BSNA 3QT5A 1VDHA 1MN7A 2YNGB 4RW7A 4G3IA 3KJVB 3AB4B 4F4XA 2CJXB 1C0UA 1KLMA 2GC8A 1IKYA 1KWMA 4EMDA 3ZFVA 2EK6A 4M5JA 5KT2A 3I5CA 1J5EJ 2OTLS 1HW8A 1RAOA 1KQSR 1OYDA 4B3RJ 2MJUA 1WHXA 3MMAB 4K0KJ 4TKTA 2AMCB 2ERRA 4WIQA 4Q43A 3FSYA 4FS2A 5KFQA 1OWXA 3O44A 3NBPB 4R0EA 5KFLA 4DSEA 3PX6A 4LQ3A 4GKKJ 3CCUS 4MKAA 4IKAA 3M6XA 2ZJRQ 1BQMB 1UEVA 2IC3B 3AA9A 1F2GA 3HO1A 5C24A 2JLFA 4KGMA 2E7VA 3QSIA 4M5GA 3QGHA 1UMJA 1T05A 4JV5F 5ETRA 2FJBB 5GADU 2KTQA 3RRGA 3ENQA 3ZZPA 3G6YA 4DFPA 2V2VA 2HNDA 2ZKUA 2FJEB 2Y0BB 3OD2A 4L73A 2XMAA 3H5YA 1WC6A 2L3MA 2LYVA 3ENWA 4CNYA 3D68A 4CRJA 3E51A 3PV8A 3T6JA 2QMXA 1NLKL 3FBBA 2WSCC 2WVEA 5E33A 3K5NA 1KR4A 2Y8WA 1N48A 2NS1B 3DDIA 3VCDA 3UCUP 1LXNA 1RUSA 2KJWA 2WVBA 2XYHB 3NAIA 4HDHA 4CZCA 2MYFA 5L8RC 1Q8BA 1T3NA 3CCRS 5KFTA 3NMRA 2KL8A 4ZVTB 3TYTA 3W3SA 4KPCA 2CQCA 2LQBA 1WOOA 2NCKL 4QIFA 4USTA 3RBEA 3EMTA 5D8HB 1IKXB 3T3FA 2CXEA 3OT9A 4Q8EA 1TU0B 4JI8J 3C6TB 3HVRA 5CQGA 5EWGA 3WBZA 4NLWA 3T9NA 2EK1A 4DL0C 2D3UA 2K3IA 3O8WA 4RNNA 1CJUA 2MKKA 4RO0A 2ZH4A 2DNLA 4EGLA 3L95X 2B0GA 1B0VA 3IN5A 4PZVA 5C42B 2XM3A 1CQNA 2YNHA 4H4MB 4U8VA 4CLYA 2B5JB 5KFJA 1HR0J 3IP0A 2MKIA 1FX2A 2HQ3A 2K1RA 5KFRA 5KFWA 3GQCA 2AGPA 1VQNS 2KFZA 1JLCB 2BYCA 1FWKA 3KNGA 3CJSA 3VWSA 3RB0A 3OR1A 4NMXA 4IOBA 2LEBA 1Q8KA 4DPTA 2XZTB 4EYIB 3VGSA 2E1AA 2H9ZA 3NOGA 2H3EB 1XMOJ 3LP0A 4WBFA 4FNIA 3PJXA 4RW7B 2HHUA 3KFWX 1SJ3P 4FYWB 1GQEA 3TI0A 4LQ9A 2GZOA 2BUNA 3MUMP 2AU0A 2CDQA 2Y3YA 4M95A 4XDDA 1LKZA 1EX8A 5DQGA 2XGQA 5E0OA 2ZEJA 2IBKA 5E2QA 2CRLA 5D0GA 2E5LJ 2LXFA 4H4KA 2NSCA 5IQQA 4DV5F 5KFXA 2NSBA 3HKWA 2VBZA 3NCQA 3V4IB 1OY6A 4MKVA 3Q23A 4CTAA 4ZP8A 3M8PB 3O5TB 3NOCA 2GJ2A 3W5ZA 3PJWA 4MYUA 2W9BB 3W66A 3CC2S 2IVMA 1VBKA 5HK4A 4JI0J 2CPDA 1JJ4A 1QLNA 4LBPA 1R27B 5C2GA 5CA5A 1FEHA 2BJ9A 1RYRA 4M5DB 4DCPB 4J9OA 2QYGA 5F41A 3DCAA 5K8NA 1ZPVA 3KUHA 1U1KA 2A3JA 4G65A 2UUAF 2CYYA 2K3KA 2Q6CA 1N88A 5IC6B 3D1OA 4KB7A 4LRAA 4ELTA 1QUPA 1SVDA 2R7SA 3GG1A 3MAAA 4NPOA 1KHWA 3SDEB 3UW1A 4CH7A 2AJQA 3L7UA 5DDRC 1NKEA 2F65A 3KWMA 5DQHA 1BQMA 2MEWA 1KSPA 2W4DA 3W8PA 5DDOC 1HMVB 3MEGB 3AJ1A 3N6NA 4U9RA 3TJ8A 3W64A 3K5OA 3ZZRA 3BBBA 3CEDA 1O6XA 3W9IA 3R5DA 2EWHA 4CT9A 4UOFA 3F73A 1SKWA 4LF5J 2MGZB 2RS8A 2VIHA 2RVJA 3G4SS 1PJ5A 2FJVA 4AXIA 5J1EB 4M63A 3D3CJ 1GNKA 1FD8A 4LF9F 1R0CB 2RUGA 4B3SF 2XSJB 1MWZA 2V67A 4PAAA 4H4OB 3M8QA 4DV7J 2LQ9A 1RTDA 1WF2A 1HNXJ 2FJDB 1TQLA 4CLLA 2J7KA 2NZCA 4TLRA 2C2EA 1TKXA 2DO4A 3SQGB 2ZH1A 3JQJA 3QATA 1JK9B 1SUQB 4IDKA 2WCXA 3TVZA 3ENVA 3J81j 3G87A 2B6AA 3AD8C 3FKBA 4NCAA 4I68A 4DLEA 3QRRA 2KRBA 1CVJA 2IJNA 3RG6A 1T03A 3NGDA 1X5PA 1FFGB 3NG8A 3CC4S 3GPAA 3QO9A 1EP4B 1F9FA 1RTJA 5ETPA 4U6PA 1X9SA 3IFEA 3M2VB 2WTFA 2E5JA 3IRWP 5M2PA 3HXMA 2VICA 4WXWA 1U1PA 2HRUA 3M9NB 4ID8A 2V9WA 2HNYA 4CM2A 4Q5VA 4ETXA 3PHEA 1S9GA 2ROGA 3AD7C 5FLXY 4MK9A 1F9EB 2IRXA 2EW9A 3I9V9 4J9QA 1JXEA 1EKRA 2QA1A 3KUGA 3HHLA 5HANA 3RJMB 4PG8A 4NRTA 1SCJB 1U02A 5IZHA 1KLMB 1YDLA 2KT3A 2EC2A 5HVHA 2O3DA 5LJ5Y 3VGVA 2HHHJ 3B78A 3IG1A 4GVLA 2YBVA 3FEYB 1WACA 2N4DA 1D8ZA 3EJMA 1RT5B 4CO0A 3V2UC 4ECVA 1JXLA 1ZAVA 2JVOA 5J2MB 3V6HA 4XIUA 1ZYQA 5JJBA 2OD4A 1EQMA 2FYXA 1QSYA 1C2PA 3F56A 1RWKB 4J9MA 4ZPWR 5DGAA 2KZZA 5IXUA 1F1BB 1VQ6S 4RX6A 1S1WA 2HIYA 5ETVA 4NLVA 1FRXA 3DRRB 3U1NA 4C3KA 2HZAA 3Q22A 4OZ0A 2DNKA 3MOZA 2E66A 4AXJA 2GGPB 4QU7A 4YP3A 1S4EA 2RUSA 2KM8B 2V4RA 2B56A 4KGZB 3TAPA 4L3KA 1CS4A 3RRHA 1NKCA 3M6WA 4GKJF 1T9YA 1CBKA 3UN2A 3IS9A 2BANA 2A1BA 2KHDA 2OGUA 2ZD1B 3CCLS 3UD4P 2VU5A 3ETMA 3OLBA 2PMHA 4UOCA 3NGKA 3T1AA 1IKYB 2V69A 5HROB 4IR1A 4Y2KA 4Y34A 4X2BA 2E1RA 3EWGA 3HHEA 1WHYA 1LFWA 4R8UA 5EUHA 4OX6A 2OPPB 1HNXF 1IWAA 3CIMA 1IKWA 4NLSA 2WW4A 4ZCLA 1BQXA 1VRUB 4P7TA 1VR6A 4IG0A 5IC4B 1U8SA 3C14A 2O1PA 1YJVA 3V6DB 3L09A 3M2VA 2HGLA 3OUYA 4FPRA 2V2ZA 3VAKA 4CLPA 3NCPA 8RUCA 3X1LB 2PEBA 2HHQA 4KV8A 3TX8A 1X8DA 2KXNB 1G1XA 1HNVA 2MZSA 4DR4F 2ZH6A 4F0MA 1RU1A 4FYXB 4I6YA 2IPOB 3NNHA 5HMZA 1F6TA 3JTPA 4HL9A 1CC8A 2GIRA 2JRSA 3RW6A 3K8WA 3MEDA 2BA9A 2VFTA 2Z58B 1IJFB 1YBAA 5F9NA 3H4BA 2H5IB 4ELUA 1W7WA 3IBCB 4MTPA 2F63A 4KKOA 3TAQA 1FVQA 5IFMA 5HLFB 1JLBA 2YX7A 3PYEA 3PIPQ 4JV1A 2B5JA 2FZGB 2C28A 5M2RA 4LVNP 3BYPA 1DY3A 2YKNB 3FBFA 2OEKA 3PCOB 1Y5IB 2V9KA 2W25A 3BN7A 1C0TA 1J2VA 1F0XA 1N5QA 4ZVQB 5KFHA 2XMKA 2M2BA 1GAOA 2VOPA 1TUVA 2AIRB 4KY3A 2HHTA 1ACMB 2ILZA 1RAFB 3DDNA 2HEKA 2XHCA 5M2UA 1U1OA 2PI4A 5D4NA 3LP2B 1LK5A 4ZIVA 4USVA 5BYQA 1JWWA 5IT9Y 2DJWA 3BREA 4MAKA 3VGUA 5ETOA 4ZN3A 2CNLB 4AQYJ 1VQ5S 2KFNA 3GFHA 3PO5A 3SIPB 4NCGB 4P2XA 3M9OB 1J27A 2ZHAA 4DPYA 1N4LA 2DD8S 2H54B 1M1HA 3LGMA 2UUTA 2B7BB 3D54A 1BGXT 3K5PA 5BXIA 2ADCA 2ZBQA 1RCOB 2H1YA 4ENOA 2AD9A 2VA3A 1OQ6A 2FVRA 3C6UB 2DGOA 3QLHA 1MU2B 2W4CA 3MMCA 4QW8A 2E7WA 2V94A 2VPYB 2E1PA 3O3LA 1IJEB 3SCKE 2LXUA 5DQIA 4TQSA 4LIRA 4TU8A 5F8IA 1UEKA 1U1RA 2VC0A 3ZNUA 3H42A 2V68A 3M30A 3ZZUA 4WTYA 3PFEA 3TW0A 2DGQA 4C4WA 4RWWA 3R6GB 2F8MA 4WP8A 3GYGA 3HLUA 4DU8A 4DJBA 1REVB 2DIVA 3AOCA 3N01A 3G82B 4RUHA 2MQ8A 3RTVA 1KP6A 1KC8T 2RD5C 3JTOA 3MEEA 4KR0B 1Z2ZA 2BW7A 2IAJA 2N7YA 4FPIA 4WFXA 2VB6A 1SH0A 2AJ2A 1M5KC 1UETA 2N7CA 3DHXA 3ZTQA 1CJVB 2GHWA 2P9CA 3A1YG 3GR0A 1IBLF 1BE4A 1FTCA 1RBOB 4OI6A 1WHWA 4DDFA 1Q81T 1VQ9S 2F40A 1V3RA 2YNGA 4RNOA 1GMUA 4C8LA 2FTRA 3Q24A 3Q8YA 1B0TA 1LWEB 2B9WA 3BN4A 3L7OA 4OYWA 3UI3A 4B02A 4DR5J 3DYAA 3TANA 4DSIA 1U6BA 3D0IE 1BWVA 1K1SA 1YRUA 4NLDA 3PW0A 3BQ1A 1IKVA 2BMBA 3NGTA 4LSZB 3W2VB 3AQPA 4MKYA 1LXJA 3R8YA 2O67A 4FVCA 1NDPA 5DG9A 1UA0A 1PYOB 3BBCA 5BYRA 1VBZA 1SKSA 2HYIB 2JX2A 5DZ6A 4DV4F 1HD1A 2DITA 1HNZJ 2R7XA 2P9EA 2CNOB 4WK1A 2UUCJ 2CNKB 2GHVC 2GMHA 1AFIA 3ZNJ1 2CWXA 3C15A 3D6FB 2DBBA 4WU2A 3P6YC 4MFBA 3CE8A 3KDOA 1YZ7A 2QA4S 3UR3C 3FEXB 8AT1B 4JOUA 5KFMA 2HHWA 1C1BA 1EARA 3A8JA 2M3DA 1MN9A 3HHLC 2V2QA 4WE1A 4QCLA 1WKJA 2QL5B 4O0NA 4NZ6A 3TNVA 2M52A 3BR9A 4CQ1A 3ZC4A 4CH0S 5HMWA 3MMBA 2BZ2A 3DRSB 4EO6A 1AA1B 1FJEB 2A2CA 2UXBJ 2MQPA 3K59A 5EX3A 1RTIB 5B0BA 3CD5A 2H48B 3KK2A 3IRXA 2J0SD 2QO3A 3Q8UA 2K1RB 1N54B 2K2PA 5KT5A 1V5IB 2DRDA 1OSDA 3FUYA 2QA2A 3K17A 2DR8A 2IA6A 1WHVA 1SC1B 1IN0A 1Q95G 1UJ5A 2IVFB 4BBYA 1KQGB 1NKBA 1CJUB 4JI5F 2B51A 1CEZA 3C6TA 1Y11A 1R8CA 2I5JA 4RLEA 2FLLA 2OIHA 1TKTB 2OMLA 2M8HA 3OL8A 2FY1A 5ETQA 1KQKA 2ASDA 4EFAC 2VG5B 4WFZA 3FBEA 5KG1A 2MLZA 1LFPA 2KXHA 2PDAA 1HNWF 4FN5A 2XLIA 3QWUA 3OR2B 1KEKA 3DLKB 4BCAA 3JQMA 1HQUB 1TKZA 2YWHA 4OYMA 2IA0A 4QW9A 1D8YA 3E2EA 4J9UE 5HMYA 1TV6B 3OJUA 1RAEB 4NXMJ 1FRMA 1DTTB 3DM2A 1WEZA 3OV7A 3MM8A 3CPWR 2RHQB 4PG4A 2RU3A 4OLOA 2WVFA 4EUVA 2GQ2A 1FA0A 3GZ7A 1UZHA 3BGUA 5DZ7A 4DV7F 4F4ZA 1RKIA 2ROPA 3ET6B 4B3OB 1RTZA 2DGVA 2RRAA 1YK9A 2R7QA 3D1QA 4NA3A 1DURA 3CMQA 4P75A 5IM0A 2G4BA 5F8MA 3ET6A 1R0AB 5D6GA 1JLQA 3OVSA 2XMTA 1NDKA 2HS0A 4OLPA 3QJLA 2CQDA 3O2IA 4F4YA 3K5MA 2Z2ZA 3H98A 1DAXA 2HVDA 2HBQB 1B99A 4I2QA 2HZVA 3KHRA 3UVJA 1OO0B 3GV5B 2J6SA 3P45B 1DQ9A 1W2IA 3GR1A 3V6KA 1JX4A 5L9NA 1FJCA 2V0NA 1NJXA 3KNAA 2KN4A 3GFYA 4PKDB 1OPIA 4DV0F 4HACA 3T5LA 4B08A 1WELA 3W5YA 3FMBA 4L6V3 4UOGA 1M5VC 2IHR1 4B9UA 3BH6B 5T7LA 3NNAA 4YDDB 4A47A 4K50A 3VAJA 2XTJP 2EVZA 2JDJA 2NYIA 5ADZA 1Y5LB 1Q1KA 3PHTA 5D4PA 3BR8A 4KAIA 1O0PA 3MPYA 4FP9A 3K58A 4WKYA 3RR8A 4F2RA 4FYYB 4ECRA 3BB5A 2C2MB 3WX4A 4B3RF 1YJUA 1TL1B 1SC4B 4HI2A 1HI1A 3PEHA 3NMAA 3RRKA 1QE1A 2XS7A 4DU7A 3W60A 1VOMA 2CFXA 2YPZA 5LT5A 1YX2A 3HMJG 4J9PA 3GJQB 3FEZA 3SSRA 4GKJJ 2YXLA 5A2QY 4MKBA 1X9WA 3IAS9 3TJAA 1QDUB 1FKPA 3MM7A 2F9DA 2RQKA 3DRSA 3SQOP 2V4JB 1UW9A 4NYPA 2U1AA 3GYNA 4R8UB 3SYZA 3UD3P 2JEGA 4RW9B 4Q44A 3S7RA 1UFWA 5KFBA 1TFWA 4TYBA 3TZYA 1Y00A 1S97A 2UXDJ 1HQUA 1L3KA 1TKZB 3HJVA 2DHHA 4DR1J 3IGVA 4DSJA 5F8GA 1JLGA 2MZRA 2OSQA 1YJWS 1VRQC 1WJ9A 3W9HA 1XIQA 2FB0A 3ISZA 4NOHA 4YR2A 1HQEA 3E01A 1SJFA 1LW2A 1T9UA 1LWCA 3HFZB 4Z7YA 4CLUA 1PCAA 4JUZA 4ECUA 3CC7S 2ZNYA 3IBWA 1NAQA 4YR0A 5KOWA 1CS4B 2IM1A 2MQMA 3ZZYA 5L46A 4ED6A 3KG1A 4QWBA 3S01A 2C2DA 3W9JA 2OEMA 4LR8A 3HD1A 4TU9A 1D1UA 2FVPA 2B4UA 2LDYA 1RT1B 4B3TF 1S0NA 3CIZA 2VQEJ 4R5PA 3BDPA 1PKUA 4LJMA 3M1VB 4XTTA 4JI8F 3PKYA 3BGRB 4U7UD 4M5KA 3GWCA 2DEIA 4WP9A 4PRFA 5LM7E 1GFWB 3OTDA 3PNIA 4C8YA 2HG4A 4X4PA 2ZOGA 3BGRA 4CO3A 1EHWA 4C0HA 2FPHX 4TNOA 3R97A 3RBDA 4LF7J 4ED5A 4WE1B 1N0VC 2BM0A 2GO8A 2MHNA 2WVDA 4OX9F 5LJ3Y 3M9MB 3KHHA 2RKIB 4OZ1A 2J9EA 4ED7A 4YHHJ 5EX0A 2GHPA 2HIQA 4Y2IA 1BMQB 4C9DA 1Y4ZB 2CZVC 5IV4A 3TO8A 2W8KA 1KDNA 1IM4A 4ED1A 1ZM3A 1S1XB 1GT8A 3B4DA 5HBMA 5HSPA 3RAQA 4LBIA 4DL4A 4FNHA 2XI2A
chains in the Genus database with same CATH topology
1LWCB 2XWXA 4IRCA 2MY8A 4B17A 2YNIB 4Q2LA 3U7JA 2DRAA 1VRUA 2EBGA 4H4KC 4A46A 2L41A 2HLUA 5EHHA 1OS5A 3MXHP 2AX1A 1S9EB 4LSNA 2VBXA 2B3TB 3AB2B 3NS5A 2ASLA 3NS6A 2DNYA 3DGPA 1CPZA 3AQOA 1SL0A 1BQNA 2EFGA 3MM8B 2CPXA 3MM6B 3KLGB 2R8GA 4U7UK 3C46A 1XN9A 5KFPA 2VONA 2IFXA 4OZ5A 1R6YA 3BDEA 3IWNC 4O3OA 2FLNA 3MEEB 5E3RA 2BV3A 3IXQA 1SV5B 2ALZA 2QSFA 4ZLPA 4DV3F 4ITSA 3DOLA 3WC2A 3QJPA 2IM3A 3ICLA 4E98A 4DX8H 2IVYA 1YSJA 3OFEA 4C7QA 3FSIA 4ZPTR 1J5EF 2W9CA 2XMVA 2XZWA 3OTEA 4HT5A 5HP1A 5F8NA 1M5OC 3QJJA 2KJVA 1ZTTA 5KFGA 2XNQA 4ECXA 3OXLA 4OIXA 2OPRA 2HWTA 5K8OA 3L7PA 1I6JA 2A18A 3H2VE 4WFYA 2DR7A 2C3YA 3H5XA 4G1IA 2MQQA 4RW8B 1BQNB 2F7VA 1FRKA 5DETA 2GIQA 2L9DA 1HNIB 1FDBA 5CYQB 3PX0A 4UQTA 3HDSA 1QSSA 4ED8A 3JYTA 1U7LA 2GW8A 4QZVB 4WYLA 4F4KA 4OZLA 3I32A 4O3NA 4DV6F 1LV5A 3CB4A 4OX7A 3NLCA 2X1AA 1IQZA 2B9YA 2YNIA 4YMEA 3CD6S 5L39A 3N6MA 2NQPA 1RQ0A 4Q2MA 5T7LB 1HBUA 2P6SA 3PR5B 3T1HF 4B9VA 3VQSA 4HH1A 3GE9A 4ECQA 3RB6A 2CPIA 4CCHA 4W90B 4ES3A 1WG4A 5CZXA 1U1NA 1SL1A 2Y0SD 4E0DA 3TA2A 4WYWA 1LK7A 5KFKA 2JFDA 2QRRA 2VFRA 1Q86T 5I3UB 1FDNA 2KXFA 3OL7A 4USIA 3G8SA 2LA4A 3HHLD 5DG7A 2JC1A 1O5JA 2DGTA 2D7SA 4LFBF 3KG4A 3HVTB 1FESA 4JI4F 2YNHB 3EXYA 3BSAA 3MI7X 1HNVB 1HMVA 3BSOA 1VBYA 2KFYA 4C98A 3CSKA 4PUOB 1HHSA 3TP2A 1R8PA 5FIIA 2DVIA 4NLRA 1CG2A 5J1NA 1LW2B 3DU6A 3M30B 2I38A 2YNFB 5CYMA 3T5HA 2FJWA 3CCJS 2YY3A 1Q82T 3QIPB 2K7KA 2ZBIA 3PACA 5IQ6A 5KT4A 2ADBA 3RAXA 3CJ2A 3MHYA 2J0WA 2OFGX 4MFBB 4ELVA 2JWNA 4QPXA 3TAMB 1WF1A 2BACA 3HJFA 3U02A 4WKRA 3PM9A 4PWDA 4NYOA 3KG0A 2PE8A 1WI8A 1X4GA 2K7JA 2B9XA 4K4ZA 4GMKA 1UA1A 1RJJA 4KJIA 1CC7A 4EU0A 2F8HA 1L3UA 2HVHA 3FCHA 2IRYA 2KG1A 1JB0C 1UVJA 4CT8A 4EBDA 2KT2A 2YWFA 5HROA 3D1HA 2PA3A 2FDNA 1X5SA 2MKCA 4FVMA 2UXBF 3CDAA 2AWZA 4ZP7A 4ECZA 3HZEA 4HHJA 5L1LA 2UV8A 1JLBB 2LU1A 4I7FA 2NREA 1K1QA 4I1TA 2PGCA 1VK3A 4J5OA 4U7CA 1GTEA 4MIBA 1K73T 2B4VA 4ECTA 1HI0P 5AE3A 3MR2A 2OAUA 3NP5A 4Y6IA 2MGZA 4WJBA 1UVNA 2OH2A 1X4FA 1BC6A 1MROB 4ED0A 4AQYF 3MUVP 4JI1F 4DR2F 1UVLA 4HT7A 2HVZA 1JLQB 4ZVGA 4DSKA 3MEGA 3R1LA 4NLUA 1DFDA 1E6YB 3MM5B 4U67Q 2J6UA 1NB7A 1N56A 4OI2A 2DHXA 2RDIA 2RB7A 1UFLA 5KT7A 3MUTP 2PA8D 2X3GA 3ZZ0A 5KG6A 1ZM4A 1YWXA 5BJRA 3G86A 4NX9A 1N32F 3K0JA 1QTMA 5KTQA 4KE5A 5KFUA 4ZP6A 1HD0A 3RU0A 4J9KA 4ICLB 2KDOA 3D0HE 1Z1ZA 4ECWA 3OFHA 4H4OA 3LWMA 4ZHRB 3ULHA 3M8RA 3KLIB 1W25A 2HNZB 1X4EA 2KYXA 1HBOB 2JLGA 3O1LA 4C11A 3PVXA 1K8AT 1HA1A 3FRZA 5F3ZA 5B0GA 5C24B 5KFZA 4BHQA 1RI7A 4YFUA 3FQKA 1JLEB 4IH5A 3VQTA 4PR6A 2AP6A 3V4MA 3CJKB 4JI7F 2WONB 4DR6F 3B82A 5AXMA 2UUWA 3PRDA 3UFCX 1VS3A 1HARA 4F2SA 2RH3A 5L38A 2DO0A 3IAM9 2WW8A 1G3OA 2ZZNA 4WFBQ 2E44A 1TZ0A 2CJ9A 4DWIA 2J9DE 2VPWB 2ZC3A 4OFZA 4ZPBA 1NH8A 3ITHB 2H5EA 1QSLA 2E5LF 3KLIA 1NU4A 4RWXA 2BE2A 2VQFF 5DG8A 2AJ4A 2PMZD 5K8PA 3H40A 1A9NB 1H7XA 2ZC4A 1RT4A 4EBCA 5I42B 2QLXA 1C1CB 1SJ1A 5J2QB 1PILA 1ZM2A 1AROP 2QZ8A 3V5RA 2R2TA 1QVGR 1UVIA 2GO9A 3R27A 2LXIA 2PT0A 2BQRA 2J76E 2W8LA 3Q8QB 4G6VB 5SUHA 3MEKA 4IUFA 1GXTA 2FVCA 3PO4A 4A8WA 3FGVA 3KLFB 5D3GB 4QWCA 1EP4A 3ETOA 3OLAA 3HVAA 4X84A 2R9LA 2QMWA 5LSLA 2LEPA 2JVRA 4FF3A 1IBMF 1LOUA 2GNKA 3MR3A 3R5AA 3LOUA 4QQBA 3K2YA 3N28A 4TXSA 5CCMA 1IR0A 4IFVB 2I2YA 4KKOB 3KLHA 2IM0A 2LMIA 4RUCA 4I64A 2GMLA 4X4RA 5L1KA 1RTDB 1M0SA 3LPYA 3M2RB 1L3TA 3DU5A 4DL3A 3TVYA 2K8GA 1H2UX 5E41A 3K57A 1N5VA 5L1IA 2DH8A 4PUOA 3NWGA 5LL6d 2EBEA 1FERA 1BY9A 4Q8FA 3NL0A 1CQMA 5A8KB 2M8DB 4UUWA 3WDOA 4O4GB 1FDDA 2FHJD 4DV2F 1ELOA 4C8NA 1B64A 4CO1A 3PDNA 3UPFA 1GXLA 3D28A 1PC5A 3KK2B 3PKMA 4PWDB 3V81A 3S6EA 1VQ7S 4ES1A 2WOMB 1P1TA 2XMMA 2C2RA 1S7HA 1A6LA 1KN6A 1VQYA 4O3PA 3SZ2A 2EPIA 3SFUA 2HS4A 4ILLA 2DCLA 1FVSA 4ILRA 2ZKTA 1YTYA 4XO0A 3VAMA 1NEEA 4NLGA 1RTHB 4HKQA 3N4WA 3FDSA 1AUDA 1RT3B 2F3JA 2KRRA 2VG7B 4PQAA 2YH1A 1S72S 3IS9B 5JVHQ 3RB3A 4DOZA 2DNRA 3DN9A 4FXDA 2J8AA 2QIFA 1VIXA 1S0MA 4HI1A 1T03B 3LALA 4F3QA 5KAKA 3UQSA 3CCES 3THTA 3I0RA 4WZMA 5E3AA 3GFZA 3T5KA 5CYQA 3ZZOA 1ZM9A 1U47A 1HWLA 4IRDA 1RK8A 2FJAB 3BF4A 4CNZA 1J5OB 2RQMA 2E29A 3DFEA 1N0UA 1ZPWX 3M32B 2R2RA 2ZBCA 5HI7A 3MFHA 1FF2A 3I82A 2B4OA 5K14B 2AF6A 4I7FB 2R8IA 3J80Y 2RQCA 1SXLA 4ID5A 3PIOQ 5DLFA 1NK0A 2GV1A 3US5A 3KJVA 4CO2A 5K14A 3IR7B 4F02A 2NPFA 3P3DA 5F8JA 5HP1B 4F50A 2HLTA 1A7GE 4I2QB 4EZ9A 2EFOA 4IOAQ 4OJHA 2XSFA 5I3PA 2M5YA 2ZH2A 4FXWA 2MSSA 3UWTA 1MWYA 2YWGA 4O23A 2M9KA 1TKDA 4UY85 4C97A 1VQLS 1KTQA 2COLA 2F1FA 1H7WA 1XMBA 2FHKA 3MTJA 2VBYA 3C66A 2XY6A 2ROEA 1YHQS 2X51A 2EG2A 2RRNA 1KNZA 4EZ6A 1FE0A 2FIUA 4A48A 3GIIA 3DOKB 4XPCA 1R31A 4P2SA 1IKWB 2SXLA 4NZ7A 3I6PA 1UJ4A 1RA7A 3POTB 4FXVA 4DFJA 1HPZB 2WBRA 5GADI 1XMOF 1TVRB 1NK7A 3PW2A 1YJ9S 2GA7A 2ASYA 4P6QA 3PW4A 4NMLA 2CQGA 1S99A 1RT2B 2FD2A 4LSNB 2ZJPQ 2U2FA 2HW3A 4K59A 1HW9A 2YNFA 2XHWA 2EC0A 3MM9B 4XAKA 3W2WB 1HBMB 5B0AA 2QYCA 1S49A 2BANB 2HMIB 1EETB 3WZ0A 4FZVA 1S1XA 1JLFA 5HBMB 4X4TA 2BJEA 4WU3A 1NK6A 2C3OA 2VA2A 1O8BA 2WB4A 3QPIA 3LW5C 3P5TL 2A10A 2MDAA 4AYBD 1U48A 1R89A 4Y0FA 4NLTA 4WK3A 1XNRF 1NJZA 2DNGA 1XTZA 3VTIA 1RT6A 3LP0B 4C2MA 4TU7A 3FQLA 5FDLB 4QYZJ 3Q8RB 3DXSX 3M2RA 3KHGA 2M70A 5DO2A 3HI9A 5E7OB 2RU9A 3MZIA 1OPZA 3N5FA 5I3UA 7FDRA 4KC5A 2ATLA 3H59A 2RJZA 3Q8PB 2NZ4A 1AXQA 2DTJA 3TQ1A 2HQIA 1VMBA 2CQIA 4L3NA 2L9NA 4Q45A 2WSFC 5KT3A 3C2PA 4RBTA 3JSMB 2R7WA 2B4PA 1XBWA 4TQRA 3V4IA 5DM7Q 2UVUA 2X1FA 2R7TA 2R7VA 4IG3A 3BEGB 2AYEA 3VF0B 4QIGA 4OHZA 5A6WA 3J7A1 4CO4A 3QO9B 2DGWA 4RUAA 4CH1A 4AE5A 1Z4UA 2MKJA 3Q8SB 4DS4A 1NJIT 3CCMS 3EUNA 1HI8A 4N76A 3C6UA 5D78A 3I4HX 3M2UA 5GAGU 1X5TA 3GYXB 2R7RA 1KOHA 4ZHRA 1SUQA 2MKSA 2EFNA 3VR1A 4X4QA 1PC4A 1VC6A 2PN6A 2MHEA 2J0QD 3HP6A 4DFMA 3CMAS 4AL6A 3CXCR 2FHMA 5JVGQ 3V81B 4I2PA 4A8QA 2MZTA 1N33F 4MMOA 3CTRA 2YKQA 4YB1P 2Q6BA 2ZH8A 4K5RA 2ZUGA 5A8RB 5MLCV 1NKCA 1T05B 5D4OA 3PRBA 4EO8A 2D3OR 4RU2A 4D3HA 5JUMA 4OHVA 4C8MA 5LMUF 3LP1B 4LT6A 2QA4G 2HWHA 4RU9A 2HZCA 2Y1JA 2P5VA 1S10A 3KMQA 1HBMA 2J0XA 4MIAA 2PD1A 1V9OA 4Y2MA 2HFOA 4RNHA 3KLHB 3U1LA 3QLHB 4MYTA 4QPTA 3CMES 4OZJA 4O44B 4I2PB 1FNMA 4RW9A 3CDEA 2E9ZA 3MM6A 3KLGA 1T3OA 1X4HA 2DK2A 4KHPF 4PQUB 3GIKA 2BXJA 3DNCA 1HR0F 2RIJA 2WAQD 1M5SA 1FEEA 4B9LA 1VQPS 3BM7A 4RBUA 3MR5A 3G8QA 1QUVA 4ZCKA 4I4BA 1NK4A 3CT9A 1KFDA 2BVZA 2VG7A 4BWMA 5DM6Q 4F26A 1S79A 3BQ2A 1R43A 5BR8F 1RYSA 4N8OA 4DLGA 1DTTA 1S6OA 2E5GA 2MKHA 2LDIA 3DM2B 3KMSA 2ZJQQ 2WHOA 4ES2A 3J7Z5 4Y65A 3OFFA 2VKZG 1WD6A 6FD1A 2OPRB 5C5JA 4IFYA 1WTBA 5K8MA 1YJNS 2E5HA 4YHHF 4RW6A 2NLWA 4WXOA 2RDJA 1PO6A 3FSXA 4AFFA 5F8LA 4K4YA 4DF4A 4QBUA 3PR4A 4URSA 4KHRA 3AJ2A 3FJ2A 3LP1A 2BRKA 4KBIA 4DS5A 2X1BA 3UDCA 2C42A 3R1HA 2E7XA 1MMLA 4QR2A 1XWLA 2BJDA 2F9JA 3R3TA 2CQ4A 4C11B 1EETA 2ILYA 3LQVA 4DL5A 3OL9A 1VHFA 4F3OA 1Q79A 2V5HG 2BOPA 2CPHA 4ZPAA 1RT5A 1SI9A 2OPSB 2N3LA 2OPPA 2DR5A 1RTHA 4DN0A 1RT2A 2XNRA 3RB4A 4ZCIA 1U1LA 3MTKA 3OSNA 5J2NA 4C8KA 4X4VA 2LCWA 3DMJB 2JFKA 3MPVA 1KQFB 1HYSB 2R7OA 3RW7A 3IC1A 2D41A 3G8TA 4B9NA 2QLWA 4PWUA 3J7YI 2AYGA 2VH7A 3D5MA 2QEXS 2DGXA 1UEUA 4PPDA 1VFJA 3NAHA 3PX4A 1P9QC 4FS1A 2D9OA 2UUBF 3QAEA 1WI6A 4I6AA 4G1QA 2DR9A 1NH7A 4NRUA 4QOTA 2HFNA 2R8KA 5KT6A 2POKA 3DLGA 1JJHA 3JSMA 2A2DA 5GAGI 1E6VA 2KYZA 4KO0B 1TP7A 4AL7A 4DG1A 3T1YF 1TKXB 1UVKA 2UZAA 2RSQA 1RWUA 3QGIA 2KM8C 4UW2A 2NUHA 3DRPB 1VGYA 3IWLA 1V6HA 2DNPA 3MURP 3R5BA 1LW0A 3H25A 3T6BA 2I1RA 2OKQA 2FGCA 2IMWP 3HHLB 1RT1A 3MF5A 1UVMA 1T95A 3Q2SC 1F5CA 2V4QA 3GILA 2VOOA 5H9EJ 1C4CA 1NNDA 5I3QA 1U4BA 4PG6A 2UXCF 2ZDOA 4OI0A 4PCQA 4USJC 1VK8A 4ZDNA 2DIUA 2WONA 3IA0A 1SV5A 2KT5A 5IM0B 3I5BA 3OL6A 2XLJA 4HEA9 3IR5B 4K5SA 1N8RT 2V8VA 2E9RX 2VC1A 3DC2A 4DR5F 1S6PB 2Z4PA 2BW2A 4NXNF 3JYTB 3THPA 1N6QB 3KK3A 4V19X 3MMJA 4Q0BB 1R8BA 3OHBA 2BM1A 1HNIA 3CCZA 3SQGA 2FHOB 2JZ5A 3MD1A 2FVSA 1TAUA 1S1UA 5KG4A 4FBUA 3DRXA 1FNXH 4HDGA 5DS7A 5MAOA 1IQTA 1RDRA 3X3UA 4ZK7M 1NK5A 5B09A 4IR9A 5J1EA 3UCGA 2CQ1A 2D74B 3I0SB 7FD1A 5J1PA 3IWXA 3SCIE 4WFNQ 2IYGA 2YTCA 1JWWA 3EGZA 5A8WB 3U27A 1HWJA 4NA1A 2VG5A 1WF0A 2FLOA 3HHKA 2B7CB 2HPUA 1JNRB 3N6LA 4CIOA 5F0UA 2YH0A 2KU7A 2XLKA 4HTIA 5GAHI 2JL9A 2GMJA 4F8RA 2BQUA 2DGSA 1GX5A 1OSCA 2YKMB 2YQ3A 3N5BA 3MDFA 4WIIA 5IWAF 1I1GA 4X65F 5A2QY 3MD3A 1VC0A 4DQIA 1FCAA 1FJ7A 4DL7A 1FRJA 2F8EX 2XY7A 2DPJA 2XBPA 4RZRA 4TYAA 4OMFG 3VAHA 3SEOA 2VPXB 3LWLA 2AGQA 2UVVA 4IOCQ 2OP5A 3FZBA 3OTBA 4OJ1A 2KH9A 3J81Y 4I0WA 1TL3A 3AAWB 2XI3A 4NCGA 4K4WA 1T94A 1I94F 5EWEA 4ECSA 3OTOF 1U24A 2I8EA 2KB2A 2DGUA 2N82B 5E3QA 5J2PB 5C25B 4IRKA 1R0AA 3BO3A 2YKAA 2AX0A 4O3SA 2YKOA 3FVYA 3DLGB 1S48A 3HKZD 4IYQA 4NZ0A 2XB2D 3OTCA 1N5TA 1Q7LB 1U25A 1X5OA 2JH3A 4PQUA 3MM9A 3TAMA 2UUCF 4J9RA 1MMDA 3ISND 3CGIA 4HH0A 2R4FA 4IQMA 3LAMA 1H98A 3LF0A 2DNMA 2VKRA 3M6UA 5DRKA 1LWFA 4F25A 1FHTA 3G6ES 2MPUA 2W4PA 3HT3A 1NO8A