2WCUA

Crystal structure of mammalian fucu
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
Knots found
sequence length
149
structure length
149
Chain Sequence
MVALKGIPKVLSPELLFALARMGHGDEIVLADANFPTSSICQCGPVEIRADGLDIPQLLEAVLRLLPLDTYVESPAAVMDLVPSDKEKGLQTPIWKRYESLLLEADCKKTLMKLERFEFYERAKKAFAVVATGEMALYGNIILKKGTLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FUCU HOMOLOG
publication title Crystal Structures and Enzyme Mechanism of a Dual Fucose Mutarotase/Ribose Pyranase
pubmed doi rcsb
source organism Mus musculus
molecule tags Isomerase
total genus 44
structure length 149
sequence length 149
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.1.3.29: L-fucose mutarotase.
pdb deposition date 2009-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05025 RbsD_FucU RbsD / FucU transport protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1650.10 Alpha Beta 3-Layer(aba) Sandwich RbsD-like fold RbsD-like domain 2wcuA01
1OGEA 1OGCA 2WCVA 2WCUA 3P12A 2OB5A 3P13A 3E7NA 3MVKA 1OGFA 4A34A 1OGDA
chains in the Genus database with same CATH superfamily
1OGEA 1OGCA 2WCVA 2WCUA 3P12A 2OB5A 3P13A 3E7NA 3MVKA 1OGFA 4A34A 1OGDA
chains in the Genus database with same CATH topology
1OGEA 1OGCA 2WCVA 2WCUA 3P12A 2OB5A 3P13A 3E7NA 3MVKA 1OGFA 4A34A 1OGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGE A;  1OGC A;  2WCV A;  2WCU A;  3P12 A;  2OB5 A;  3P13 A;  3E7N A;  3MVK A;  1OGF A;  4A34 A;  1OGD A; 
#chains in the Genus database with same CATH topology
 1OGE A;  1OGC A;  2WCV A;  2WCU A;  3P12 A;  2OB5 A;  3P13 A;  3E7N A;  3MVK A;  1OGF A;  4A34 A;  1OGD A; 
#chains in the Genus database with same CATH homology
 1OGE A;  1OGC A;  2WCV A;  2WCU A;  3P12 A;  2OB5 A;  3P13 A;  3E7N A;  3MVK A;  1OGF A;  4A34 A;  1OGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...