3A1WA

Crystal structue of the g domain of t. maritima feob iron iransporter
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
159
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(II) transport protein B
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 47
structure length 159
sequence length 163
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1wA00
1YZUA 3BERA 1IJFA 3QKSA 2X2FA 4RCZA 2R62A 1ZC4A 4NPHA 2GJ8A 2IUTA 1TPZA 1K5GA 1AGRA 4AG6A 1G20E 4MGKR 4LUCA 3LQQA 4PHGA 1AGPA 2PZEA 2ZUBA 5F2EA 3SYNA 2LKDA 3QPWA 1KDPA 1X6VA 5HCIA 3BFXA 1M7GA 5EE1A 3AKYA 4XOIA 1NN1A 4OHXA 4EIWA 4UNSA 2R6AA 3CNOA 1KI3A 1SVLA 1Z0DA 3B1XA 3LLMA 1VG0B 3X1ZA 1NBME 1W2HA 4OK3A 1E2FA 1EFTA 3A1VA 3CRW1 2V54A 4Z51A 2G0NA 2BKEA 2ZI4A 2W58A 3TE6A 2RGAA 4NU0A 3RVBA 4B3FX 3AVOA 2CLDX 4BFVA 1YR6A 4XWKA 4KI0A 4C0SA 3UPUA 1PUJA 3T1TA 1T91A 3FB4A 4KFRA 4ZCIA 2C04A 1T0JB 4O0MA 3NTUA 1E9SA 3U60B 3Q5EA 1YE8A 4YMVA 1AKEA 2QMHA 4UJ5A 1YZTA 3E5HA 1G6OA 2GESA 4F4JA 1P9NA 4K8OA 1Q1ZA 4ZDIA 1F3OA 3QIAA 4A0FA 1J70A 1ZINA 1XD2B 2F1RA 4KFSA 4LHZA 1GFIA 3Q72A 1TADA 1KZGB 4L9SA 5JZVA 1BO6A 1L4YA 2O5VA 1D2EA 3U6KA 2FE4A 5G41A 1FW6A 5AWFC 2WWFA 4UNRA 3U3RA 2X77A 3PUYA 4HLUC 4KFTA 4RSGA 3QSYA 2WOJA 4JYCA 3FYHA 4TYQA 1O3YA 2ZJ2A 1NY5A 3DOEA 2QEQA 3QEJA 4C2UA 3K0FB 2WICA 2N46A 3AVVA 3O8DA 5EXSA 3SYLA 4RKFA 1AS3A 4DIEA 4MYTA 4BRUA 3VNVA 5BYJA 2Q6TA 1YU9A 4LV5B 2AKAB 3VAAA 1IN4A 4D2IA 4OI4A 4BPBA 3C4JA 1G8PA 1S96A 4IXNA 1F5NA 3CPEA 4ESHA 3TW8B 3N2EA 2CHQA 2VP6A 4AKIA 3EPHA 2ONJA 3LXXA 1W0JA 1KSFX 4EDHA 1YZQA 2IWRA 4KITB 3UWKA 5FOTA 5E7JA 4CDGA 1E0SA 5E7IA 4G5QA 1IXZA 3I5XA 2YJTD 3B78A 2E1RA 2VHUA 1W7AA 3FGNA 5IHPA 1WXQA 2H57A 4V0OA 1XMSA 2VF7A 5L3RA 2XB4A 4JSYA 3KQNA 1NSFA 2RGEA 1IQPA 3D8BA 4TMWA 2IEZA 3LX5A 2C78A 3I5YA 1JB1A 2JIZD 2C98A 3CWZA 3GEHA 3A36A 4YMUA 2UZ3A 4B75A 2FEOA 3SYKA 4LHWA 5JWHA 2AWOA 3AUXA 4C0BA 2ZREA 2D74A 2ZYUX 2R2AA 4GP7A 1E2QA 2FU5C 2GCOB 1NIJA 1RRCA 2J59A 1TU3A 2IW3A 4PQFA 2OESA 1P60A 1E0JA 2ZRMA 3IGFA 2DB3A 1G3RA 4B3DA 3BBPA 4LV8B 3TUJC 2FFQA 2X19A 4DUGD 4ESVA 1XZQA 5B58C 1W47A 3V00A 1R8QA 3UIEA 1YHNA 2QUZA 1N25A 4BRWA 3QXHA 2OUKA 2IYWA 3SHFA 1NIPA 2ZR0A 3ZZUA 4AYXA 4GPTA 4Q02A 2NO6A 2XNDD 4A36A 5FTJA 4F7WA 1CLUA 1W2GA 3CRMA 1NVXQ 4GT1A 1N6NA 3UATA 3BGWA 1Q44A 1QHXA 1S1MA 2IYYA 3A4NA 4FI3C 3CPJB 2J7PD 2VH5R 5FI0B 3KL4A 3QPVA 1GDDA 3CF0A 5AUPB 1IJEA 2R9VA 5GJCA 4ZDJA 1E4VA 1M2OB 3K70D 4ON9A 4C2TA 1G3IA 3ZDQA 3ZVMA 2VSXA 5LDDC 1E1RD 1NG1A 2A5YB 2W6IA 2GA8A 4IEEA 1XF9A 4IFEA 3HPRA 1DE0A 1R4AA 2OE2A 4KO8A 3WHKA 4AK9A 2Y8EA 2KBFA 4C0AC 4QNRA 2P6NA 4B3XA 3G0HA 1ZD8A 2DY1A 3DVLA 3GPLA 2AXNA 1QHHB 3ADKA 4O2RA 1KJYA 1JAHA 3RRMA 1T3HA 2RGCA 1YR9A 5L3QA 1XEWX 1KDOA 1RYHA 5FBQB 1N5LA 5G40A 1S0UA 2GF9A 3IIJA 2AXPA 5BWMA 4L9WA 5H8WA 1DAGA 3L43A 3PXGA 3I3SR 2G1JA 2I1VB 5FPSA 4BLQA 4D81A 3VNUA 4ZDKA 1E2KA 4G5RA 1R8SA 1VYUA 1XDBA 2FX3A 4UKDA 2ZRBA 2R6FA 3LNCA 2R44A 4HYYA 4B2IA 1G17A 4FCWA 1UBFA 2OFOA 2IYZA 2BMFA 1UKEA 4JIMA 1OW3B 4QRHA 1BYUA 3I92A 4RFSB 4P4SB 4BFSA 3CRVA 3GFPA 4A8JB 4Q47A 2DBYA 4M4SA 4A4DA 1IBRA 4OQXA 3GLIA 4QOSA 4TTQA 3G5UA 2BCJQ 4TSFD 4B35A 4XVUA 1FZQA 4B32A 3EIHA 5EE0A 5G53C 2D4HA 4GOKA 4DDVA 1OFHA 3KTAB 2F43A 1GAJA 1SKQA 4PFSA 4XJXA 5KUTA 1ANKA 1RJ9B 1NBMA 3C5HA 3F8TA 3VKHA 2MSEB 1DTSA 4JSTA 4LI0A 1OKKA 4W5JA 3TRFA 4L15A 3EW9A 3ADCA 3ADDA 3BH6A 3RSLA 4HUTA 4MQBA 3RC8A 1M7HA 1Q22A 2J0VA 3ZD7A 4P0TA 3QI2A 4L8GA 1P72A 1KAGA 2O0HA 4XD7A 5CITA 1T8TA 3TR0A 1UKYA 3A1SA 2B21A 3ZZTA 5CYPA 3ICEA 1F48A 3LVQE 4BQSA 2A9KA 3AVQA 2HV8A 4A2WA 1U0JA 3EZ7A 4QL3A 1TTTA 3BD9A 2WJJA 4GZMA 4A2PA 1N2CE 2OAQ1 3AVUA 1KI6A 4QGFA 5A0FA 1DOAA 5H1YA 4F4CA 1SXJA 4M53A 3SJZA 5EXPA 4CZ2A 3ZYCA 3UANA 4KAXA 1FTSA 2PEYA 2WVJA 4IFBA 2QRNA 3LX8A 5EQTA 5KPDA 3CH4B 5AJYA 4EUNA 1ZCBA 2QZ4A 1BS1A 1NVVQ 2J5XA 2NPFA 5FTMA 5EUMA 1LY1A 3DZ8A 3KTAA 4E09A 2ZS8A 4Q4AB 1CEEA 1NNEA 2PLRA 4Q4JA 2ZJ5A 5C4MA 4Q18A 4JLKA 5DHFA 2CE2X 5DSZA 3MWKA 1RRPA 3CM0A 1KI9A 4BZXA 2WSSD 3E70C 4Q1CA 2B7BA 2PH1A 1BOFA 4EQ6A 3IPXA 4PC6A 3GLHA 2Q21A 4GRAA 4L5BA 3NVAA 4EPXA 1Z6AA 1M1YE 3K1JA 3R20A 4AI6A 1FQKA 1I4DD 1NG9A 3S1AA 4AG5A 2C9YA 4MUBA 4OYHA 3L0OA 4DSTA 3A1WA 3MWYW 3THWA 2NO7A 5EUQB 1U94A 4XSGA 5EZ5A 2NQ2C 2IYTA 1EFCA 3D31A 4P4TA 4DT1A 1BH2A 1QZXA 1HV8A 3KKOA 4I1UA 4HZUB 5M04A 1VHLA 2IXEA 2V7QD 2WM9B 3CF2A 5DO9A 3W6PA 4A6XA 1M7BA 4CEIB 3OEHA 4MRVA 4L4UA 3A37A 4CEHA 4Q19A 2VL7A 1W4CA 4TMXA 3W5JA 2J46A 4YQFA 5L3SA 3RABA 4KLNA 5HPYB 1OV4A 5LD2B 3CRQA 2QY9A 4PPQA 2MSDB 4P3YA 2PT5A 4PQYA 4BLSA 3LVRE 2GHIA 4TLBA 5L3SB 1F2TA 1RKBA 1G5PA 1DVRA 4NYMR 4MYHA 1GRNA 2QT0A 4MRNA 1R7RA 3CBQA 4E5UA 4CIDA 1S8FA 5HKKA 5DHAA 2E9SA 4PAOA 3BH0A 2X2EA 1E9AA 4LBVA 2BEJA 1G3MA 5ELXA 1OH7A 2EQBA 3HR8A 4URZR 1T5IA 4MUAA 2QQ0A 1FTNA 2ZXUA 2WWYA 1VTKA 3AF2A 4DLVA 2DFNA 3BB1A 1JI0A 4LJ9A 3UG6A 3EXAA 4LWZA 1JALA 1G18A 4CVNA 3QG5A 4RZXA 1PVOA 3ZVLA 1W48A 1QVAA 3ZVRA 2D3WA 2OHFA 3FHCB 4QJ3A 4O3MA 4RVCA 4U7DA 1CP2A 5IDVA 4D4MA 2BDTA 1Q21A 2VLIA 4MYUA 1AK2A 4JLJA 5A4JA 4IVRA 3C7KA 4JBWA 5C2JB 3WYAA 4XH9B 3SR0A 4LBZA 5CK5A 1WE2A 4NYJR 4DJTA 5CDFE 1U8ZA 4JZKA 5FUXA 1WP9A 4C0HA 1IM2A 1W44A 3O8BA 3WMGA 2RAPA 1DAFA 1J8YF 4C7OB 3Q7PA 1JEEA 1Y63A 2ZTSA 2MMGA 2CL7X 4ZPXA 4M1TA 4ZV4A 3OIYA 4PSKA 3CX8A 3VU9B 4OKSA 3BRWD 4DC9A 3X1WA 1XTJA 4HB3A 1AKYA 1G3QA 2JIZA 3MJHA 3FPAA 1VCIA 2QP9X 2V55B 3K9LA 4B6EA 3NBFA 1ZM9A 1KMHB 2WSMA 4HAZA 1RVDA 4JKYA 2QAJA 4LC1A 4TTRA 3TIFA 4DHEA 5JJKA 3NC0C 5HE8A 3T35A 2GVZC 1SVIA 3PFIA 3PEUA 2ZIAA 2KI5A 5G3YA 1P9RA 5B64A 3NDBB 2GRJA 4M9ZA 1OB5A 1UEJA 1JXOA 5DI9A 1YZGA 1A1VA 2G77B 4D82A 4BLPA 1UM8A 4D6PA 3GLGE 2IYQA 4JLNA 1Z0KA 3T1OA 3OIVA 4RKEA 1ZJ6A 5DH9A 3CZPA 2Q3HA 3QXSA 2ZM5A 1R0ZA 2ZAOA 4WVFA 5CYOA 1BMFD 1KO7A 4OI1A 3GLIB 4B71A 5F9HA 3ASZA 5B57C 1E2EA 2A3RA 1II9A 2C8VA 3K0AB 3U4QB 1R0WA 1Z2CA 4PZYA 1GSIA 1UDWA 4G1UC 2QE7D 1E4YA 4M0LA 3NG1A 5JECA 4FMDB 3ICQB 1P6XA 4YLGA 4V02A 3VR5A 2VYFA 1A7JA 1QG2A 1C4OA 5KYKA 2VHJA 1P9WA 3WNCA 1CJMA 1COWA 4D0LB 1E2NA 1JPJA 1KSGA 1I2MA 4UNQA 4C30A 3KB1A 4XSHA 1XTIA 1W4BA 2OLJA 1ODFA 4D4JA 4LSGA 2F1HA 4IVPA 1Z6GA 2XTNA 3EWAA 4AWXA 4C0JA 4JYBA 1XXHE 2HCBA 5HZKA 1AM4D 1P2VA 3THYB 3KJEA 1ELOA 3S1AB 3SEAA 1OH8A 4Z8YA 1P2TA 1U0LA 2DFLA 2OT3B 2W0MA 4JVLA 3EPJA 4V03A 4A2QA 2WKQA 3GFOA 1E3MA 2JDIA 2NIPA 4B74A 3AP1A 1A4RA 4YC7A 2VHTA 1OJLA 1DAEA 1FNNA 2YWEA 3EPKA 3P4YA 1E2HA 4GMDA 2C77A 3BB3A 1YZNA 2ZROA 4DKXA 4FINA 5FPYA 1ZD9A 4X8OA 1JJ7A 1PJRA 4XVRA 4TL8A 4I99A 1H8HA 4DCNA 5C18A 4DXAA 4HB2A 5TMPA 2QPOA 2BIFA 3IBGA 1GTVA 2ZANA 4I1OA 4MGYR 4OJKA 4Z8XA 2XB2A 3K0AA 3AQ4A 3BFVA 5FI1B 2VSFA 1EWRA 4LHXA 1SVMA 1IOZA 2FJUA 5KDLA 2QE7A 4M22A 4ZKEA 4DEXA 3W8NA 1ZNZA 4W5WA 2IYLD 3ASYA 4PO8A 5CK4A 1ZNWA 1US8A 2YYZA 2YZ2A 2IXFA 1OXUA 2FSFA 2ONKA 1EX6A 1KTVA 5E4FA 1KI2A 1NL3A 3BORA 4OQMA 2PCLA 2C96A 4IOKA 2WOOA 2GBLA 2YWFA 4TSFA 3KJGA 1U8YA 2OO7A 1Z0IA 3A8TA 2QTFA 3B9PA 3I32A 3WP0A 4KXFB 1W36C 1OH6A 2A7QA 4B2LA 2P6UA 3I8SA 2OXCA 3KZ1E 5K8TA 3C14C 4Y0VA 5IK2A 1EFHA 2HCJB 2QAGA 4AKHA 2KB0A 3UG7A 2YOGA 3CWQA 1UADA 4Q7KA 1EFRA 2HF8A 4DSNA 5BN4A 5BYKA 2GVDC 2ORWA 1W36D 4QHYA 2F55A 4ILEA 2JATA 2ZRJA 4KBGA 4DLSA 3U6BA 2JLVA 1W5SA 3AF1A 3KX2A 1FP7A 5DYIA 1TNDA 1U99A 4NYJQ 4RFSA 4DCUA 2A30A 2Z83A 3Q8XB 5BXQC 3KXLA 2GXSA 3THXA 3AVYA 1GOTA 1T4GA 3IQWA 1L2TA 2FPMA 2WWGA 3N5CA 2GEVA 4IDPA 1CS4C 1Q57A 1ZM4A 4GFDA 3QXXA 4Q48A 5EE3A 2GJAA 3G82C 1T3SA 1TQDA 4NE2A 5HR5A 1DO2A 3AGQA 2V8OA 2I1QA 4O2LA 4B6FA 3B82A 3TNFA 3GD7A 221PA 1S9DA 2JJ2A 3I61A 3AUYA 5FTKA 1RC8A 4RD3A 2QRZA 2F3RA 3MWLA 5GVSA 1OPXA 2CDNA 3MRSA 1LVGA 1XZPA 4NHOA 3W9YA 3LY5A 4G5SA 4A15A 4QBFA 5KU1A 2WPDD 2W6JA 5FR1A 1T5LA 4JL8A 2G0TA 4WZBE 3GCGA 3RNLA 4DBLC 5J47A 3RS5A 2PJRA 4KSBA 2JJ2D 1XWIA 4QKQA 1XEXA 1TUIA 2YVUA 4S35A 4WZ6A 2FZLA 3W90A 5LD2C 1H8EA 2WJYA 4TYYA 3NC1C 2YOHA 3TSOA 3NH9A 4LJ7A 4OL0A 4US0R 1EK0A 2JCSA 3FVQA 3WBJA 3ZQJA 1GITA 3TAHA 1XPRA 2G3YA 1N5IA 1AIPA 4PC3A 5SZJA 4ASUA 1EWQA 4M1YA 3EG5A 4ABYA 2A5FA 4F4IA 2XZOA 3TUIC 1U9IC 1OFTA 2CJWA 2WZQA 4NDZA 5FBRB 1KMQA 2NPIA 3UMSA 2ZETA 4LOAA 1RRFA 4AYWA 3WNBA 2CL0X 2GNOA 3GLHB 1ZNYA 4MGZR 2IYUA 4EPVA 2RGNA 3LH5A 4PZLA 3GLFE 2O8CA 1GRRA 3NBXX 1G4UR 4Q1DA 3W8RA 4OJQA 3SNHA 3AM1A 2BBOA 4JVNA 2P5SA 2CVHA 2QENA 1TAGA 3E1SA 3H4MA 1CF4A 3VX3A 4P32A 5AUNB 2GCOA 2WHXA 2QPTA 3GJ8A 3EWSA 1KAOA 4KV9A 1VKJA 2AX4A 4TL6A 2EVWX 5ANRB 2OCAA 1Z06A 3BK7A 1TMKA 1G5TA 1GKUB 4M9QA 1FMLA 1S2MA 2GWHA 3KJHA 1TX4B 3DZDA 4MH0R 3VMFA 1VIYA 2WWHA 3SDZA 4CT5A 4EJSC 5KHOC 2J0QA 3VR4A 4FWIB 5FBWB 3BIFA 3C41J 3RLFA 2ZE6A 1OFIA 2JLWA 1VIAA 1QHNA 4Q4HB 3WP1B 1NVVR 4PX9A 1G7CA 1QG4A 2CHVA 3DPUA 1ZUIA 3QUSA 4MA4A 5LBIA 4DDUA 2H7VA 2ZRHA 2GILA 2R6DA 3RRYA 1JR3D 2IBMA 3HYRA 4JVMA 4M1MA 5IK2D 1J8MF 1WBDA 2QNRA 3DKPA 4BLRA 1AZSC 2BBTA 4AIIA 2FGJA 2J3EA 1FOEB 4D4LA 1E32A 4KYIB 2CNWA 3FKQA 2W83A 4KU4A 2F6RA 1AS2A 1RJ9A 5F3WB 5KO2A 4QC2A 2CEAA 4ACAA 5C1BA 4LYHA 4ZCLA 2ZJAA 1U0HC 4W7SA 3M1IA 1KHTA 4LDJA 1M6NA 3B1YA 3OAAD 4BFXA 1Z8FA 3ZS8A 3K70C 1T0HB 3LBIA 3FKSD 2BMEA 3QVVA 2JJ8A 5GJWC 2P2LA 2QTHA 5L8VA 1X8KA 1AS0A 3NHAA 4TZ6A 5JEDA 1GKIA 1YQTA 2ZRLA 2KBEA 3VX4A 4NKRA 4BEJA 1TU4A 2DPXA 2A2ZA 1KK0A 2FPKA 2QQEA 2W6JD 4B44A 2HT1A 1L7VC 1AQUA 4LZZA 3FKSA 3LFUA 4P33A 1J2JA 4R7ZA 2QROA 3QNUA 3EZ9A 2Q0HA 5FUYA 2NTYC 4N1AA 3JZMA 5J4KA 3AKEA 2DFTA 1UBCA 2XJ4A 3GP8A 3SBEA 1W0JD 3OFND 2GEDA 3VHXA 4M2LA 3KKMA 3MMPA 4PPFA 3TUZC 3ECCA 4I4LA 4PC2A 1MRNA 4JLOA 4D4KA 1BMFA 1KZ7B 3A6PC 1OYWA 2ODBA 2NZ8A 4ASUD 2YC4C 1E2MA 1ZAKA 4LBYA 4EPRA 3IPYA 4M8NE 4QGHA 1UEIA 1NJFA 2SHKA 1OHHA 1FMJA 2R8RA 5EP4A 4F38A 2C99A 3DDCA 3HP1A 2O0JA 1UDXA 1H8ED 5DN6D 3DMNA 1E9BA 1J99A 3SFZA 2ATXA 3KUCA 4UXIA 2NO0A 1XMIA 5FOWA 3OIWA 3RC3A 4DCVA 1E6CA 2A5GA 2ZJBA 3GJ7A 1GZSA 5EE9A 2OAP1 2ZUCA 4IOMA 5SZKB 4LJ5A 4CEJA 4UXHA 1W36B 1VMAA 3P32A 3W6OA 4NCJA 2QGZA 1Z08A 1A2BA 3TMKA 4C3ZA 1KY3A 5JCPA 5FTLA 2C2HA 1PLJA 1YZKA 2ASEA 2FFAA 2ZI7A 5KNDA 4Q4HA 4LYJA 2ODWA 1CRPA 1MKYA 4AURA 2GTPA 2D2EA 1KNQA 1AJEA 3GEEA 1CRQA 4DRZA 3QXJA 4JJZA 1NMYA 4QM7A 1RPZA 3R7WB 3PJRA 3AVTA 5GVRA 3RRNA 2BVNA 2GZHA 2O8FB 721PA 4WA7A 3C16C 2GXAA 3WMFA 2H1LA 1WRBA 1EESA 1EFUA 3EASA 3GFTA 2GF0A 1C9KA 3IHWA 1XCPA 2ZI6A 3D3QA 4DSOA 1D8TA 2ORIA 2Q9CA 1R6BX 1Q20A 4LC0A 2AWNA 4GZLA 2FFHA 4U5XA 1N5KA 2RMKA 1QBKC 1W5TA 3H86A 3B7GA 5P21A 3C5CA 3EAQA 3SJAA 3QEOA 3KDSE 3B5JA 1GNPA 3ZQ6A 4IEIA 1X1RA 2F9MA 2ZS9A 3QKTA 1KY2A 3I73A 5AR1A 3IILA 3MUFA 2JEOA 1U81A 1NP6A 4HDCA 4JKIA 1CJUC 2EFHB 3AF3A 4ITRC 4O25A 1ZC3A 4HATA 4TYNA 3N70A 3NH6A 1SHZA 3AF4A 4A8JC 2DCUA 5JS7A 3AVXA 4P31A 3L2OB 5JRZA 2AFIE 1ZP6A 2ZSEA 3U4QA 4HZUA 2RCNA 2OZEA 3KQLA 3NWJA 3X1YA 4CRWB 2XXAB 4BLTA 1IN5A 2RHMA 2GZAA 2V6IA 3M0EA 4EFNA 3FFBA 5JHGB 3UMRA 1DPFA 1FP6A 3PG5A 2N1BA 4OHWA 1SGWA 1ZYUA 3JVVA 1CR4A 1GM5A 4PO1A 1Z6XA 3RSOA 1QHIA 4OQFA 2QU8A 3NXSA 2CL6X 3UKDA 2YOFA 4PSVA 3ZZ0A 3U7GA 1NLYA 2WJHA 2QORA 3FMIA 2IWHA 2XGJA 3SJCA 2ZYVX 1WCV1 1XTQA 2O8BB 1E94E 1W1WA 4MITA 3K0CC 4RD1A 1XEFA 1W4RA 2H18A 4B3BA 3LV8A 3FE2A 4CW7A 3QVUA 1D2NA 5CJ2A 1FX0A 1N0UA 3MSXA 4TQAA 3K0SA 5AUQA 1ESNA 2G83A 3AGPA 3HYTA 4KSCA 3AP2A 1HQYE 3OIUA 2PMKA 5H70A 4M1WA 1LS6A 4LJAA 2WMNB 4KCGA 1GG2A 3RRZA 2ZYTX 3A1UA 2PMDA 1E9FA 2JLYA 1HT2E 3WRXC 2BV3A 5JJIA 3FWYA 4Q21A 4YONB 4IDHA 1LF5A 4MGIR 2ANBA 1RYFA 2ZU0C 3W3AA 3UMFA 2D2FA 2P67A 2WKPA 2ZRNA 1JJVA 3X1DA 3PV0A 5D3QA 1O87A 3KQKA 2WAXA 1E9DA 4N3NA 1RW4A 4HLDA 2YNMA 2Q9BA 4LJ6A 3I1FA 3R9XA 2RH5A 4HI0E 4JLBA 4AY2A 4YMTA 3O8CA 1XD9A 4WZAE 4BFYA 3F0TA 2BBSA 1VCMA 2J0UB 4LHVA 3R9IA 1OHHD 4QXAA 5F9FA 2GJKA 3W6NA 2XTZA 2NG1A 1KDRA 1DG1G 1LB1B 4IVQA 4Q01A 1R0YA 2IYRA 2OBLA 4POAA 3BJIC 2CCGA 3OEED 1JEDA 5HE9A 1E2LA 2G6BA 1G3UA 2PZFA 3MD0A 1XD8A 1LTQA 3HWSA 1IY2A 1KO5A 4OK6A 2V1UA 4OHYA 2VEDA 1CTQA 2FFBA 3QXCA 3KKQA 2WSSA 1EG7A 1N6OA 4TQUS 4OQNA 4YDSA 4UNPA 4Q7MB 2XX3A 5TXGA 2B8TA 2EW1A 2IUUA 1DG3A 2HEIA 3TQFA 5BN5A 4EFLA 4ZO4A 5BN3A 4D25A 1ZUHA 2XAUA 4UNNA 2ZE5A 4AKEA 2HLDD 2VA8A 1KI8A 1ZBDA 3ZIAA 2ZRIA 3SE0A 3TQCA 4C4PA 3NBZC 3ZS9A 4N0DA 2IYSA 3NKVA 2VRWA 1T6NA 2EFDB 2IS2A 1XCMA 1Z0JA 2FDCA 1YZLA 4K46A 4D80A 2B8WA 4HB4A 1I4LD 5FTNA 1UF9A 4A1FA 3K0CA 1S1CA 4B47A 1KK1A 4PQRA 2H16A 1GL9B 3B2EA 2F43B 1L8QA 2VQSA 5FL7D 1JQLB 4LPKA 4TT3A 3VQTA 1SQ5A 2OBNA 2JLXA 3T1QA 2VO1A 4TLAA 1DS6A 4W5HA 3AVWA 3IO5A 4DZZA 2CK3D 1JBKA 4OI2A 2IK8A 2RGXA 2A78A 2L0XA 4Q7LA 5C4GB 1MO3A 1MOZA 1ZRHA 2GCNA 2XSZA 3CNLA 3HDTA 5SZIA 4CEJB 1XJCA 2AR7A 3LBHA 2GCPA 3Q85A 4JBYA 4RZ2A 4TLEA 5JMTA 1Z83A 3RS7A 2VTKA 1N3BA 1XFAA 2BEKA 2JGNA 2P5TB 2IC5A 3TKLA 4A9AA 4X8MA 1RFLA 3QENA 4G3XA 2CLCX 3OEHD 4B48A 5JSZA 1AN0A 4M1OA 3CRRA 3EA0A 1MV5A 4EAQA 2XOKA 2ZEJA 1OKKD 1VYTA 5AK0A 1COWD 4LJ4A 3ZIAD 4KJZA 2BHRA 5JBQA 3K70B 2PX3A 2JLUA 3EC1A 3THXB 1RIFA 5K8UA 2ZI9A 4F91B 1ZD1A 4JL6A 1F60A 1P62B 1QVRA 3B1VA 4WAUA 3V4RA 1JPNA 1XTRA 2WJGA 1CR0A 3FHOA 3RYTC 5FL3A 3L82B 4AC9A 1N5JA 1LF0A 4NZYA 2D7CA 2Z43A 2CXXA 2DWOA 4QBGB 2V9PA 2ZPTX 3GJ3A 2BKUA 2PL3A 1SXJE 4V0KA 4ZI2A 4JJKA 1R5OA 3QF4B 4DLRA 3REGA 2REBA 2RB4A 1EGAA 1CIPA 3A58B 2QG6A 2XZLA 2GAOA 1N6HA 3UWOA 3IEUA 3MAAC 1GILA 1VCOA 2QBYB 2C9OA 4M1SA 3TAUA 1E1QA 2WJVA 1XPOA 4GMXA 4I1SA 2QM8A 1DAIA 3PUVA 3VR3A 3UXMA 4F92B 3LW7A 3CX7A 1UKVY 3T5DA 3LLUA 4M1KA 1B0UA 1GWNA 1SKYE 3Q9LA 2WIAA 4NYMQ 2FN4A 2Z4RA 1UFQA 2J7KA 2WPDA 2QN6A 4UJ3A 2C03A 4A6PA 1Q1EA 1LW7A 3K0EA 2NZJA 3OESA 4LPSA 4HZIA 3IHLA 2XITA 1Z47A 4HUQA 4XD7D 4II7A 2HLDA 3WY9A 4B3CA 5JRJA 4PPGA 5KSYA 4LYFA 1F2UA 4Q9JA 2CMKA 1F2TB 3RAPR 2P3SA 4JLMA 4PHHA 3GJ0A 3TBKA 2IX3A 2F1JA 1VDZA 2ZS7A 1XXHB 3HU1A 3T61A 4HDQB 4BEBA 3K0FA 5LPNA 1ZIPA 1GUAA 3TSZA 2RGNC 1SZPA 3FOZA 3NBYC 5E3HA 4FXPA 4HAXA 4R9UC 1NSTA 2QTVB 2Z4SA 4EPWA 1DARA 1IN6A 2QL6A 5HKKD 1Q3TA 1HY3A 3OAAA 2JLSA 3QKRA 5G3ZA 4DWJA 2OXRA 2A5JA 2H17A 1GP2A 3U44A 2FH5B 4KVAA 2UVQA 4MYCA 2CNWD 4DIDA 4KBFA 1BIFA 5CB6A 3EPLA 2QP3A 2BMDA 2OCYC 1PLKA 2I4IA 2OBMA 1OXSC 1Q1BA 3P26A 5D3MB 4CGZA 1OXXK 4MRRA 2ZSAA 5DISB 4FW9A 1WQ1R 1NN5A 4NONA 1P73A 4R98A 3RS3A 3EZ6A 1E2PA 1DBSA 3FMPB 1OIVA 1C1YA 4W9MC 2RGGA 3W3ZB 3CH5A 4RD6A 4LV6A 3OFNA 2RGBA 2MMCA 1E79A 5AJZA 4CEIA 1G41A 2LCFA 1UKZA 1VG9B 1G291 4DVGA 1Z07A 3T5GA 2ZRKA 4JBXA 5FR2A 4IJMA 2CHGA 3KXKA 4X8HA 1QRAA 1ZU5A 1WBBA 1X8LA 4TN1A 2EYUA 1TF2A 2AD5A 2CE7A 2BJWA 3VR1A 2ZJYA 2CLSA 2J7PA 2GKSA 2O8EB 3GJ5A 5LB4A 3VHLB 4EQ6B 4JVSB 2DHRA 1NLFA 3VR6A 4NMMA 4Z1MA 4LJ8A 3OHMA 4NCHA 1HE8B 3CPHA 5EP3A 1SHKA 4CF7A 4Q9IA 1VPLA 2AK2A 3CONA 1XB2A 4LYAA 1NJGA 2NO1A 4TYWA 2VHCA 2WMOB 1KO4A 3TVTA 1NKSA 3LA6A 2ZRAA 3K9GA 4KFUA 2ZU6A 5JHHB 1XNJA 3PR1A 2CCJA 2IT1A 1E1QD 1D2MA 1Z5ZA 3RDPA 4MDFA 2NMVA 2Q3FA 3SI7A 4FCVA 1X3SA 4TMTA 2O8DA 3CLVA 4QGAA 4HUQB 1FNMA 1YRBA 5JLJA 4PAMA 1R0XA 1G64A 4ZKDA 1ZW6A 2CJWB 621PA 4HSEA 5LB2A 5JI2E 3CR7A 4NYIR 2Z6VA 3L0PA 5DN6A 5B2ZA 4DB2A 1IXSB 1MT0A 4DLTA 3LRPA 5L3VA 2N42A 4BFZA 1MO5A 2WAYA 3RANA 3VU9A 1HYQA 1AZTA 3LW8A 4G5OA 2HXSA 2O8FA 1MO6A 3QKSB 4M21A 3SZRA 5JS8A 3HU3A 4ERNA 5L3QB 2QGNA 2ZRDA 3SS8A 3FHTA 3AKDA 1FL9A 4M9XA 3K9NA 2B7CA 4URYR 2UKDA 3IEVA 2HJGA 4DDTA 5TV2A 2GBLC 4X8LA 2FEMA 1XBTA 1Z28A 1ZM2A 2QA5A 1G8YA 1XRJA 4IKEA 4JT2A 5DE3A 3IIKA 3T12A 4GL2A 3U7EB 1HT1E 3ND8A 1BKDR 3THYA 4A0HA 1KO8A 1DEKA 4HAYA 1SVWA 1W46A 3D6TB 5D3MA 4B33A 4ZI3A 2Z5FA 2WTUA 1KMHA 1E2DA 1M74A 2FOLA 1KGDA 5JI3E 3C15C 2VHQA 4NL4H 4ZIRB 4IOJA 2FNAA 3LQRA 1II8B 2V3CC 3U44B 3AH8A 4RD2A 4IXMA 4B2PA 4ZCMA 4QHSA 5TVKA 4H9GA 1KSHA 1SVSA 3F5FA 1W4AA 4GI7A 1XTSA 3I8XA 4QJ4A 1E0AA 4S2EA 3CF6R 2AL7A 1XJ0A 1HUQA 5FH9A 2E87A 4BLOA 4LK2A 4XTRA 3EARA 1HH4A 4A92A 1NKTA 3H1TA 1I2DA 1K6MA 1DAHA 3GLHE 4PAQA 3BB4A 4HDOB 1NVWQ 3U61B 2WIBA 3ZD6A 1DAKA 5BW8A 3DO6A 1CJVC 1XEWY 2QMOA 5IF9A 3H84A 1WB9A 1FUKA 3N2IA 1XMJA 3SHWA 2IA5A 1SXJD 1US8B 3DKVA 2V4ZA 5CJPA 5EP2A 2JAQA 5JJLA 2ZRCA 4RJLA 2HT6A 5EP1A 1ZUNB 1QHYA 2G9NA 1GNQA 3ZH9B 2EWVA 2PCJA 1SKYB 3B85A 4HB0A 5JEEA 3A4LA 1FUUA 4GOJA 2QPAA 4JS0A 4QBIA 4AYTA 4GP6A 4KVGA 3PEVA 3MGCA 2BC9A 2ZI5A 3H2YA 2R6CA 5FUVA 1NLZA 2O8DB 1NMZA 3M6AA 2YV5A 4NCNA 5JSZB 1EX7A 4ZIRA 2EFEB 4YDHB 2GAAA 1N6PA 4DEYA 1D6JA 4NTZA 1N0WA 4Q00A 2ZVQX 3KUDA 1E1RA 2W6ID 3LXRA 5FOSA 4PC1A 3VFDA 3I62A 2WBLC 1GVNB 3RS4A 1KI1A 1E2GA 3W34A 4D0GA 2GJ9A 8OHMA 3QKUA 3L0IB 3BS4A 4CEHB 2F7SA 1NN3A 1U9IA 3CX6A 4RY2A 3P1JA 1LS1A 4Q1FA 3O47A 1Q12A 4TLDA 3U5ZB 3SQXA 2FF7A 2VSOA 4EJSB 5FBVB 2VF8A 2XNDA 3FMOB 4WXRA 2HDNB 5GJBA 1YVDA 4UQOA 2EFGA 1N6IA 1XU4A 2H8KA 5KSPA 5KPJA 3OE7A 3QBVA 1Q1QA 3GJ6A 3KJIA 4XTCS 5J4VA 1ESMA 3ETLA 2J0SA 2P6RA 4YMWA 5GJVC 5UKDA 1NF3A 2QT1A 3DHWC 2H5EA 3EA5A 4PHTA 1G1MA 1U90A 1U2RA 2FGKA 1KI4A 1PUIA 1VCNA 4B76A 1KKLA 1ZM7A 2HYDA 4PHFA 1E9RA 2O0KA 3L0SA 1OFUX 3CUEF 3P27A 4Q4LA 5J5CA 2CVFA 4PZZA 3SQWA 1SVOA 2GDJA 1OIWA 2W2TA 5SZHB 2D7DA 1G16A 1HQCA 2KWIA 4MKIA 1N0VC 4GOXA 2C9CA 3GJ4A 2BWJA 1NY6A 2XJ9A 4YMSA 1GL6A 2ECKA 4OBEA 2KSQA 2OFXA 4RD4A 1MABB 1NVUQ 2P0EA 1E9EA 1II8A 1RRGA 2ANCA 1XTKA 3FFAA 3NIBA 4FN5A 4I1VA 4IDNA 4M9SA 4U02A 4R71A 2AHOA 4JLAA 3DL0A 5CIWA 4QHTA 3PVSA 1JNYA 3HU2A 4EPYA 1XPUA 2F1IA 4MKFA 4NP6A 1S3SA 4D26A 1VHTA 3IBYA 4DLWA 4IW3B 1HA3A 1IONA 5CM8B 1WF3A 4CT4B 3WNDA 4URWR 3KQHA 1V5WA 2GETA 1CKEA 3R7WA 1Z3IX 3U2QA 1QHGA 2ZAMA 1IXRC 4YXWD 3QY0A 3SN6A 3TLXA 2J0UA 4LRWA 1KO1A 1KI7A 1G7SA 4Q9LA 4MKGA 1VG8A 3VKGA 2ZITA 1Z6YA 2ZRGA 5EZ6B 4IDQA 2X1VA 4MRSA 4DUGA 3EX7C 5IT5A 1H65A 1PZNA 1M34E 1OB2A 2PEZA 4I81A 3MLEA 1Y3AA 1TF7A 4HEJA 1EFRD 2AD1A 2BMJA 2PX0A 2WWWA 3M4YA 1OH5A 3WHLA 1VYVA 4EKDA 1OSNA 3GJXC 5EXXA 1HURA 5KSZA 3GMTA 3UK6A 2FA9A 2O8EA 4R2HA 2HXYA 2BBWA 1N6LA 5AJWA 2ZQ5A 3NDPA 2NGRA 2JLRA 4US2R 3PEYA 1A2KC 4B43A 4E03A 1MABA 5DGXA 2QM7A 2VP0A 3QOFA 4TMZA 3THOA 1UAAA 1LV7A 4IOLA 3L8YA 3AB3A 4GDFA 1W0KD 1I4TD 3U3MA 1FPMA 1GNRA 1IN7A 4KODA 3FDIA 1FQJA 4YXWA 1L4UA 4C7OA 2BCGY 2JJ1A 2D06A 4HLCA 3AEZA 3AP3A 4JL5A 3BXZA 2OV2A 4A8JA 1CBUA 1N6KA 4LX0A 3BH7A 4TL7A 3J81k 3V4FA 1QDEA 4B34A 1CJKC 4G5GA 4NCIA 1PLLA 2OEPA 3AV0B 4QJ5A 1D9XA 4E22A 5CIQA 4H1UA 2DWQA 1ZU4A 2OM2A 2ZE7A 3PQCA 1KK3A 3BOSA 2EU8A 4TLCA 5BQ5A 1DADA 4V0LA 1II0A 1G7RA 3A1TA 3BE4A 1F2UB 1NI3A 1J7KA 3KXIA 2IF0A 5E95A 2OG2A 4L16A 2YKGA 4Q4JB 3NEYA 4PPNA 4BGDA 3IO3A 3KKNA 1XP8A 3KKPA 4XWAA 5FPKA 3GQBA 1OXTA 5KNBA 2LKCA 1JR3E 4BUJA 3THWB 1BYIA 4J0QA 3B13B 3WYGA 1XMVA 4IRUB 2ODEA 1MO4A 4GSYA 1P2UA 4Q9KA 4TL9A 2JJ1D 1CR1A 2D62A 2XZPA 2IS1A 1E69A 5C46F 1KJWA 1D5CA 4QG7A 4PR0A 3PUWA 5HZHA 1CXZA 4ZDWA 4AD8A 4OHVA 4A82A 2WWIA 1X86B 2B6HA 2FV8A 4P4UA 3VR2A 2QMUA 4KYUA 1TF5A 3ZJYA 4AKGA 4TTPA 2W2VA 1ETUA 5TDHA 1LNZA 3ZLJA 3IIMA 1P75A 4DLZA 3TSWA 2JDID 2XEXA 4HLUA 4UXJA 1K8RA 1QF9A 2JLQA 3BWDD 2GEUA 4C0KA 3C8UA 1ZCAA 3MG9A 2HF9A 3LD9A 4GBMA 4Q5IA 2JA1A 3SU8A 2KJQA 2ATVA 2PBRA 4JLPA 4QNMA 1TQ6A 4OI0A 3R8FA 4KLZA 2ERYA 2ZSBA 2G1KA 4A0RA 6Q21A 2IEYA 4V0NA 2ZE8A 3CIOA 3EZFA 4TQ9A 2EFCB 2J41A 4DLYA 3IKJA 2CBZA 2X8AA 4DLUA 4JMPA 4QGGA 2BM0A 2XTMA 2QMEA 4BECA 4PC7A 2WWXA 4IHQA 2R65A 4V0MA 1U98A 5B30A 5KNCA 3RWOA 4WOPA 3LWNA 2J45A 1ZIOA 4URXR 121PA 1OIXA 2IHYA 1SXJB 2VP4A 3CB4A 4WBSA 4EFMA 1R5BA 2A5DA 3CZQA 2Q3MA 3ND9A 3T06B 2C5LA 3WRYC 1G4AE 2VBCA 2WV9A 3PUZA 5KDDA 2XNSA 2FWRA 4D0NA 3PITA 2QP4A 3TGPA 2ZUDA 4LHYA 521PA 3DMDA 4LCBA 4ARZB 1P5ZB 5AUOB 5DIFA 2QAGC 1TL7C 3BC1A 2K5UA 5J4YA 3P4XA 3IDQA 1RZ3A 1KJZA 4FMCB 1E2JA 2XSZD 5E7MA 1CR2A 4PANA 3O8RA 1DAMA 1KSJA 3NHBA 1XX6A 4LBWA 4HAVA 3B9QA 5FOUA 4JLVA 2WJIA 4US1R 2REXB 421PA 1IY0A 3I72A 4FCTA 3L8ZA 4XWOA 1QHHA 1CJTC 2REOA 2EYQA 3TJZA 3RHFA 4MDEA 2IL1A 4FWTA 1G8FA 3H0KA 3QF4A 1W49A 1LFDB 1YRAA 3EIQA 4RCYA 5FPHA 2FPLA 2YC2C 2DYKA 2QI9C 4DSUA 1IHUA 2YHSA 3IUYA 1X1SA 2NO9A 2V7QA 2FMXA 4BFWA 5CLLA 2QSZA 1JR6A 3WYFA 1FX0B 4BZQA 4G0NA 3NEJA 4DCTA 5DNYB 2V6JA 4K81B 1K5DA 1R5NA 2GJSA 2RGDA 4B73A 1PV4A 3PCRB 4FIDA 5EE5B 1WA5A 1GRQA 3K09C 2XOKD 4CYMA 5KDOA 1G8HA 2OFWA 1JQJC 2PLFA 1KK2A 1G5RA 2ZJZA 1E9CA 3EIEA 2OCBA 3GLGA 5TB5A 3F3YA 1E2IA 2O52A 3U7HB 1OXVA 1XD2A 3QPUA 3MCAA 5HTKA 5JFGA 2VP5A 2DR3A 2RHDA 2OLKA 3CKLA 1HEIA 3QQ5A 4WW0A 3MFYA 4QFMA 3WBKA 3PIRA 2PT7A 1OLOA 1TEXA 5FPTA 3RWMB 3GEIA 2ZRPA 5EJEA 3CR8A 4DB4A 4Q1AA 1NRJB 4FMCF 3HJNA 3QG1A 1TQ4A 4FMDF 1HE1C 4C0QC 4TYPA 2DWPA 5DYGA 2O8CB 1T3LA 3AF0A 2ZR9A 1ZM3A 1UBGA 5CDFA 1E99A 1OF1A 1UPTA 5JWRA 3GLFA 3DM5A 3KFXA 3R8CA 4E07A 5TARA 1R10A 1KOFA 1T9HA 3X2SA 3QF7A 5J4LA 1P7CA 1GIAA 5K8LA 1Z2AA 1J90A 4PTLA 5JCZA 2NOAA 3ONWA 4MRPA 5KOYA 2BOVA 2GK6A 4Q1BA 4G01B 4DT1B 1XCGB 3GLGB 1JECA 2ZR7A 1OT3A 1V43A 3EC2A 3SFVA 2VP2A 4BE7B 1DO0A 5CLQA 1MR3F 1S9HA 4PXAA 2IF2A 4BFUA 2IYVA 1E98A 1KI6B 1NBMD 3P20A 3QJYA 4NYIQ 4QBHA 4RFVA 1A82A 1MH1A 1AA9A 4OHZA 5IRCD 2KE5A 1TUEA 2TMKA 4EJSA 5DLQC 3DOFA 3R9WA 1YKSA 3HR7A 1KYIA 4A0GA 2O8BA 1TQ2A 2GZDA 2OCPA 3JZAA 1ZVQA 2W00A 3ADBA 1JAIA 4TMVA 5FOVA 1WMSA 2ERXA 2DFKB 2YWGA 3B1ZA 1P4SA 4GNKA 5H68A 1UBEA 3B6EA 4Q1EA 1P3JA 3KQUA 1G7TA 5FBLB 1OE0A 3TH5A 3OF5A 1YR7A 1HTWA 2AK3A 2WKRA 5AJXA 4FMBB 4TWZA 3ZGXA 2UZIR 1KIMA 1A5TA 2ODNA 2FG5A 3AKCA 4JT4A 3T34A 4BASA 4BWYA 3GLFB 1Z0FA 1Z0AA 2LWIA 2CCKA 1F6BA 1SULA 2ORVA 1JXMA 3QBTA 1GL7A 3I4LA 3LDAA 3PENA 4Q7JB 4OK5A 4NBSA 2W0SA 3WXMA 3QKRB 4Q66C 1TEVA 1QHSA 2MSCB 1JR3A 3B8HA 4LJYA 3EZ2A 3X1XA 3U3KA 4LY6A 3OZXA 4P4SA 5AJVB 2J1LA 4RD0A 1U8AA 5F98A 1G8GA 3CO5A 5FL7A 1Z22A 2PZGA 3TR5A 4DCSA 2ZJ8A 4Z1MD 1E96A 1N6RA 1YJ5A 2OILA 2G88A 2FSIA 2Z0MA 1SVKA 1RE0A 3U3JA 1S3GA 1P2SA 4HAWA 5TY0A 3TW4A 3K9HA 1YR8A 2B92A 3IQXA 4KHZA 3RS0A 4ACBA 2VIIA 2F9LA 2XXAA 4C0LA 3LAWA 4Q4AA 3Q7QA 4Q03A 5EXTA 1M8PA 3BFKA 3D7MA 2FSGA 5A5GA 3HPQA 1IY1A 3KB2A 4URUR 3E2IA 2IHBA 4LGMA 5J40A 1CULC 4RZUA 1Q0UA 3VTKA 4DDWA 3TVDA 1X8JA 4URVR 1ONBA 2YWHA 4C9BA 2RKOA 1G9XA 2F3TA 1Z29A 1E79D 4FD2A 1G6HA 2QBYA 5DI3B 3W5IA 1H8HD 2EWWA 2GXUA 3DEFA 3Q5DA 4XVQA 2PJZA 5CB8A 1NMXA 3B1WA 3CNNA 1S4QA 4NH0A 3B60A 5GADl 1XEXB 2W2XA 2JLZA 5DI3A 3OE7D 3OEEA 3RS2A 1B23P 3K09A 3PEWA 4Z54A 1D9ZA 3AVPA 2ZYWX 3KFVA 3SOPA 4TZ0A 3U3OA 3CW2A 1XJQA 1VECA 1Q3HA 4NCKA 1EXMA 4DLXA 1KDTA 3LO5A 4BFTA 4Y0AA 2I3BA 2ZVPX 3FMFA 2ZSDA 3QE0A 2J87A 3T15A 4PO9A 2VP9A 2IXGA 1ZNXA 1VG1A 3SJBA 2IS6A 2ZJOA 1FFHA 3DM9B 1XXHA 3PUXA 2AFHE 1KNXA 1P61B 4U00A 1CU1A 4R2IA 3A4MA 3K53A 2GXQA 1IAQA 3WMEA 2BM1A 3SBDA 2J9RA 2R6GA 5K8IA 1Z6TA 4F93B 4WIAA 2HYIC 1KKMA 4HLQB 4QM6A 2V1XA 2IYXA 1R2QA 4BZPA 1GKYA 5FFMA 3REFA 4MKHA 2IS4A 4JLDA 3VKWA 1E0KA 4XIGS 821PA 2QSYA 1Z63A 2ZSFA 2FZ4A 5KTYA 4PSAA 1NN0A 3SC3A 5KSOA 1AQYA 4RZ3A 3MWJA 2H92A 5FOXA 5HCNA 5J4HA 3GLIE 1ZMXA 3JVUA 2JASA 2C95A 2OSBA 3ZVNA 2QAGB 2FSHA 2GK7A 3TK1A 1UJ2A 2AN9A 4B3GA 2BJVA 4WXPA 3FTQA 4V0ME 1DELA 1W0KA 4IDOA 1SXJC 4OQLA 4Q9HA 5FUWA 3V9PA 3U7FB 4TT3D 2YINC 3K8YA 1G19A 2AKYA 2CK3A 2P65A 2ZI3A 5JWOA 3T1VA 1IN8A 3BAFA 1MRSA 4TMKA 5CM9C 4ARZA 1G21E 4HAUA 2IUSA 2VPPA 4EPTA 2HUPA 1T8UA 3MJRA 2Q9AA 3LBNA 1WDTA 3Q3JB 4H1VA 4N0EA 1OYYA 2HJVA 2ZRFA
chains in the Genus database with same CATH superfamily
4EYKA 1N32B 1IJFA 5TT1A 1Q77A 3DXXA 4CFSA 1OTYA 1T36B 2P90A 3OSZA 5CG2A 1S2IA 2ZCVA 3QIVA 4D8UA 4NPHA 1TPZA 1W581 2ZB3A 1AGRA 4YP1A 2V6MA 3L92A 4EL0A 5EJGA 5IJ0B 4O4IB 1YOVA 3MTGA 1LEHA 3D4BA 1IY9A 1AGPA 2NU9A 3G6KA 4ISBA 4HTFB 2VSQA 1CIVA 1M7GA 2QZPA 3CXUA 2ZB2A 3AKYA 1CG6A 3ZHXA 4RDHA 1H2WA 3N0TA 4MINA 4MWSA 3SC2A 4L50A 1Y7TA 1NR5A 3DMHA 4WNAB 3B1XA 1VG0B 3AW9A 1HFJA 1H2XA 3AUJB 3O4VA 4X60A 2RE8A 3MN1A 1T15A 2GWRA 3KFLA 3E81A 4WOCA 3VBCA 2XMQA 4GEGA 3FIJA 5CFQA 4R1MA 2RGAA 3RVBA 4KE9A 5LU8A 1YR6A 1R4NA 3D2AA 1K6EA 3UMMA 3UPUA 2B8JA 4D5EA 5HZGA 1XZCA 2IIVA 1UKCA 2OV4A 4XRGA 3BQMB 1N5MA 2XUFA 3FB4A 1P4RA 3LYHA 3M49A 3QWIA 1V5GA 3MNFA 2F9FA 3DHEA 5F5LA 3WMXA 3EMBA 2VN8A 3LC2O 2PKQO 3DJYA 3SHVA 4IS2A 3E5HA 1X14A 2JK1A 4LS3A 1W2WB 3P96A 4BNNA 4F4JA 5EJ5A 4W9NC 4QDZA 4YRTA 4ROTA 4WBNA 4P7JA 3NT2A 4ZDIA 3LBYA 1F3OA 3QIAA 4A0FA 3A3NA 1ZINA 4FDAA 4J3JA 4LHZA 4MVYA 2Q6IA 2VS1A 2R60A 4ENRA 1JZQA 2OCIA 3GFFA 1EYZA 3P45A 2PNFA 5G41A 1RMQA 2WWFA 1JG2A 3KYBA 4WBXC 3RG2A 3L4SO 4EKYA 4HLUC 3HXQA 2QJFA 1USKA 3OZDA 4RSGA 2WOJA 3QSYA 1ZSVA 1E3JA 5DBFA 1MG0A 3PL5A 5KKAA 1Z4QA 3EF0A 3HFRA 4RGQA 2JIDA 1L1RA 4I55B 4JBNA 4EGQA 3SQNA 1G2IA 4MYTA 4BRUA 2EGUA 1XROA 3VNVA 4WXMA 3WLHA 2G76A 4FHCA 3S8YA 4IXNA 1HKUA 1F5NA 5CEJA 1A97A 3T9BA 4Y6OA 1Z45A 1X1DA 1ZVMA 2AEEA 4ESHA 1XIVA 3N2EA 5DHTA 1JL3A 1MDBA 1XGKA 3QX3A 1FUIA 3C3WA 4MR8A 2PNJA 4EDHA 1DLIA 4U9HS 4FPXA 5E7JA 4NEQA 4CDNA 1QRDA 3OJXA 4ZVKA 5DMHA 2GEBA 2XB8A 4JOCA 5E7IA 2XA2A 1WB6A 3HXPA 4DABA 4KJXA 2HD4A 3NWOA 3I5XA 4A5SA 3WSWA 3G2JA 3NPAA 2HM7A 2JI6A 1YL5A 1FVXA 1KRHA 2XE8A 3B78A 1GSOA 4X91A 1NC3A 2MYNA 4O59O 3I6ZA 1BFDA 3R41A 4GS5A 3WGMA 2HQSA 3QEKA 3AEQB 4LDNA 2VF7A 4MYRA 1KQFA 2J09A 3AHDA 3AR3A 1UFVA 4Q37A 2D2IA 3L8DA 3I5YA 4XM0A 1FFAA 3FNFA 2WFZA 3QEMA 3AEYA 1GAQA 4GICA 4EKDA 1R00A 1J33A 3A36A 2AWOA 2C0QA 5IARA 4YUYA 4JI4B 4RIIA 2ZREA 1SQ0A 4FR5A 4GR4A 1MHTA 1EHYA 2QJWA 2ZYUX 1E2QA 2FU5C 2Z8XA 3JARB 2WG1A 2PFKA 4RXUA 3R7LA 2XI4A 2VTEA 4U3JB 2JVKA 3DW1X 3OQIA 1TU3A 2ZIXA 1EVKA 1L5YA 1B6SA 1P60A 1A3CA 4QAJA 5BWCA 2C4MA 4LV8B 2NP7A 1Y37A 2PL1A 2VZLA 3C97A 2X19A 3JAWB 4HQKA 3K3PA 1TKBA 3CLHA 4WLNA 3RVKA 1QKKA 1ECGA 1E1YA 3M89A 1C9DB 4UDXX 4HH3C 3UYKA 1XNRB 1NI5A 1V3TA 1JLLA 1SCAA 1YQ9A 4I3FA 4DIUA 2KYRA 1JG6A 3ZDXB 2FVYA 4IWNA 5E1MA 5C4IA 5TT0A 3ZZUA 2NVBA 3QP9A 4AYXA 2AG6A 2NO6A 3PS9A 5DBGA 1ZMTA 3GRUA 3MERA 4J0KA 4IUBS 1VIDA 2GOYA 4KE6A 4JQZA 2EX0A 3P2EA 2ZBQA 1S1MA 3EY9A 2DWUA 5FI0B 3CPJB 3L8FA 3WGHA 3KYDA 4B3JA 1B3RA 3CF0A 2CBXA 4YRPA 4EY8A 2R9VA 5AUPB 1DWOA 1RAFA 2NQTA 4EVSA 3HWRA 5GJCA 3UK1A 3K70D 3AF5A 3F74A 1G3IA 3O94A 3QVSA 4HWKA 1E3DA 1WAMA 4JODA 1UL1X 3ZVMA 2V0CA 4UARA 1K7EB 2YDXA 4V2IA 3G2QA 3T7RA 2W6IA 3EQ9A 3HNOA 1NW7A 5K1ZA 1XF9A 1NQ5A 2OE2A 2P8JA 3AEQA 3WHKA 1I7NA 2Z9BA 2DM6A 2H85A 2KBFA 2Y4NA 4B3XA 3G0HA 1JBQA 1H0SA 1ZD8A 2DY1A 2Y0PA 1OOEA 2Q0QA 1ILWA 4HVLA 2OO3A 3KPWA 1FNCA 5JASA 3I9V1 3VDQA 1XVUA 2ADFA 1C5KA 1MIHA 2PMCA 2XMPA 1JHQA 4IHJB 5DRYA 3VVLA 2VT6A 2RGWA 3OT1A 3W8FA 5HF9A 3MAJA 4WCFB 4TKVB 1DO8A 1XEWX 4X5OA 3HEMA 1KDOA 1OTXA 4BYGA 4F6CA 1RYHA 4UU1A 1SFRA 3I76A 1FFBA 1S0UA 3J7TA 4IMPA 5FBQB 2PYIA 2AXPA 4RJIA 5ELLA 1H23A 4Z7NB 4RTRA 4R41A 2P2CA 1SN7A 4LFBB 3FUTA 3PPIA 3V4VB 3PPYA 3MLBA 3MTQA 5FPSA 1T8SA 3UW1A 3BWEA 2PX8A 3H1GA 4ZZ0A 3QVXA 3HK2A 3I3OA 1R8SA 1VYUA 2H1FA 4C6RA 1TZCA 4I5IA 4YJ3A 2H9IA 2YN2A 4TV9F 1UBFA 1O95D 2OFOA 4EVRA 4JUCA 2IYZA 2QKYA 3NDRA 3UPTA 2PFSA 4RPCA 4X3OA 5A71A 1WWKA 4WE3A 4CU5A 1H1LB 1BYUA 4RFSB 5D2CA 5ECGC 4QXQA 4BFSA 4GMGA 2H7XA 2BR3A 3N2KA 2V6FA 2C20A 3ZK7A 3UMJA 2B0CA 5IXYA 1QTIA 1YAHA 3G5UA 1D0IA 3KSDO 2HA4A 4TTQA 5A6SB 2N75A 4B32A 2OB1A 3H1FA 2P35A 3SF0A 1KA9H 1JYFA 4OB6A 3KEOA 4DDVA 5L7WA 1OFHA 4E0BA 1GAJA 4XPIA 2WU0A 5KUTA 1ANKA 1N2BA 3LQKA 1NBMA 2YJ6A 4Q3DA 3W2FA 5BQ3A 4N47A 4HYQA 3QU5A 2DE0X 2MSEB 4QYTA 4JSTA 4LI0A 4MJ7A 4FFLA 3TRFA 3ADCA 3ESBA 1YQDA 4G41A 3WISA 3QFSA 3IMCA 2GUWA 1M7HA 2HJHA 2XB6A 3AB8A 3PPXA 4KQ6A 5EZYF 5IZ4A 4DA7A 2DUNA 4RS3A 4L8GA 1P72A 4ATNA 1EZZA 4YY3B 3OP1A 3KLPX 3TR0A 2NTJA 3BWCA 3ZZTA 3LVQE 5ESRA 2C5HA 2ZG6A 1FB5A 4A2WA 2BZGA 1U0JA 4EG7A 4ZYVA 2VUIB 4AMBA 1RI2A 3BD9A 2FZEA 3LFHA 2O54A 3VI4B 3M6LA 4H3SA 5BV7A 3OPYA 5A7HA 3U4QB 3QE4A 1JT2A 2QX4A 1P3DA 1XYVA 4LZJA 5IANA 4L8FA 1BXKA 1IK4A 4X71A 4V1CA 5JNUA 5JYEA 4F72A 3TNLA 1JHVA 1JQKA 2C9BA 2QRNA 3E1GA 5EQTA 5ETJA 3UJ3X 4WK0B 3Q2KA 1MHPA 2Q07A 5AJYA 1P5JA 2JKYA 4PNPA 1ZCBA 4NZPA 5AI0A 1YI1A 5SY9A 4ER3A 3N8HA 5IM4A 5BQFA 1H2AS 2X0DA 2JI8A 1TECE 2JEYA 4FS8A 3G79A 5JSUA 3DZ8A 4E09A 4OGLA 3MB5A 4IMRA 2WSIA 1CEEA 4H7HA 1JEOA 2A4KA 3AX6A 1JDSA 4QU0A 3QUTA 1QQTA 1T36A 1YB6A 3K05A 2D1YA 1HDXA 1CUIA 1HL3A 1RRPA 1ZICA 3EDMA 2FYTA 3SDBA 1QTQA 2FRVA 1XCJA 4Q1CA 5DLEA 4NARA 2CC2A 1GCIA 1PP4A 4EQ6A 5EPOA 3IAUA 2Q21A 3DPSA 1GGNA 4X62B 1Z39A 4F12A 1DDIA 5KZMB 1M1YE 3QYAA 1FQKA 4QICA 5IBCA 3BWBA 4JU9A 3KZXA 1FDRA 3UV3A 3BHMA 4WACA 5H5JA 2C9YA 4LZLA 4MUBA 2XCTB 2VJMA 4B5KA 2XB9A 3GDGA 3M82A 3N74A 4IHKA 4NWIA 3PC3A 3W79A 4IJQA 4KPUB 4E5MA 4XSGA 2E2WA 1ECFA 1J2TA 1ZK4A 3SX4A 4O08A 4BLVA 4DT1A 1DC8A 1BH2A 1QZXA 3GA7A 1G2PA 1HV8A 3KKOA 3ZDCA 1C9NA 1QQ5A 4JXZA 3U7IA 4TV9A 1CQPA 3D1LA 4E2XA 5ITSA 4CXMA 4M8IA 4ZYLA 3E61A 4EF4A 4J4TA 1WSDA 1C7JA 1A4XA 2XNCA 2FLWA 4BNYA 1ZJ5A 3TOSA 5EHXA 2WJPA 4GVXA 5EFZA 2RARA 1ONPA 2VL7A 4E3WA 3OBIA 1W4CA 1QXSA 1ENOA 4TMXA 2I0FA 3I61A 3N7AA 1VL5A 2G17A 5L3SA 1M2HA 4P5DA 1WXEA 3U7JA 5HPYB 2YXBA 1I0IA 3MTDA 2QY9A 4PPQA 4EYGA 2GA9A 1KEEA 2EF1A 2GYYA 4BLSA 5BMVF 1I3KA 2Q3EA 2PJDA 3AESB 1DVRA 4LQ4A 1KYZA 1V7PC 4NYMR 5FJIA 4UREA 3U81A 3VU1A 2QT0A 3HSSA 4RV5A 2OM6A 3NIWA 3KZMA 3UK0A 1JMYA 2GD0A 4YP9A 1S8FA 3V1UA 1RBMA 4GLLA 5DHAA 3OCZA 4ZT6A 2KW5A 3ZI0A 3BH0A 5HG0A 3WGOA 2PAAA 4ILKA 3G6WA 5CW2A 4P38A 5ELXA 4WFJA 4YJ2B 3HR8A 2ZWMA 3OY7A 4MUAA 4ZZ3A 4M7OA 4BXOA 2ZXUA 4DKJA 3UMBA 2YFKA 1VTKA 4DLVA 4EF6A 3ZVKA 3PU6A 1MQ8B 2DFNA 1JZTA 3AFMA 4A23A 2DERA 4P86A 2ZPUA 4LJ9A 2CJFA 1DSSG 3NYRA 4ZVNA 4D5GA 2Y6UA 1QJCA 2XZDA 4I3GA 3L6RA 2AC4A 4CVNA 4QGSA 4JOBA 3FPHA 4AJIA 4RZXA 1R9GA 3DV0A 3PJFA 1W48A 1QVAA 5I9BA 5A9SB 2OHFA 4X1IB 3LQ1A 5IFKA 1YIDA 3EUEA 4U7DA 1A76A 5IDVA 1HDCA 4D4MA 1Q0RA 3UXHA 1L9XA 1JU9A 2OQIA 4DNXA 1J0XO 1AK2A 4XVCA 1PFKA 5JDCC 4BKOA 3WYAA 4HNGA 4XIJA 3UV6A 4B7CA 1I5RA 2OZVA 4RH1A 3SR0A 3DWEX 4FFMA 2D5BA 1U8ZA 5CDFE 1O6CA 1A7KA 1Y34E 3E18A 5I8ZA 4AJPA 1POWA 1IM2A 5C8YA 1OR8A 2RAPA 1JMKC 2BSQA 5JANA 2A8YA 4O4LB 3Q7PA 3ORQA 3PHIA 3JASA 2ZTSA 1C2YA 1MZVA 3IC5A 4YFVA 2GM3A 2CL7X 2FWMX 3PDCA 1KRWA 2HSWA 2CFOA 3O26A 2O3QA 2OL4A 3OIYA 3FN4A 2IU0A 5C52B 4HB3A 2JIZA 1G3QA 3D0KA 2VCYA 3INNA 3LUFA 1R9MA 1Y5MA 2QP9X 4TMFA 4C5CA 4CN8A 2ECOA 4HX5A 3ETEA 2WSMA 1RVDA 4TTRA 3H9BA 4DHEA 2R2GA 1EIZA 3TNYA 1E77A 1OAKA 2CDAA 4WOKA 4BNTA 5LLDA 3PFIA 1SVIA 4W7IA 1R9JA 3VO8A 1XVTA 4KH1A 2QZZA 4OHRA 3TW8A 3VISA 1UEJA 5EJFA 1OX5A 3DP7A 3A1EA 1YZGA 3V1YA 2G77B 1R6XA 4F3KA 2REQB 1LH0A 3INRA 2BFFB 1NFRA 3PVZA 4MWTA 3MJFA 4D42A 4RKEA 4TXMA 4QFDA 2E4VA 2QTTA 3BSFA 4CQLA 1K75A 2UYOA 3OPQA 5J1TB 3QXSA 5BSWA 5IF3A 1BMFD 3GLIB 2HBRA 2JB9A 3O95A 1M67A 1GZVA 3VGPA 4QO7A 5EWMA 2H1RA 3C3XA 5B57C 1M83A 3KYDB 1II9A 1MEJA 3MQFA 3P2MA 4YB8A 3BDAA 1R0WA 2PUBA 4GXRA 1GSIA 2C5BA 1AMNA 5EJ2A 2C8KA 5FUBA 2QE7D 1E4YA 1T4BA 1Y98A 2AW5A 2XQJA 4U7PB 4M0LA 1Y4DE 3BTVA 3NG1A 3WZLA 3IDAA 1XOIA 4ISCA 4JJGA 1Y82A 4EG8A 4Z0PA 4LOLA 3ICQB 4YLGA 2IPNA 1LSOA 2MT9A 3LUHA 3VR5A 2QIOA 5IWAB 5DNEA 1Y8AA 3DZCA 4HQOA 2OY0A 1EQ2A 3RNOA 3WNCA 4MVJM 5GTDA 3M34A 4QJBA 4D0LB 1B26A 5DNAA 2QRHA 3TD2A 1KSGA 4FB4A 1Z8DA 1QWOA 3KB1A 1WR8A 1QLWA 1XTIA 4EA7A 2BM8A 4AULA 3TD6A 2WQZA 2H1CA 5KYYA 1Z6GA 3EWAA 4HUJA 1Z8HA 2FKAA 1FYWA 1ZOOA 3ANMA 3C2QA 4ID9A 2NXJA 3FBWA 4WJZA 3TLGB 3THYB 1WOYA 1C41A 5D6NA 3MBKA 4MQEA 1P2TA 2QRMA 3R1IA 5F1YA 4ONEA 4BGUA 3BMQB 4W99A 1FJGB 4WOJA 3LQ4A 3C7AA 3AZOA 2WKQA 3ELDA 2EL7A 4X6LA 4E3ZA 2HQ1A 2JDIA 3O3OB 2QZ9A 5EKTA 4YC7A 5A9SA 1KTIA 1WB5A 4RVDA 1D0SA 2B4QA 1KOLA 3FCCA 1O9BA 2DHEA 4A73A 3EPKA 3P4YA 3BGDA 3M6VA 1HO3A 4MCIA 2I65A 1JLMA 2VBIA 1DIRA 2QRUA 5IULC 4MB2A 1X70A 2UZ1B 3FLBA 1DKLA 1FSGA 4RY0A 1WCYA 2Q2OA 4ZANA 4XIYA 3LPMA 4I99A 3ZCRA 3T3DA 4DCNA 1S2GA 4HP8A 2GNAA 4DXAA 3DZBA 2QPOA 2BIFA 2NSYA 3N2YA 1GTVA 2ZANA 4I1OA 3LZ6A 1XRMA 3DWIA 4LF5B 3EQ8A 2VDLB 4C3UA 3AQ4A 4PX2A 4ECAA 5DXJA 2VSFA 4DMFA 1CY7A 4FJ1A 1QX4A 1SC1A 1SVMA 4IUYA 3DXZA 2QE7A 1TO6A 4M22A 1LBIA 1ZNZA 3K1AB 3O21A 2WAMA 4EHNA 3EQ6A 1GZ5A 2GZSA 3ASYA 4PO8A 5CK4A 2OORA 3W05A 4C04A 5I45A 4LDPA 5P8WA 2IXFA 1P1CA 2FSFA 2ONKA 3RQIA 1KTVA 4MP8A 4JJ8A 4BFLA 4DC1A 4CKCB 3S2UA 5I8PA 3QEBZ 2I71A 2XCRB 4DIBA 3BORA 1NL3A 4OQMA 3V6MA 5G0SA 1U4OA 4BDSA 1G38A 4Y2HA 1YQEA 3UY4A 1FIUA 1O96B 1YE5A 4HMQA 1VKRA 1A5SB 1N2ZA 1ICIA 2IIPA 1BAPA 2OK7A 3T1NA 3VYTB 3LKBA 1KRXA 3PYLA 4OO3A 4TSFA 2OO7A 4H35A 3QVJA 1GEEA 1GZ3A 1DV2A 3I32A 3RHTA 4S24A 5JAPA 1YH3A 2PZKA 3BMOB 4E13A 1I1QB 1I4EB 2M98A 3GLUA 3VOAA 3DULA 4LHEA 4CU2A 2B83A 2I34A 5IK2A 5H4GA 2PE5A 1CQJB 3FFTA 4GPAA 4HVCA 5KYWA 4LDZA 3UG7A 4R8VA 1MAHA 2YOGA 3S68A 4ZYUA 4ALLA 4PYIA 4YS6A 1HL7A 4Q7KA 4DA8A 1PT6A 1SKBA 1Y8RB 2IW1A 2XNJA 3OPXA 4YJFA 4ZYTA 5BYKA 2ORWA 4C78A 4QHYA 4KI7A 2HX1A 4FS3A 5EIBC 5FLEX 4ILEA 5LOVB 4KBGA 4RGVA 4DLSA 2CT8A 3KR9A 3IAHA 2XOXA 5DYIA 1Y8ZA 1NDQA 1W9MA 1T2UA 3RRBA 4EG3A 3LY9A 3UAXA 3Q8XB 2FOXA 3BIJA 3E5NA 1F0KA 4PBRA 1OT5A 3KXLA 5HIMA 3VBEA 1GOTA 2GFHA 4MQ6A 3P0HA 3OZFA 1L2TA 2FPMA 2WWGA 3PDHA 4LDQA 1NXXA 5TPWA 1CS4C 3F2IA 4L5JA 4ZRMA 1RQ2A 2GJAA 3C6KA 4N5IX 4OU4A 5SY6A 1IDOA 5BR7A 4P0QB 2P11A 2QXTA 4CQMA 4NNOA 1VFPA 4EI8A 1XDGA 5JJBA 3QW4B 1KF0A 1J22A 1K08A 5LCXA 4R2JA 3B51X 4FNGA 1M3SA 1T3TA 221PA 2QR3A 2JJ2A 3ITDA 3UGJA 5FTKA 2NN3C 3RFXA 2E3JA 4OLHA 1IL0A 2KMLA 3MWLA 2P62A 5GVSA 1OPXA 4G5FA 2CXSA 3MRSA 2OHOA 3IAAA 5EWLA 1IPEA 3LY5A 4G5SA 2UXDB 4OG2A 1Y9AA 4C05A 4QNNA 5ALXA 2R1TA 2WPDD 4BO8A 4CMHA 5C7YA 3ZYZA 4G85A 2H4XA 4JL8A 5KYTA 1I7QB 2WU3A 3DH0A 3GARA 3UAZA 3RNLA 4BNDB 4D9CA 5J47A 4N3CA 1XWIA 2HHJA 1CRLA 3PXDA 1J0CA 1XEXA 2AEFA 3CNQS 2HRZA 1E5LA 1OVMA 3KPYA 2C7VA 1TUIA 5G02A 4BWGA 1OTHA 1T6BY 1ZLYA 2HY7A 2FZLA 4HRYA 5LD2C 4BVKA 5CT4A 4YXFA 2VDJA 1GRVA 1NXWA 2C2XA 3OO1A 3ECAA 3TSOA 4OL0A 3WI7A 3U19A 5ILOA 3F8WA 3B1KA 4Z49A 5HP4A 1FZTA 2YRFA 3LM8A 3NDJA 5E4TA 3K1AA 3TAHA 2VTVA 3ROKA 1AIPA 1M2WA 3HB4X 3IE2A 1Z2NX 2Q8PA 3Q7RA 3GDFA 4QUDA 2G63A 4F9EA 5I47A 4BO3A 1OX4B 1Z8NA 2WEKA 4TXNA 1OFTA 2B8EA 1SB8A 2HH9A 2WZQA 1KMQA 3PNKA 4NY1A 2LE0A 3CNEA 1KDYA 1CDOA 4UPEA 1K0UA 1JXAA 1RRFA 4W9NA 3B5EA 3K96A 4N65A 1SOUA 2CL0X 3WNBA 4AYWA 1ZDMA 3IBCA 1C0LA 4MVJE 5AKYA 4NECA 2O07A 2JGDB 2ZVJA 3H9QA 1PYOA 2ZQZA 2RGNA 1N2EA 2XOEA 3LTEA 2ZRQA 4MUGA 4PZLA 2W93A 4Q3AA 1TW3A 1W85A 1ZIDA 4FLFA 2J67A 2Q6OA 2OV6A 1G4UR 1FY2A 2FRXA 5ALWA 3EMKA 3SNHA 1SQSA 5TS2A 1NW9B 5AK5A 2EGGA 2P5SA 2QENA 1YDMA 3MINB 3UHPA 2YVQA 1BN7A 1Z7BA 3P9SA 3VX3A 4ENUA 4BNKA 2GCOA 3N0XA 5AUNB 3OEYA 3EWSA 2JZCA 2Q1UA 3H87A 4PNZA 4BNDA 4BX0A 4DF3A 4N5MA 4RLQA 5A03A 1R18A 2DTXA 3G0BA 2QNIA 2ODAA 3HRHA 1QGUA 4EX6A 3L79A 4D8TA 5C3UA 2X3UA 1S2MA 4DCCA 3FI9A 3AHJA 4HQ0A 4KPYA 2W11A 4AXBA 3ZWMA 3SDZA 4CT5A 1P44A 2J9GA 5HJ7A 2IPOA 1CNMA 2C1XA 2W2KA 3EIFA 5EXDA 4DNPA 5A0VA 4YDQA 4FWIB 4E6PA 3RLFA 2G04A 4D7AA 2JLWA 1VIAA 4R2LA 1QHNA 1YJXA 3OIGA 4BUZA 1M5TA 5JDCA 1JIJA 3HVRA 4MJ3A 3VO1A 1M6YA 3WP1B 1QG4A 4UDNA 4MA4A 3TO5A 1MQ9A 1QX3A 2HDWA 3WGIA 3STYA 2JGLA 2R6DA 2IBMA 3DVAA 3RRYA 1C7EA 3PWKA 5IK2D 5IZCC 1M2JA 1AKRA 3DKPA 3AJEA 2EGHA 4Y1RB 3DA8A 4BNXA 2G5GX 4ZTZB 1YMVA 3E03A 1WVIA 4R0VA 4OHCA 4CV0A 2TYSB 2IV3A 3DOJA 1JDVA 2X1LA 2Z2IA 5ECDA 4EHLA 5JJCA 1CS0B 1QP7A 5FWNA 1UZUA 2DEUA 1WP4A 3AMVA 1AS2A 3QPDA 4PYKA 5F3WB 3GRRA 3PRKE 5C1BA 1VB3A 3QLEA 4ZCLA 2EHDA 2YW9A 1U6JA 1PEDA 1TJPB 1JHRA 1RLJA 5K3BA 5CX1A 1KHTA 2AOUB 3WKBA 4D4HA 2QW0X 3A6LA 3DW3X 2GYUA 4IP0A 3OAAD 4IXTA 3CH7A 4NDNE 4BFXA 3ZS8A 1Y80A 3TKAA 3K70C 1KHHA 1TKRA 3ST7A 3MXTA 5I9NA 3VNQA 3HGTA 1PQPA 3C8MA 3Q40A 1VJDA 2W2LA 3JYQA 2WP0A 2H4JA 4RHTA 5JQGB 2QTHA 1H42A 1X8KA 1S7GA 1V9LA 6YASA 3NHAA 3UW3A 1CD5A 1DWPA 5I4BA 2ZRLA 3VX4A 1RRVA 2KBEA 2JBAA 4MV3A 4NKRA 3IP8A 2DHQA 5FOQA 4G0VA 2IUYA 2VDMB 3HYLA 1TZBA 3GCXA 2PL9A 3A6KA 1L7VC 3EF3A 3FKSA 4P33A 3ESQA 2QROA 2V4MA 2YRWA 3FPSA 5FUYA 2Q0HA 2NYUA 1LDNA 2AJLI 4MUXA 3JZMA 5CEEA 1SAYA 1H3FA 1NUSA 1UBCA 4MPJA 4NJMB 4TLLB 1BWQA 5BV2P 3L18A 5C7OO 5T67A 3KKMA 1XZBA 4B3SB 3DEHA 2I2CA 3MMPA 3VMMA 1DC6A 4EG1A 4D9HA 4ZGGA 4NE7A 2V7TA 1OLUB 2V9ZA 1RXCA 4I4LA 4OP1A 1D6NA 2J08A 3TZHA 2PU5A 5CXUA 1SQGA 3F97A 3K6RA 3RVPA 1KZ7B 1P5RA 1PKEA 3II6X 3JYLA 4YMGA 4EB8A 4ND8A 3AR6A 3Q8LA 1RD4A 3MELA 2GAJA 5DBEX 4OCZA 1V1RB 3FA2A 3RJ9A 3ZWAA 2SHKA 4PINA 1FMJA 3OIFA 2C99A 4AAYA 4HEA1 4KQIA 5ERXA 3N53A 1JDBC 3PGKA 5DN6D 2PYDA 3D3WB 5JU6A 3RSSA 2NO0A 2JCVA 3LK7A 3OZRA 2IGBA 1E6CA 3GJ7A 1BDIA 2WA1A 5E6UB 3V8VA 4IOMA 5AK6A 2SKCA 5SZKB 4E7PA 1AO0A 3H19A 1VMAA 3IVRA 3A1CA 3V4ZA 3W6OA 2OXTA 4Q3CA 3TMKA 3UTCA 3ESAA 4COKA 4YAOA 3UKJA 4UZSA 5FTLA 5A06A 1YZKA 2PKQP 1YRYE 2YVLA 5JXIA 2AYYA 1PJ4A 2DH6A 3A9TA 4I14A 4J1QA 4L02A 4O8ZA 3RH0A 1SBIA 4LYJA 4MROA 5EJEA 5FEUA 3S81A 3AUKA 1BU8A 3IQZA 1OLXA 1PK7A 2GTPA 4LAFA 2JBAB 5BNIA 1KNQA 1L5SA 1CRQA 2H59A 3GZNB 4DRZA 1GLGA 1RPZA 3PJRA 3R7WB 4RLFA 3MGKA 4RORA 3RRNA 2O8FB 3EDRA 2X6RA 3AJAA 3B3GA 3IDSA 2F64A 3A2KA 3THRA 2H1LA 3VR4D 4DR4B 2GF0A 1C9KA 3IHWA 3VR5H 3WX0A 2MWMA 3FPGA 2RIPA 5DXFA 1D8TA 3DFFA 5F4ZA 2AOWA 4C03A 4I55F 2FQWA 1UJ5A 1R74A 2UYHA 2Q9CA 3L8MA 4DTCA 3PZRA 2O2EA 2W6OA 2K4MA 3B52X 2B9EA 4GZLA 2PH3A 5ICGA 4U5XA 1Y9DA 4U7GA 5BSRA 4PRKA 1B7GO 3H86A 4OREX 2XCQA 5TS3A 3S8EA 2LNDA 2B30A 3PIIA 1VHJA 3HYSA 5E1OA 1UJBA 1Z4IA 4NG4A 3EVBA 1WEHA 2UU9B 2PANA 1T9ZA 3B5JA 5AVUA 1A71A 1R16A 4IEIA 1X1RA 3H18A 4OY3A 1KH3A 4Y2VA 3QKTA 1KY2A 2XUHA 1Z88A 5AJTA 5JRDS 1GPAA 2Q5CA 1FRQA 2JEOA 3UJ7A 3DVRX 1FMCA 2BSAA 1GPBA 3B9RA 3ETDA 4JKIA 2IOYA 3IODA 4ITRC 5FYQA 2C7BA 4RK7A 5F51A 4F1JA 1JTEA 9ABPA 1ZWLA 3PLAE 4IBOA 1Z2EA 1K1EA 4P31A 1QRUA 3JYOA 5JRZA 4MVJF 4G97A 4XSVA 4YIKA 4Q3EA 3KQLA 3DE1X 1PWHA 1V47A 3NAGA 3NWJA 4CRWB 2G4CA 1UP4A 2C3PA 2MR6A 5EIWA 4CMEC 2EKPA 1IN5A 4YPFA 4IQGA 3UXEA 2CSXA 2Q1WA 3FFBA 4P35A 4EFNA 1Y1SA 1G1AA 5G1PA 3UMRA 3IUBA 4CL2A 3B6IA 2N1BA 1U04A 2XRMA 1ZYUA 2WM2A 2JGMA 4LE2A 1Z6XA 2QU8A 1GRCA 1TZKA 3NXSA 4BVGA 3U7GA 5B5SA 2IZ0A 1ULHA 1Z9BA 2DXIA 2QORA 5E4JA 5T5QA 3MWEB 1F8UA 3ISVA 1WCV1 2BGUA 2ID9A 1E94E 1XAJA 5CGQB 1W1WA 1YULA 1ZGBA 4MITA 3FIUA 5MDHA 4TYMA 2AE2A 5KNDH 3PQ4A 1D2NA 4J1TA 3T8YA 1FX0A 2H5JA 4UEQA 3NBQA 1YU6A 4JI6B 2X3FA 4EY4A 4OA8A 1LVUA 2AN5A 2XKJE 1HQYE 3BMCA 1D1QA 1FP1D 1WULS 4HX9A 1N7HA 4TWRA 5B53A 3O4GA 4M1WA 2VZ9A 1K4MA 1VGRA 3RGWS 3QTTA 2R7LA 4RY9A 5I7WA 4E2WA 1TE2A 3VPHA 3IVMA 3A1UA 4ZVLA 3U4QA 1KVQA 2OYSA 3R75A 1E9FA 2JLYA 1HT2E 5CPFA 3EZLA 1NHWA 2WT8A 4ENSA 1JMVA 3NKFA 2XNHA 5JJIA 4JI8B 3ZZMA 1I3CA 2E5WA 1JHZA 1CY0A 4YONB 3H4IA 1LF5A 3KRTA 3IEXA 1RYFA 3ENVA 2X9NA 4RQBA 3UMFA 2D2FA 4WQMA 4CKXA 5CFNA 1Y4AE 3K20A 4TRJA 5I7SA 4NAUA 1E62A 2P67A 4NPCA 5E1BA 4D46A 2CF6A 1YUNA 2RAVA 3PV0A 4F9GA 2ZTMA 3K4PA 5BNFA 1KJNA 1H3NA 1QV7A 4UM8B 1DUIA 1NRWA 2AMFA 4KTTE 4RF2A 1JWAB 2RI6A 1VSVA 1KKUA 3O8CA 2BCEA 1WDKA 1XD9A 3SR4A 5GAJA 1H4QA 1FYFA 1OHHD 1EAMA 4QATA 2HMSA 2Y0DA 2PWYA 2NG1A 4Z5XA 1DG1G 1EEHA 1AXRA 1LB1B 2XCIA 3NNSA 4HYEA 1ES9A 2IYRA 2V7WA 1PJ8A 2FEPA 3TLGA 4QOGA 1BX1A 2BHTA 5EKXA 3R7FA 2HN9A 5LXTF 4GOLD 1A95A 4BE4A 3FTNA 2YN4A 1NLMA 1D03A 2Q1SA 3B7PA 3MD0A 1LTQA 4GGMX 2R4QA 5IAOA 1XZGA 1IY2A 3TOVA 4GR9A 2V1UA 2YJGA 1X0XA 3FCUB 4RBNA 2ZZKA 2VEDA 5DBIA 5YASA 1CTQA 5ADUS 2FFBA 4IIEA 1RI3A 4X66B 2DU8A 4KGVA 3WAGA 3QFRA 4QOJA 4YDSA 4Q7MB 2XX3A 2ZXEA 2IUUA 5CHEA 4MUFA 3AYZB 3TB6A 4EGJA 5JH7F 4EFLA 4ZO4A 3W5BA 3Q8MA 2ZE5A 1PVDA 2VA8A 1XQWA 4JC5A 1MQSA 1ZBDA 2C4TA 2RC5A 5JD5A 4MMYB 1EFAA 4KL8S 3SE0A 1TB4A 2FLKA 1NZFA 3FI0A 4KXQA 1DJLA 2INGX 1TZMA 2IYSA 1RM3A 2WF9A 3GCWA 2PMEA 1AY0A 2IS2A 2O06A 3C1TA 1XCMA 4OFWA 4YJFB 2JRLA 2Q2WA 4AUEA 4IV0A 2PUFA 2C4WA 4KN6A 3HJRA 1O4VA 1LX7A 4HB4A 4L6IA 3LL4A 4NULA 5FTNA 5JY6A 3K0CA 2AS0A 4Q6BA 3U0BA 4RXTA 4PC7A 2F43B 1L8QA 2OGUA 1OWNA 1EI9A 1OZHA 1TT7A 2G07A 2VQSA 2GBFA 4FKBA 5ALQA 5IYZA 2OBNA 2JLXA 2WUEA 1W1UA 3BXXA 3DVAB 1TDJA 1C3LA 4HTFA 3GN2A 4LNAA 2DTEA 1NRXA 3FJ1A 3OJ0A 5E0KB 3ONEA 3AVWA 2JD1A 4YBZA 4OSEA 3IP3A 1IHYA 2Y2VA 3WGKA 3SC2B 3GRYA 5JW6A 3KZCA 1O94A 3VYRB 1SU8A 3WIBA 1EMDA 5C4GB 2QI9F 3OM0A 4RWEA 1E3IA 1MO3A 3TIXB 1MOZA 1ZRHA 3EXG2 2BM9A 3M1AA 1C9YA 4B4OA 5EJ7A 5LIPA 3HDTA 4MGHA 5SZIA 4MHTA 5JMTA 3Q85A 1P81A 3BL8A 1U2TA 2BFOA 2GVNA 1N3BA 1XFAA 3NM6B 1DCMA 2JGNA 1PIWA 3KV1A 3NV7A 4XQ9A 1RFLA 3O82A 5LQJA 6PFKA 2I5PO 1T6YA 4G3XA 4JI2B 3LX6A 1CF9A 1SHTX 1VLVA 2CLCX 3NIFB 4V1CI 2HU8A 2JVIA 5F78A 1R0RE 3H6HA 2IGTA 3DV2A 3G1TA 2YZMA 1WX1A 1S3IA 3HO6A 4X9XA 1J06A 1O89A 5AJHA 3PPVA 1QH1A 2ZEJA 3OTIA 5HF6A 5AK0A 1COWD 5FNVA 2P9JA 4FFVA 1E4EA 1EFKA 4IRXA 2L82A 3ZIAD 1ML3A 3LP8A 4HFMA 4KJZA 2BHRA 4YCJA 2IHVA 4ETIA 4XQ0A 3MPUA 3EC1A 2BMVA 4YO8A 5K8UA 3MIIA 2DOKA 5TR9A 2FN7A 4F91B 1G0OA 1P62B 4CF3A 4WK6A 1ONSA 3OU7A 4BNZA 4RSMA 3V4RA 4D92A 2WJGA 1CR0A 3RS9A 4DR1B 3FHOA 3RO7A 2I6QA 6AT1A 3HJGA 2AG1A 5BVHB 3BICA 4YEDA 4A8PA 4L95C 3RASA 5LA6A 2DWOA 3EJ6A 4JX9A 3COZA 2HSJA 1VOTA 5JD3A 4HGPA 4DUYB 3FJYA 2VXYA 3GJ3A 1GUBA 3GK3A 3M3HA 4IIJF 4HNAB 2PL3A 1PJBA 3OI7A 3RRJA 3ZHSA 5LP6B 1RWMA 4JJKA 4FIZA 4XGRA 3TDMA 2VOEA 3G0GA 2O1EA 2SCUA 1VPVA 5BW5A 4G67A 4ZC1A 1IZ8A 1XDWA 3JWEA 1N6HA 1PUXA 2Q4RA 3UWOA 3H5AA 3W2TA 5JD4A 5HJ2A 1KWKA 2QBYB 1GILA 1P8JA 1ISPA 3PCXA 4M1SA 3TLZA 4EBBA 1V7CA 2BLNA 2WJVA 2Y1OA 4WY8A 2VTBB 1HMPA 1DAIA 2JCGA 3MQ4A 3MTJA 1OX6A 2W4QA 5DW0A 5A04A 1O6BA 3AY7A 1PR2A 3CX7A 1UKVY 2GS9A 4JX8A 4DGSA 1AT1A 2W6PA 1CUVA 1GWNA 2XMCA 1HC7A 1BE8A 1NVFA 2P1RA 3SJ7A 3DBVO 3SG0A 2ZSJA 1P6UA 1PTKA 1EIWA 2J7KA 3N86A 2A0FA 2WIKA 1MB9A 4Y9UA 3WS7A 2QN6A 4WESA 4IG9A 4HNRA 2WNIA 3OOYA