3A2NA

Crystal structure of dbja (wild type type ii p21)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
298
structure length
298
Chain Sequence
RRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Hydrolase
total genus 107
structure length 298
sequence length 298
chains with identical sequence B, E, F
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a2nA00
1GKLA 4W1PA 4FTWA 4KE7A 1GXSA 2PUHA 3PFCA 3M82A 1KU0A 1LNSA 3QVMA 3WWPA 2RGUA 4BP8A 2BCEA 1FSSA 5AIBA 1QIFA 3DYVA 4INZA 2HRRA 5C7YA 3STVA 2BFNA 5C8XA 2H7CA 1JJIA 3WZLA 4N5HX 3CN9A 3STYA 2CUTA 3UUFA 3WYNA 5K3EA 3FWHA 1LGYA 5D3KA 1H2WA 2XUAA 4EY5A 4U2FA 5CH8A 4YK7A 4XX1A 1YAHA 1HKHA 5AKYA 1CIJA 1ZGBA 5AKXA 5AI8A 1XRNA 3ZV7A 3PUIA 5FP0A 4BCDA 4HRXA 2VJAA 3D4LA 5AK6A 1XRPA 4CCYA 1IZ8A 5CXXA 5EGNA 3U1TA 4X94A 4N8EA 4O08A 3PF9A 4G8CA 4LXHA 4I4CA 2WQZA 5CT8A 5JAHA 2J3QA 1XQYA 3F67A 2CEKA 2AJCA 3G02A 1DX6A 5LP1A 1GPNA 2ZVDA 3E3AA 1HDEA 4EZIA 2O2IA 1HBJA 2OLEA 5FOQA 4J0HA 4KAFA 1CUAA 5EIEA 5ISMA 5AI4A 4IO0A 1BCRA 2VSQA 5DNUA 5K5EA 3D3NA 2HA0A 4BRZA 2RONA 1SOMA 2PUJA 1JU3A 1XQWA 4U2DA 2XUGA 2X8BA 1IUPA 1H2ZA 3NUZA 1HL7A 4GEGA 4LHEA 2GYWA 3I1IA 4W9RA 5ESRA 2OAGA 1E8DA 1LPPA 1EX9A 2VATA 5BOVA 2XT0A 1EDBA 1ZD3A 5AM5A 5LZ5A 1XZCA 2B61A 1ACJA 2PSFA 5A7HA 4QDXA 2C4HA 3IULA 5ALLA 2XQJA 5AM3A 3O4JA 1ISPA 4UHCA 2GBFA 3GROA 2WJ4A 3FNBA 4YX9A 4Y7DA 5CT4A 5KREA 3EQ8A 3WL5A 2O2GA 2OQVA 4WY5A 1VZ2A 4FOLA 4KYVA 2PVSA 5T4FA 1R4ZA 2CZQA 1X2EA 3Q0TA 3QPDA 4X3CA 3GZJA 1ODTC 3IVMA 3BWXA 4J0GA 4AMZA 1TCCA 1W6RA 3H2KA 5D7BA 4BC1A 3PF8A 3WKCA 1VZ3A 4Q3LA 1MNQA 1UOQA 2ES4A 3ZPXA 1E66A 1XRMA 1XRLA 3HYSA 4L3WA 2XDWA 1LPOA 4EA6A 3M83A 3AINA 4HS9A 2RHTA 1GZ7A 1U2EA 5DYYA 5EHXA 1ORVA 3WA6A 3V48A 1DWOA 2HDWA 2WU4A 3D2AA 2CJPA 5AK4A 1R1DA 2HRQA 4B81A 4RE6A 1A88A 4FKBA 1AMNA 4EY7A 4HTAA 1FFAA 2XQKA 2QUBA 3WK4A 2BGRA 4B9EA 3FLBA 3I6ZA 2PKYX 4CCWA 1YAJA 4YPVA 2VT7A 3G9XA 1Z68A 2CB9A 3HSSA 2OCKA 5LZ7A 3EBLA 5AI0A 5AP9A 5K3CA 3I2HA 1RP1A 1F8UA 3BDIA 2OQIA 4X97A 3EIOA 3V1MA 4OB6A 4RE5A 4HXFB 1Y37A 3O95A 3G0GA 1MT3A 4DIUA 3H04A 3VDXA 5ALZA 2OG1A 4EB0A 3G7NA 3C70A 1TKRA 3GA7A 5CRIA 4LIPD 1EXWA 5T4BA 1A8SA 5AI9A 2JF0A 4MYDA 4N8DA 5EHNA 3H18A 5CT6A 4NVRA 3FYUB 4BE4A 4FFWA 3STUA 3F98A 3FYTA 1P0QA 2BGNA 4LXIA 2XLBA 1QIKA 4X71A 1QFSA 4K6GA 3BJRA 3BIWA 5AOCA 4ARBA 3WL7A 1XRQA 3DJYA 1FJ2A 1IUNA 1I6WA 4UBIA 2ZYRA 5JAOA 5HF8A 5EIAA 6YASA 4X6YA 2E3JA 5JAPA 1DU4A 2QZPA 5IVKA 4KRXA 5T4HA 1ZI9A 2JGIA 4CIBA 3R3YA 2Z3WA 3H1AA 5A2GA 3SWWA 5ALIA 1XROA 5E4JA 3M81A 4L0CA 1TRHA 2WFLA 4Y2YA 3QMWA 3FCXA 4UBJA 4Q1VA 3L1IA 3O0DA 4AN0A 1W76A 1CUHA 1BN6A 3ICVA 2ONCA 4ZREA 3FYUA 2HIHA 4DM7A 3PDCA 2WG2A 3C5WP 3KD2A 2JGFA 1CVLA 3G0DA 3VJKA 2W6CX 4W1RA 4G9EA 5CTAA 3ZLUA 5HK8A 1CUSA 2C0QA 4CFSA 2WG0A 1XZMA 2I3DA 4MYSA 1UK7A 1Y7HA 3FBWA 1BCSA 3VISA 5JADA 5HZGA 1ODCA 1C4XA 4DNOA 4QE3A 3VVMA 2WUFA 3MVEA 4WDRA 1CUUA 4OB8A 5A7GA 4B9AA 1SCKA 1L7RA 4F5ZA 1AGYA 2IITA 1EK1A 3E4DA 1EVQA 4BC0A 4H7FA 1MN6A 4H7JA 1A8QA 2WJ3A 4KJXA 5ALNA 1WHTA 2O2HA 3A2LA 5JYCA 4XJVA 4B80A 2QT9A 5JARA 1QIJA 4UUQA 3R3XA 1EHYA 2NW6A 3HRHA 3D5EA 1LPSA 4FDMA 2OCGA 1T4MA 2HL6A 2WIDA 3BE8A 1BEZA 3K9BA 4CIAA 1JU4A 1B41A 1QJ4A 1MPXA 3AZQA 4FHZA 3IDAA 4IHAA 5ALMA 4Y2SA 3QMVA 1GKKA 4P08A 1CLEA 2XUHA 1G4HA 4F60A 2AJ8A 2XUIA 4H77A 3F9CA 2XMGA 3L1JA 2FUKA 1BROA 3GFFA 4GXNA 1YB7A 1QIHA 1FFBA 1QIDA 1CUJA 2QTBA 2VAVA 2XLCA 1SC9A 5JD4A 1EDEA 1CUFA 4MWTA 3LS2A 2V96A 4V2IA 1MU0A 3R3UA 1CUIA 3AJAA 5CURA 3WI7A 2QR5A 2I78A 5LZ8A 3G9UA 1MNAA 2VQ6A 1K5PA 3PUHA 2WJ6A 4KE6A 4BVLA 4ZXFA 2RI6A 1DT3A 4Z49A 1RWQA 4D9JA 4XIIA 4P93A 3A2MA 5AKLA 4HXEB 5ALPA 2D0DA 2IX9A 2OAEA 3WYDA 4QWMA 2RIPA 2HFJA 2ZJ7A 4BAGA 5J3JA 3DOHA 2DR0A 3NGMA 3QBJA 1EVEA 1FFDA 4TVKA 5AM0A 4B0OA 1J07A 3WL6A 3C8DA 2PSHA 4QZVA 1CQZA 1QFMA 3LP5A 4RPCA 4BDTA 3FSGD 3DD5A 4FMPA 4W63A 2AJDA 3VJLA 4AO7A 2DQZA 3WIBA 2ACKA 4QDOA 4N5IX 4CG1A 1WB5A 4IH4A 5LKRA 5ALKA 5LZ2A 4OUKX 4LXGA 2XE4A 2I3ZA 4BDSA 4Q3KA 2QKYA 3RK4A 1YS1X 3KOOA 1K63A 2WG1A 4S0XA 3FCYA 2VJDA 4FWBA 1UXOA 2WIJA 3QM1A 1OXMA 3R3ZA 4PV7A 4JH0A 3I2KA 4U2BA 5JIBA 3EF3A 3U0VA 1XLVA 1DQYA 1VXRA 2JGEA 3DNMA 4Y2JA 3V9AA 3OC0A 1XZHA 5AKHA 1WPXA 2DSNA 2GBGA 2B4KA 5HFAA 3OTQA 3DKKA 5AHXA 4J0IA 3R3WA 5JZ9A 4Y2UA 4OSEA 2XQIA 1ORWA 3P2MA 2ECFA 1LPBB 3W9UA 1CUXA 4X95A 3CCCA 1BU8A 1UK6A 4C87A 4BB0A 4MQMA 5ALDA 1DWPA 1YA8A 4WFIA 2WUEA 3G9ZA 3V1LA 2HA7A 1UT6A 4FLEA 5IVIA 1Q0RA 2XB6A 1OILA 4UBLA 3IUQA 4K6KA 4WY8A 1TK3A 3WK9A 3DCNA 1D07A 1A8UA 4DTCA 2H1IA 2XUFA 3H0CA 2QXUA 1MJ5A 4UHDA 3DYIA 3E1GA 4I3FA 4P92A 2PSEA 2OCIA 1WB6A 5KWJA 1ZJ5A 5DTJA 2WHQA 2HA5A 4LYDA 2WKWA 5CW2A 1TAHA 4GBGA 2YH2A 5A6VA 3DEAA 2ORYA 5JATA 3PFBA 5FPQA 3YASA 4OU4A 4B85A 5CBKA 4N8SA 1QTRA 5ALSA 3TEJA 1R9MA 4BE9A 3HABA 4AZ0A 4KE9A 4BYMA 5ALUA 1TCAA 5HK9A 1HLGA 2WIKA 1YCDA 2HADA 1F6WA 1WPRA 3D59A 3LCRA 2WHPA 5E4YA 1A7UA 5HFNA 1CUEA 3WWDA 3DS8A 1XZJA 3G8YA 4FBMA 3ANSA 4IH1A 4PSCA 4OCZA 1NU8A 1WB4A 5ALHA 1M33A 5AKJA 1X2BA 3H2IA 4WCVA 1LPNA 4J03A 2XUJA 5IKXA 1MX1A 1H23A 1NX9A 2DFPA 3DL7A 2ZSHA 3C6ZA 2Z3ZA 2WIGA 1O6GA 5E2IA 3WK7A 3EQ9A 2PSJA 3A6ZA 3I2IA 2XUQA 5ALYA 2J4FA 4XWGA 5JASA 2I03A 4BAUA 5EI5A 3FLEA 1KEZA 1ZIXA 3LIIA 2XMRA 1K8QA 1R50A 5T4EA 1W4LA 3STXA 4HAIA 2Z8ZA 4FBLA 5HKAA 3SK0A 1ZI6A 5K3FA 1VJ5A 2RHWA 3ILSA 2G63A 3ZI7A 3MGAA 4E11A 3WK8A 3M3DA 4C88A 5CMLA 1U8EA 1QIIA 5AKKA 3C43A 2VT6A 4BTVA 2VA9A 3AUKA 2VJCA 3WIOA 1CUWA 1LLFA 5FDFA 3KSRA 2GBIA 5DNWA 4FLFA 4DLNA 2Z8XA 2HA3A 2C58A 1EINA 1XZLA 4FNMA 4ZV9A 1UOPA 1H2YA 4C01A 4EUSA 3EQ7A 3D2CA 3HXKA 4M0FA 1VLQA 1KU6A 4BP9A 3D0KA 1AUOA 4KAAA 3QZUA 2GZSA 3QPCA 1X70A 3JYHA 1DQZA 1L7AA 2VTVA 5HF5A 1GQRA 1DX4A 2WU3A 5JZBA 3IUMA 1XLUA 4ZI5A 1AURA 1JMKC 4PF1A 1JT2A 5AOBA 3GUUA 2QUAA 1H2XA 5A7FA 3IUNA 4U2CA 4UFOA 4DNFA 3I2JA 2JGLA 3FYUC 1JJFA 2XMDA 2Y2UA 1P0PA 3QITA 1ZI8A 4IH9A 4BATA 3HACA 3OM8A 4H18A 4BCBA 4QLOA 1J1IA 5IVDA 3SC2A 4DMCA 3PICA 3O4GA 3O4IA 4Q05A 2J3DA 1E8MA 4MQLA 3H17A 1XZEA 1E89A 1N8SA 2XMCA 4BTLA 2H9YA 4MXDA 1AKNA 2CKMA 5HCUA 2JGJA 4E46A 3ED1A 2XQGA 2C0PA 3ESDA 4YASA 1MTZA 1ZIYA 2FX5A 1UWCA 4KACA 2VJBA 4E14A 5AI6A 2R8BA 1W1IA 4QDTA 4Y2XA 4DGQA 5ALFA 2QXTA 3B12A 1RYYA 1N5RA 5FLKA 3W06A 4EY8A 5K3DA 2WSLA 1E5TA 1THTA 4AZ3A 5JD6A 5IVHA 3T4UA 3MUNA 2OPHA 5DNVA 2JIDA 3HEAA 4Q3OA 3C45A 1XZGA 3QPAA 1XRRA 4G5XA 4G8BA 3N0TA 3RLIA 1CEXA 4KEAA 3S8YA 1FFEA 1Q84A 3DL4A 3WQHA 1FFCA 1XFDA 2V9ZA 3H19A 1S8OA 4Y2RA 4JUIA 5KWIA 1IZ7A 5EIHA 3UMJA 2C5FA 1IUOA 3A2NA 3IA2A 5FRDA 1XZFA 4OD0A 4WFKA 5CH5A 1XLWA 3TJMA 1BRTA 2PSDA 1PFQA 1LZKA 4B6GA 5A62A 3N2ZB 2QRUA 5I9IA 1EI9A 2QM0A 5AK5A 3WWOA 1VA4A 3IB3A 3VVLA 5AI5A 4UBOA 5AK3A 1YSCA 1QO7A 1QGED 3FAKA 4G8DA 1UOOA 2BUCA 1C7IA 4Y2VA 4W1SA 3UUEA 1QZ3A 2B9VA 2ROQA 4B83A 2JGMA 3DQZA 1N5MA 1ZD5A 1OCEA 1P0IA 3LLCA 1NU6A 3QH4A 2DQYA 4BAZA 3TGLA 2OGZA 3H2HA 3IURA 4X00A 3R41A 2WFZA 3F8SA 4GDMA 4JEIA 3T52A 4FFVA 1SFRA 3R3VA 3AIOA 1E3QA 3W05A 5SYNA 1ZD2P 5C8ZA 4CI9A 1GGVA 3H1BA 2ACEA 1EDDA 5H3HA 4X6UA 4C89A 4JNCA 5LIPA 3WKEA 4MWSA 1W75A 4UBNA 3RKSA 2C5GA 3G0CA 1USWA 4JYMA 3AZOA 1CR6A 2AJLI 3H2JA 2HA4A 5HKBA 1N1MA 1SCQA 4NZZA 5SYMA 3OG9A 5CT9A 4G4JA 3WA7A 4A5SA 5AKGA 3PE6A 3D7RA 4RGYA 3I6MA 2LIPA 3WK5A 4BVKA 5ALRA 2GYVA 2JGKA 3BXPA 2Y6VA 5D3ZA 5DWDA 3IUJA 5AKZA 1UKBA 3CCBA 1F0PA 2VAXA 2PL5A 2BAGA 3DOIA 1E8NA 1R9NA 3FSGA 3C6XA 5ALEA 3A70A 4EY6A 4H7EA 2HA6A 5AM1A 2D5LA 4UFPA 4Y2TA 2WFMA 1XQVA 4G4IA 2WUGA 3ZLTA 3O9VA 3WLAA 5BWCA 4W1QA 4QEKA 3ICWA 2XUKA 2ZJ6A 1VE7A 4A23A 1Y7IA 1UZAA 2XI4A 2Y6UA 1R3DA 3HJUA 3HI4A 1UK9A 1YA4A 4J3JA 1XKTA 4ZGBA 1CRLA 4UPDA 3R0VA 4UHBA 2PU7A 4BZZA 4ROTA 4OU5A 4FNGA 5JALA 2XUDA 4QA9A 2EDCA 3WJ1A 4B0PA 1QONA 3C8HA 1CPYA 3AZPA 3ESCA 2HA2A 5A71A 2EDAA 1ODSA 1PV1A 3STTA 3Q8WA 4J0KA 4EHBA 3X3HA 1UFOA 1QIMA 2G5PA 1JMYA 2ZSIA 3LIPA 5AKIA 1MAHA 4GWLA 4DMHA 2WILA 4PSUA 1BEEA 2DHDA 3FLAA 2XUOA 5K3AA 1IVYA 1JI3A 1PJAA 1UKAA 3V1NA 5LKAA 4ZWNA 5LZ4A 1MX9A 1Q83A 1U4NA 3OPMA 4BVJA 4X7BA 4HXGA 2DHCA 1YR2A 1VKHA 5ALOA 3ZLVA 3K6KA 4NS4A 3I2GA 4OPMA 2GBCA 1IMJA 1JJBA 3ZWQA 3BL8A 5CT5A 3C6BA 4C4XA 1ZGCA 3C5VA 4PNZA 2XMSA 2HM7A 3KWFA 2Y1KA 4WFJA 1DINA 2JEZA 4UBMA 3O4HA 4A16A 1ZICA 7YASA 3WK6A 1B6GA 4U2EA 2ZYSA 4QWWA 5AOAA 2G5TA 5BWBA 4E15A 3NWOA 3O9MA 4HVTA 5I7UA 4K6HA 2CMFA 2BKLA 1YS2X 1QE3A 4MJ3A 4DSZA 4U2GA 1TQHA 4B7ZA 4RNCA 4DYHA 4J0JA 5ALJA 1J06A 1THGA 1G5FA 4EBBA 1HPLA 2XMBA 2ZJFA 4H7DA 4K2AA 1TIBA 4KAJA 2CBGA 4H35A 1AX9A 2BJHA 3E0XA 4Q34A 1T2NA 4ITVA 3JWEA 2K2QB 4GI1A 3AIMA 2GYUA 5HF6A 5AKEA 1O6FA 2PU5A 3DKRA 4H7KA 2J4CA 4OB7A 3FVTA 5JANA 4X92A 5FXMA 3BDVA 1CUZA 1JKMA 1YB6A 4BZWA 3B3QA 2WLSA 1AQLA 2JBWA 4Y2QA 2VEOA 1CUYA 3FOBA 5JAUA 3NOXA 1VXOA 1XQXA 5C8VA 4QLAA 2QJWA 3I2FA 1JFRA 4F0JA 3TRDA 1XZAA 4ARAA 4QDUA 4DNQA 3SX4A 1EA5A 5FUMA 4H7HA 4J7AA 3G9TA 2QJRA 2W22A 2GZRA 3PI6A 5JZSA 2EEPA 2PX6A 3L1HA 4UFNA 4X93A 3W9BA 1VE6A 4X6XA 1ZD4A 3CN7A 5F4ZA 1U65A 4DSAA 4UHHA 4G1FA 4CG3A 1DTEA 1VOTA 4K5QA 4B82A 1QIGA 3F97A 2R11A 5DYWA 4OYLA 1K6EA 1AC5A 1LBTA 1GPKA 1AZWA 4KE8A 5IH7A 1QO9A 4AXBA 3STWA 2QS9A 4AMYA 2OCLA 3BF8A 4X91A 3OOSA 4PO3X 1K4YA 3ANTA 3K2IA 3AFIA 2Y2VA 4QNNA 3VXKA 4DNPA 5AIAA 5JD5A 2HU7A 2DHEA 4M0MA 1ZOIA 1UKCA 1GPLA 5DTIA 2Q0XA 1QLWA 4KR0A 1L7QA 4HZGA 2ZYHA 4XVCA 1XKLA 4Y2PA 4UHFA 5ALTA 1XZIA 3ESBA 2XMQA 3VKFA 1CQWA 1UK8A 3IIIA 1WCYA 2V97A 3WJ2A 1Q0ZA 1LBSA 5DYTA 5DLPA 5ALQA 3OURA 4IQ4A 4CG2A 3BF7A 2QVBA 4X90A 1MX5A 5LLSA 3WZMA 1EH5A 4JYPA 4GW3A 2V98A 2HU8A 1HQDA 2O7RA 2WTMA 5AO9A 4G4GA 4TPKA 2AXEA 5DJ5A 1XZKA 2HFKA 2FJPA 4F21A 2H7YA 2YASA 2OXEA 3DLTA 3H2GA 3KDAA 1WM1A 3BJMA 1LZLA 1W52X 4AO8A 2RAUA 1DWQA 2YYSA 4EY4A 4C4YA 5ALVA 3KXPA 2HU5A 1MAAA 1G42A 4PSDA 5HF9A 1TCBA 3S2ZA 2OGTA 3W2TA 3C87A 5AICA 3G0IA 2WM2A 2IIVA 2WHPB 3ESAA 3MUOA 4PQEA 3C6YA 2QOEA 4C6HA 1P0MA 5EHQA 4I19A 5AJHA 3WKBA 2YXPX 2PPLA 4Y9SA 5EFZA 1R88A 1EK2A 4TGLA 4GHWA 1GT6A 4OYYA 1ZJ4A 4Q82A 5HQ3A 3D2BA 4P9NA 5K3BA 5E4TA 5BV7A 4FLMA 2HHAA 1LPMA 4BBZA 1ETHA 2UZ0A 4J0CA 3AIKA 2BUBA 2FJ0A 1QOZA 5AH0A 2XMZA 3JW8A 2B20A 1G66A 1VA5A 4UBKA 4BCCA 2O7VA 4KRYA 1CUVA 5KBYA 3B5EA 2OGSA 4HRYA 3KWJA 2C7BA 3V1KA 5ALGA 5ALXA 3G0BA 1C7JA 5C81A 4AQDA 1BN7A 4ZV7A 3W04A 4UHEA 2VF2A 3QYJA 5FKJA 2G4LA 3I28A 4LYEA 4QDZA 1CV2A 5CXUA 4B84A 4GLBA 2WUDA 2Z5GA 3VJMA 2WTNA 4AB1A 4ZRDA 5FV4A 2X76A 4L72A 1YASA 1ACLA 3BIXA 3WKAA 1CUBA 1EB9A 1MO2A 3WL8A 5I8PA 1WOMA 5CH3A 2X5XA 5HQ3B 2XUPA 2PBLA 4DMKA 4L9AA 1DT5A 1CUCA 3WWCA 4WDQA 4WJLA 3F96A 2P8SA 2WIFA 4X85A 1F0NA 5D6OA 5AM2A 3IBTA 3HLKA 1WHSA 2XQFA 3WWEA 4J0DA 2JEYA 2WFLB 3RM3A 3AILA 4AO6A 4H7IA 3FVRA 2H7XA 1QIEA 1XZBA 2ZYIA 1BS9A 4DMFA 4ETWA 1EB8A 1BE0A 3CXUA 3QMMA 5ALWA 4M0EA 5LYYA 2PM8A 4AN1A 4H0CA 3GELA 3WMRA 2AJBA 5LZ9A 1CUDA 2QMQA 5K3FB 3RARA 3I1YA 3HZOA 5EHZA 3DDUA 1QTIA 4AX4A 1LPAB 1H22A 4PW0A 1CUGA 5YASA 4G9GA 5FPPA 3WKDA 4LKOA 1SCIA 2WHRA 4NMWA 3I6YA 4C4ZA 1J2EA 4GECA 4BRSA 3R40A 1CFJA 4CCYB 5AM4A 1GQSA 4MEBA 1XZDA 2BUAA 2DCMA 3HC7A 3GBSA 4MEAA
chains in the Genus database with same CATH superfamily
1KH3A 4FDLA 1FFHA 5AJWA 4RPGA 2FPPA 1RYEA 4NE9A 3MJSA 4L2IB 4DL9A 2FEMA 1KSFX 4WE3A 4JLMA 2FRDA 3QI7A 3UN1A 5IBPA 3IOMA 4DR4B 2R2AA 1LJUA 5IXJA 3P32A 1S3GA 3ZHCA 2I1LA 3LLUA 3K73O 1T0JB 2ISSD 3D0RA 1ECLA 3JQDA 3MT7A 2GZ2A 3QVMA 4HLQB 4BP8A 2BCEA 2O5VA 3ISVA 5FFFA 1CETA 3PXAA 5H82A 2ZSFA 5NULA 2V5UA 4RJTA 1OB2A 1PV2A 2ZBPA 5AIBA 5FCDA 1QIFA 5IHXA 4B3JA 1Y0BA 4C3UA 1V4VA 4YV1A 3OCWA 3H65A 4R98A 3RR2A 4L5JA 4U3JB 1PVOA 2Z5FA 4NR0A 4M7OA 2PD6A 5C8XA 1ZMBA 3NDPA 2H7CA 4ZAYA 5KB3A 2BMJA 4IQFA 5DX1A 5BOSA 1KS9A 1XVLA 1YZQA 1MENA 4QPZA 4QTYA 3SIWA 4FSDA 4JUCA 2AI2A 1L6RA 3JX9A 4R40A 1V3VA 1LGYA 5B6JA 1TK9A 4LXQA 1APBA 3PVCA 1WR8A 1KO7A 5DM0A 5EXPA 4N47A 2F64A 1Q1QA 1TVKB 5LBTA 4B3CA 1TC1A 1U0NA 2WYWA 3B53X 4PR0A 4PZZA 5FIUA 3D6FA 3TLGB 4YK7A 4FCTA 4R9SA 3GZNA 4PAWA 3T15A 4RVDA 5KYVA 1U31A 3J7AC 3PTAA 1OD6A 5AKYA 3H1PA 1PVVA 4YWJA 2OHJA 4G5HA 4C6SA 3RYCA 2NPIA 5K0LA 3K0CA 1NRIA 1DMSA 3PUIA 3SJCA 3GRFA 1DBQA 3MRSA 1U1FA 3LXMA 3GL9A 3DR5A 3AKCA 5EC8A 5FP0A 3EC1A 3SXPA 5ICMA 1N2CE 5A3SA 4DXHA 3N0RA 1NW4A 2QYTA 4MZDA 5H4HA 5KC8A 3NP7A 2W8BB 1BDBA 1XRPA 2EU8A 3GEEA 1ZD9A 2ZE7A 2F9MA 3N8NA 1E5DA 3KU1A 3TRKA 1XJCA 1PLJA 1T5IA 5LN1A 3FYDA 2BM0A 2AMFA 3U1TA 4XDZA 2XZTA 3QE0A 5JJCA 5K05A 4HGRA 4YDHB 5C31A 5LU9A 3I6IA 2REQA 4G8CA 1NM5C 4A8JB 2JJYA 1ZM2A 2R6AA 1ST3A 4PYKA 5C1BA 5CT8A 5JAHA 4J3FA 2X2EA 3M9LA 4R5MA 1T8YA 2WVAA 4XGKA 2JBHA 4DQDA 1D6JA 4W7IA 2ZJBA 1UC4B 2C3YA 1EE9A 1K68A 2B2XA 2CK3A 2HT6A 4KK3A 1N2HA 5DLYA 4F4DA 2AJCA 3E3LA 4M9CA 4EX6A 1KVUA 1DX6A 2EIHA 2YL2A 2ZDHA 2BTQB 3AVPA 1Y6RA 1YQXA 3AHFA 3E3AA 4Q6BA 4E09A 1E64A 3OTOB 4EZIA 2D13A 4RKEA 4MMXB 1IN1A 2FW9A 3SEFA 1GVNB 1LRJA 1HBJA 2Y1OA 4H1TA 1RXCA 2TYSB 3ZYCA 2XZLA 4LXXA 1JPJA 4QUBA 5ISMA 3TQCA 1DG9A 2C98A 3X1XA 4IJVA 5ER9A 1KYQA 4UHKA 4FMCF 3ZZMA 1O4WA 2IV2X 2VSQA 2WHYA 2D59A 4NOKA 3EF1A 3I04M 4AG6A 5K5EA 1CJMA 4BRZA 3G13A 3GDOA 4HQKA 4IF4A 1V9LA 1Z7BA 3PD0A 3PEFA 3HB1A 4RDCA 1XKQA 4NXMB 1NOKA 1HQCA 4QXQA 1OREA 1FFXA 5TPZD 2H51A 3PDIA 3GR6A 4OBEA 1T2VA 2ADOA 2GZMA 1JHUA 4LX8A 2BGIA 2XUGA 4RJJA 3I30X 4XYEA 2X8BA 1XEXA 5HIMA 1JQBA 3I8OA 4EA8A 4DB4A 3VHQA 1H2ZA 2R00C 3AL0C 4JXZA 3UFXA 1E6WA 2EFCB 5J59A 1HL7A 4B6OA 4ZJZA 2SCUB 2HJHA 4MGYR 1I3MA 3K6SB 1TMOA 3OCUA 3MJHA 3NTOA 4GEKA 4POOA 4WVLA 4XLZA 1X7ZB 2GYWA 3EXG1 4QDKA 5K4GA 2CWDA 3I1IA 3Q6IA 4MB6A 1G8HA 5AW8A 1T4GA 1VCNA 5EA2A 5ESRA 5BVGB 2X8JA 1UDWA 3BZUA 1JLKA 3VR4H 2GJ8A 2B0CA 3A1SA 4IKOA 5FFMA 1PGJA 1II9A 1TK2A 3CSSA 1TTQB 3NM5A 3A3PA 2H92A 2H4JA 2NOAA 1EDBA 5BOVA 4B3RB 3ILYA 5AYVA 3HFGA 3JRNA 4PZ9A 5JS7A 3CRQA 1S96A 1OV4A 1NRXA 2QP3A 2GTIA 2RCYA 3I92A 4JBLA 1VECA 1IM5A 4X5OA 3UHAA 5JYDA 1RC8A 1XZCA 1M1YE 2WPDD 4IQGA 2Q1SA 2YZKA 1GWNA 3PRJA 1ACJA 1X1DA 3CRVA 4I9HA 5JFGA 1ML3A 4J7UA 2XTZA 3DUFA 5AW6A 1SU8A 4OXRA 3BIFA 3UKDA 3DT6A 3D31A 3WV4A 1YDMA 2RHRA 4ND3A 4YAKA 2FRDC 3LFUA 5ALLA 3WOHA 5AM3A 3O4JA 5F1PA 1ISPA 3KYBA 3VHXA 2O2JA 5E1OA 5ITSA 3R2JA 4HQLA 5KEIA 1QF6A 2RB5A 2XRMA 3FNBA 4D56A 2ISQA 4M60A 2XNSA 3L49A 4KMOA 5CT4A 3U3ZA 3MRXA 1KQFA 1V5EA 3EIEA 2R1TA 3NHUA 3QLJA 1CNEA 1J24A 3DOJA 1LI5A 1LVGA 3FMOB 3WLNA 3Q2IA 2FZEA 2L17A 2PA0A 3RWOA 5FYQA 4PG8A 2F1OA 3BWBA 2PO5A 1YE5A 3ANYB 1KORA 2BWJA 1SUWA 2IUTA 4YFVA 2Q3HA 2GB4A 2O7QA 4KYVA 4R9NA 1PDWA 3EXG2 5I01A 2PVSA 5T4FA 1R4ZA 3PFIA 5GGXA 1F0KA 1GDTA 5H80A 1FYWA 1GFIA 2HGZA 2OSBA 4LCEA 1Z39A 4RESA 3IP1A 3R6DA 3IVMA 4LRQA 4NFLA 2VJPA 3I12A 3LGXA 2JLYA 1KGDA 1E32A 2FQXA 1GRQA 1CK4A 1W6RA 4RL4A 5D7BA 2VJNA 3ESZA 3PF8A 3G23A 1MNQA 2Z4TA 4ZOQI 3R9XB 4BN0A 3TW4A 2FG5A 3I8XA 3VR6A 1YQQA 5B7PA 2CW5A 5F7ZA 1E66A 4ANFA 2CFSA 1XRLA 4L3WA 4TKVB 2HHJA 2XDWA 3UM9A 2X0KA 3LPLA 5EUMA 2AFIA 1XMQB 2BJVA 3WNVA 1PEDA 2MHCA 3M83A 2E4VA 3HBJA 4TUYF 2XYGA 5DYYA 4Z53A 1RKXA 2D1TA 1W9MA 2JHAA 4GOXA 4EI2A 4JA0A 1GPH1 3EMKA 3AFHA 2P3LA 3P19A 2X40A 3O75A 3LT0A 1UBRS 4E03A 4RD3A 2PMFA 4CTOA 1ORVA 2CNDA 3RIGA 4QOGA 2HDWA 4GC5A 1Z26A 2WU4A 3O1IC 2CJPA 2Q7XA 3SP1A 4D4KA 3PQCA 1OXKB 5FBQB 5HTKA 2E4UA 2HRQA 3V3KA 4B81A 3AVXA 4RE6A 4F1KA 3KM0A 5KPJA 4R2XA 1JFLA 3PC6A 4JJZA 3RC3A 3ABQB 3W1EA 3PX3A 1FFAA 3WHIA 4EY7A 4YT4A 1Y1KE 1Z18A 1VG9B 1Y42X 4P3KA 3CLRC 2ALJA 1Z0SA 3KNZA 3L7LA 3TFWA 5I8WA 5IJWA 4U9IS 1E4OA 3NEAA 3NAMA 4J49A 1SPXA 4RADA 1FFSA 2W4IA 3DPUA 2ODPA 1JP7A 1YE8A 2QUBA 1Y8ZA 2OXIA 3VZCA 1YKGA 3OQJA 3FLBA 1OAAA 4LOAA 4WK0B 4G23A 3JARB 1A9QA 2MINB 1V4BA 3I6ZA 4QTZA 4RHCA 3IERA 4PG4A 3RJ5A 2QJTA 5H4GA 5C51B 1TT7A 2G8LA 3FFAA 4UMVA 2O59A 4EG0A 1LDGA 2V6GA 5GV7A 3T4PA 4F04A 1WMBA 2C9DA 5DYNA 1D5WA 1U0HC 2F8SA 1SKAA 4CIWA 2BI7A 2V45A 3OFND 3RK1A 4EVIA 2YVAA 1UJBA 3E5HA 3IRUA 2GD1O 3GJSA 1EVYA 4YUWA 3GLFB 2QX7A 2ZIEA 3AU9A 3FPSA 5A4JA 5HZMA 4GPTA 2JLUA 1CJSA 2HCTA 3TDNA 1KEWA 1BMFA 1T9CA 4PFKA 1SQ0A 4YCJA 1ZVMA 5K3CA 1ZITA 5A1JA 1IXYA 4UCXA 2QMYA 2NT3A 2JCVA 1BIFA 2OQIA 4O4IB 4Z4IA 4X97A 3G2OA 5IFKA 4M8LA 3HN7A 1IHPA 3TS1A 4YJ2A 4B8ZA 1YB2A 2H07A 3DZCA 1XMXA 3KCQA 2HRBA 3V1MA 5BVHB 3CZRA 4KVZA 2ZGVA 3I52A 4QPPA 4RQAA 1E6EA 1PHRA 2DPGA 3BULA 4UEOA 1MT3A 1YIAA 1RKUA 2JI8A 3AHDA 2EAUA 1ZOSA 3U13A 2SECE 2P27A 3AM3A 2PD3A 3G2LA 3EFOA 3G7NA 5K0JA 2BEUB 1KJQA 1GARA 2REQB 2W0SA 5CTJA 3SVZA 4A8JA 4BZXA 2ZQYA 3RTAA 5CRIA 1NM5A 2BKXA 1ZK0A 1EFRD 5KPDA 4RUKA 1EXWA 2V9PA 4RH1A 1RLOA 2A9OA 4PLGA 4ZYWA 5FA5A 1A8SA 1R0SA 3S7TA 5AUPB 4JVOA 3ZE6A 1NBEA 4Z4FA 2EBFX 4JLSA 1W19A 5DHQA 5D1NA 3IILA 1VKRA 2GEKA 2AMYA 3LF2A 3N0WA 3QW2A 3B3JA 3VU3A 3CUUA 1DC3A 1GILA 3I0MA 5HBRA 3E6AA 2OAQ1 3FYUB 5DM4A 3GAFA 3TX2A 5K9ZA 1DOZA 2R47A 2I34A 2IOQA 4EF6A 3DWEX 4BE4A 1M5RA 1REQA 1JPUA 3TI7A 3STUA 4WESA 3PKJA 2HI0A 4KPUB 4MINA 4OBBA 2YBEA 3KEMA 4LJRA 4WUTA 4RSRA 1KVRA 2BM1A 1JIQA 1QYXA 2Z2IA 1UEXC 2H2GA 3FYTA 3GWZA 5FEMA 5ILOA 3BGDA 1IPHA 3DZ8A 3D2LA 4Z9AA 4M3NA 3EGXA 2E4YA 5DSXA 4B5KA 3PWTA 1WY5A 1DCFA 3PXEA 3PWZA 4TTRA 1GFSA 1Z63A 1NURA 1G18A 3DLPX 2ZB7A 3QPVA 3TL6A 3QEKA 1BH6A 2WTUA 3CEPB 4D4MA 4M99A 2XZOA 1JQAA 2DT8A 4K6GA 6CHYA 3L5OA 3AY0A 1CDDA 4ARBA 3CEMA 2B4YA 4BN5A 1TAUA 5HM6A 3DE2X 5CJ2A 4PNHA 2C3OA 1Z33A 2K87A 1FJ2A 2VXBA 1LLQA 3GXBA 3O5AA 2PZJA 4HLDA 4CT0A 1OUMA 1IUNA 1T0PA 4RO0A 5FLXA 1KNXA 4GICA 2ZYRA 1V41E 1GGFA 1M2VA 3D7MA 3LVRE 5EWLA 1XXHB 3BWEA 3FTEA 1WV1A 2W6ZA 4EPWA 1RXVA 4GVLA 4X6YA 4HCJA 1W0JA 1DO0A 3LTNC 4OYRA 3W4IA 3N58A 1JFTA 5BSEA 4LAFA 4C08A 5JAPA 3ZW8A 2O6LA 4JLWA 2JAXA 4RHEA 2FW7A 2Z09A 2P91A 3EXIA 3IAHA 3ZCTA 3VPXA 2NZVG 4OMFG 3ZWMA 4L0QA 3H5IA 1ZI9A 1U63A 2JGIA 3EB9A 1X1TA 4DFDA 3A06A 1R6DA 4U7GA 1GGNA 4XLTA 3U3JA 2QRMA 2VDWB 2Q4OA 3H1AA 5IZCC 2W6PA 1BXRA 2YFKA 1ISJA 2YZGA 4MHSA 4A2WA 3SWWA 1UC9A 1CY8A 1SRQA 1Z13A 3AERA 4OQFA 3VYSB 3CO0S 3A6LA 3DHNA 4YTEA 3QFCA 2MSDB 1T0UA 4YRPA 1SQFA 2MSLA 4BE7B 3QX8A 2B6NA 3U3OA 2AYXA 1NMZA 5I45A 1N5JA 2X0JA 1P19A 3HKBA 3G8BA 2ERYA 3JASA 4XD2A 4C5CA 4GKBA 4PNEA 3LPCA 1GAEO 2O7SA 5A3RA 1KYWA 3UXEA 5KYWB 2ZR7A 4IO1A 6ADHA 3VHXB 4DR2B 1K4KA 2ZEJA 1SXJA 3FPHA 3G5MA 1TRKA 4IX9A 1KI7A 2ZXFA 3GEPA 3L1IA 4IGIA 4Q1VA 2PV7A 4JEUA 4M6WB 1IVSA 5TLSA 1W76A 1YNSA 2PV0A 4IINA 2ZJ1A 1YB4A 4ZANA 1EE2A 1L5HB 1QKJA 1ZJZA 2BN4A 3AESB 4DAEA 3ANMA 1RQRA 3QXCA 4R6XA 1QH1B 2HIHA 2J9FB 4JLNA 4Q4HA 3TTVA 4YCMA 2V6MA 4U7PB 3A0UA 5BV1A 3D5TA 4DM7A 1CB7A 1USUA 4KIFA 2QLNA 4LWZA 4XQEA 5DLEA 2G1PA 1P4JA 1KAMA 1E3JA 2V4MA 5CFNA 1F0YA 3VJKA 1DEXA 4BIMA 4HEJA 3JQFA 4S1WA 4TKUA 3AQ4A 2GETA 3ZHBA 3MWYW 4WZAA 1RJ9B 4PZCA 5HK8A 1EEXB 1DAIA 2OQ2A 4BLPA 3BM5A 1ZCAA 2AFHA 2XCUA 3L7KA 2WG0A 5IKPA 2O0JA 4ZO8A 3H1TA 1UBTS 3K15A 5LQDA 3T1OA 1IZ0A 3C98A 1JEEA 3KQVA 1RHJA 4CLRA 1CS0B 2I7VA 3HR7A 4J0FA 1LC3A 1JX6A 3RTEA 1MB0A 2OBNA 2PL3A 3HDQA 4QC2A 3UWOA 2BCJQ 3FPEA 1C4XA 3QFHA 2FF5A 1JQEA 2IYVA 4DSTA 2H1HA 4TKVA 2DPLA 1MB4A 1OHHA 4PHHA 4GKAA 1V8BA 4HYYA 4PPFA 3O6VA 3JQEA 4YR9A 5JPDA 3ZD6A 1THMA 2EFJA 2XECA 4FXPA 1HE2A 2G9UA 4YP1A 1CF4A 1SKYE 3NHBA 3TSYA 1HI9A 2PLAA 2OCAA 1A69A 1QHIA 1CUUA 4BQQA 4OB8A 3ICEA 3E22A 1SCKA 4TYQA 3RT7A 3JQCA 2ORVA 2XTAA 4U8GA 3VDRA 2PQMA 2XJ4A 1QAQA 4KPEC 1X8JA 2A94A 4K28A 4MYUA 2R97A 5P8WA 5CG1A 4ZYUA 1QKIA 3LQKA 4DSOA 3NUGA 2C9YA 1MN6A 4H7JA 1RC0A 2J33A 1O0BA 4P4SB 1ID1A 1WDTA 3RTBA 1WZCA 1ZK2A 1VMIA 2QTRA 4OF4A 1NVXQ 5DI3B 5ALNA 5EFOA 9LDTA 1RRMA 1PK9A 1SNYA 2V4UA 3A2LA 5JYCA 1W8IA 3SR0A 5DGHA 3WIEA 4G1BA 2NU9A 3U7QB 3ZWCA 1QIJA 1FTSA 2D0PB 3NC0C 3SEQA 1ENPA 3QOXA 2DR2A 4DA4A 1JE0A 4L57A 1EHYA 1I4EB 1OX5A 2VBGA 2XNDA 1M0EA 1EK5A 4A0QA 1RLTA 3C4VA 2NZUG 2GJAA 5FEUA 1SBZA 3VR3D 1LPSA 3ACCA 2Y9PB 3DZDA 3AERB 1VI2A 4MKRA 4JROA 1Z5VA 1T4MA 5HDQA 3EPRA 5A4IS 3GP5A 1XTIA 4FN4A 3G59A 4RZSA 3UKJA 4HG2A 4BFXA 1JU4A 2WYOA 5F3DA 5JWRA 2HV9A 3BXFA 4HTFA 1MB3A 1MXFA 4HN9A 2IYPA 4H59A 4HNGA 1O6BA 3H42B 4EITA 1DO2A 1MPXA 1GAWA 1QCYA 2P1DA 3AEQB 3IDAA 4FHZA 4FQ8A 4GGPA 4L5IA 3GHYA 4YYZA 5KX5F 3QMVA 1YVDA 4BNXA 3G68A 1GKKA 2OV1A 1GQQA 3DH0A 2ZW9A 2WD7A 4OG2A 3AXTA 1B74A 2YN0A 5KOIA 2YW2A 2VDMB 4CW7A 3A31A 3KOUA 2A35A 4MOWA 1M2GA 2R1VB 3NC4A 2E2WA 1PG2A 3U80A 2XUHA 1UMCB 3UW1A 4ZGWA 4C5BA 2ZRPA 3AHGA 3GFVA 2Z58A 4IFIA 4JD5A 1MO3A 2H17A 2HSWA 3KOMA 3RC7A 4BNTA 1E6LA 2J3JA 4I1SA 3O3MB 2W42A 1R4AA 1Y3FE 4HBZA 3R7NA 5KVCA 4ALKA 4HX9A 2W8BA 4CL8A 3GFFA 3LLSA 1GCIA 4CU5A 1EVJA 2WNHA 4GX5A 3SSOA 4DUGA 3BCUA 4IUCS 1OPXA 1QHHA 3CF4A 1GADO 3CR8A 4MQ5A 5TPZA 1Q1BA 3ZX4A 2P4UA 4OK6A 4M54A 3OZGA 5KCZA 4G0WA 1U3CA 4TYYA 2IY9A 2GARA 1SC9A 1W9HA 3EIXA 3DYBA 2P62A 4JUBA 1S7CA 5IJZA 3EPJA 3H4IA 5BRAA 1EQ2A 4IOKA 2H65A 4OXIA 4MWTA 2W93A 3BBPA 4R68A 1H9BA 1CUIA 1GA6A 2H4YA 1XA3A 3EIFA 3KZXA 2PT5A 1EWYA 1NR5A 3GGGA 3L0IB 3WRVA 3P0IA 3C97A 3HBFA 3IYLW 4E94A 3D6AA 4Q7KA 4RYLA 3G9UA 1DQPA 2B37A 4A6XA 4AICA 4V0ME 1MW9X 1FTQA 2NYVA 1NE2A 1MP0A 4UU0A 1FVHA 1Q44A 2VQ6A 3N6XA 3OEED 3PXXA 4DY6A 5C4IA 4DCTA 1P29A 2REBA 3M4JA 4ZU3A 3O1LA 4OGFA 2A5LA 3FB4A 2PX4A 4OJKA 2R5WA 2GCGA 4O33A 2JDID 4I3GA 3B60A 2AX4A 1GRCA 2MSWA 4OV6B 4P4TA 2GCIA 3W90A 4HDAA 4ZHQB 4D9JA 5AJUA 4NPCA 2WKQA 4K3VA 4RIGA 5C7IO 4TVBA 4D3ZA 3Q8MA 5E1MA 4S1VA 5LWHA 4RTSA 3ESRA 2YMQA 3A2MA 3F7OA 2I2XB 1WZUA 3D43A 3DFMA 4HXEB 1CJBA 5BN4B 4NABA 5A6SB 3CLTD 4DADA 3KAPA 1EE1A 2F43B 3S40A 1H5NA 2PMKA 5LCXA 3T3GA 5I7WA 3B85A 4R8MA 2OAEA 1KI2A 3OHMA 3CZCA 3U9TA 2PX5A 2RIPA 2HFJA 4OEHA 4PN7A 5T67A 3JR7A 1ZGGA 1UEJA 1E69A 2VZ8A 3L7BA 2C61A 3U16A 4N0DA 3UFXB 4WW0A 1NR1A 2Z9DA 3QBJA 5HOQA 4OP1A 3DOCA 5KYXB 4NCJA 4P81A 2NUPA 3DBVO 4I1OA 5FHRA 4B0OA 4MQBA 3NNNA 4MUBA 1EG2A 4JXXA 1FFYA 4MIKA 3C8DA 3DTVA 2HSDA 2Q3LA 2BM9A 2WQ6A 2AI1A 2GI4A 1NBME 3ROMA 2FSVC 4Q93A 1XPRA 3LP5A 4RPCA 4WECA 1TLLA 4R71A 1PGQA 1VLVA 1G8PA 2DUJA 1QV6A 1C8VB 2DQ4A 2ZBUA 2IYRA 4G09A 4IJUA 4LVNA 1QQ7A 5J2TA 1R9GA 5DNCA 2BFPA 2HYDA 2P2LA 1P7WA 1RW4A 3HP4A 2DQZA 3WIBA 2ACKA 3EZ7A 2P4SA 4DWWA 4B4UA 2WNSA 2VHJA 1IN7A 1V16A 1WB5A 1X1BA 3JARA 4AP5A 5KSZA 2X9GA 5LKRA 2ZIZA 1XTPA 2UUAB 4LXGA 4ZQEA 3ILHA 2WBLC 4EJ6A 3DE7X 5TGZA 3AI2A 3OOEA 5DBHX 5ED4A 3H9EO 4X1KB 1Y6FA 1K63A 1R2QA 1FU8A 4Z8XA 3IKMB 1GLNA 2WG1A 4S0XA 1JIXA 4QQKA 4LBWA 3QUQA 1ECCA 4MV6A 4RELA 2HF2A 2FZ5A 5HJ7A 3HB0A 3NKLA 1BXGB 2VJDA 3IUSA 5A9SB 2WIJA 4UM8B 2IV3A 3G82C 2LPMA 3QKRA 4JQCA 3R3ZA 4MGHA 1DLJA 3NJ8A 1ZJYA 2I3AA 5GY7A 3D02A 1EFDN 1FP6A 3I2KA 4RY8A 2Y0EA 3LDFA 5JIBA 5KVVA 1KPHA 1SK8A 1U2DA 2O48X 3EF3A 3ZZ0A 4ZV4A 2CLMB 2X2PA 4G37A 6ABPA 3LHFA 1HE4A 1XP5A 2WEKA 2ZZKA 3S99A 3RPEA 3SIXA 1DQYA 4AJKA 4AYXA 1EVIA 2E85A 3PNMA 3UT6A 3BTSA 3N8IA 4KOEC 1ZZGA 3A4YA 3CIFA 4J94A 1MD9A 4XJXA 1RQXA 4Q00A 5B5SA 1JSRA 2XCTB 1UMKA 2FCAA 3IQDB 1VYHA 4G1CA 2GBGA 2B4KA 3JCZA 3VH1A 2VUUA 4H31A 3BVPA 3I5AA 1C3EA 3DKKA 1KPIA 3SKYA 5K0EA 5JZ9A 3LQ1A 4Y2UA 1OBFO 3NHLA 1Y3IA 4Q4AB 2XQVA 1KEUA 4IKPA 3HUEA 5EVJA 1NVVR 4AJNA 4EF4A 1IATA 1GO2A 1LSUA 2XMPA 3SC6A 4LTNA 4S0ZA 1ORWA 4I5FA 3ZHRA 1FNCA 1D4AA 3KWMA 1B3RA 1B8VA 2XVYA 4Y18A 4JA2A 2J0SA 4BGIA 5FTMA 2QU8A 4Y6PA 1E58A 3HZRA 2P79A 5FQNA 2GVNA 2FSFA 3P0FA 3EUWA 3GVPA 3QXHA 4HWTA 4LMAA 2ZJ5A 3PNQA 5EZ5A 5U1PA 2QVXX 1T3SA 1PZFA 2FFQA 3T34A 1K08A 1UK6A 1ZVQA 1EXVA 2QORA 3IT3A 3ZI0A 1YHNA 3AG6A 1SVIA 3GCGA 3KQSA 3QBVA 2R79A 4II7A 4MQMA 2Y0PA 4MUMA 1DKRA 1LLCA 4L5YA 1YA8A 3N5KA 4WFIA 1EFLA 2VTBA 3P96A 4RPHA 4WJZA 3FYCA 3OC6A 1XU9A 1VC2A 5K8LA 2YJTD 4TVOA 3ROFA 3OIUA 3ZV5A 2YXBA 3N6RA 1CG6A 2EW2A 4RFLA 3RFXA 4TV9A 1AVTA 4ABYA 3QU5A 1P1CA 1OILA 4UBLA 1F14A 4AM8A 3EPHA 1V9SA 2V58A 4HK4A 4AKSA 1UMDB 1TK3A 4JAVC 3DCNA 4BV8A 4C5AA 1D07A 2MSKA 1EUYA 3OSZA 4NH0A 2CMDA 3ND6A 4PLCA 1UT5A 1RXUA 2HXYA 2XDAA 3ZW7A 3KALA 1OH7A 4HLUA 3ZY6A 1FDOA 2F6RA 1QGUA 2QQGA 2RJOA 4CDNA 2WHEA 3BXZA 3RU7A 3E1GA 4I3FA 5ADUS 5JDCA 1IWPB 4H7PA 1TQ6A 1L1QA 3AXSA 4Q9JA 2H5EA 4JP8A 1AGRA 4Q7QA 4AY2A 3SS8A 5F2NA 4NENA 1T3HA 4OXYA 1TE2A 4E3ZA 1HE1C 2WHQA 1M3SA 1C30B 3A2KA 1NQOA 2WKWA 4F9EA 2GLXA 3GUHA 3G85A 3DMRA 1TAHA 1U9YA 1TQ2A 1KOJA 3ZE1B 2Q1TA 3EBPA 4CQMD 4B3DA 3UPUA 2YH2A 3GFGA 2HJGA 5A6VA 1W8DA 4K9SA 3N39C 3ILVA 3Q3EA 3A9WA 2ORYA 2F9FA 3JATB 3W5JA 3CVWA 4Z9YA 4QXOA 1KAHA 2PUAA 3TSOA 3MOSA 1NJ1A 4ETIA 4TV8A 4UVIA 3QI2A 3RV3A 4JLUA 1Z7WA 4M0KA 5CPBA 2RKBA 1V2GA 1NJ2A 2MSNA 4AS3A 1N1DA 4LJYA 4N8SA 2BGLA 1O89A 1W36B 1R9MA 4A2PA 2QN6A 4KNYA 5B64A 1GSHA 1O94C 1SVKA 1DUVG 4NV1A 1IHDA 2P7HA 4KE9A 4ZU6X 1QH0A 3TKAA 5C9ZA 3PR1A 4EFMA 3EUFA 4DLYA 1Y1LA 1Y81A 3DLAA 4PTLA 3Q7RA 2CJWB 3SF8B 2WIKA 2Z4SA 2V7QD 4BN4A 4G89A 1SWVA 3FJYA 4FGZA 2GDJA 5JYEA 1F6WA 2FW6A 3RIYA 4ZICA 1SO8A 2C2YA 2OCPA 3R5XA 3OKFA 4Q3NA 3VTZA 4H6WA 1WPRA 2JFBA 3D59A 5DHAA 4XEUA 2NXNA 1R74A 1M6VA 1IN5A 2FEXA 2YS7A 3DS8A 4QHSA 1YS9A 2WE7A 3CH5A 5DSTA 4BJHB 4UM9B 4FMBB 2R6CA 3MBKA 4CV0A 1SZDA 4MCAA 2VXCA 2ZPUA 2BFDB 2ETXA 4IGAA 2EXXA 1EFCA 2PAFA 1MA0A 1JHYA 3QTTA 2Q1UA 3JPYA 1R00A 1B3BA 2YBDA 5JCOA 5I7FA 2FDXA 1IBLB 5H8WA 1M33A 5EJ8A 1ZL2A 2RAFA 2OXFA 5MGBA 1Z5WA 2QLLA 4OK5A 4A15A 3IHWA 3CVXA 2M2IA 1PZMA 2OPBA 1NW5A 3MCWA 3ZZUA 4AF7A 2ID4A 1Z45A 3TI9A 4UAGA 4DQVA 3EYAA 1XCBA 3H2IA 1LPNA 2V0NA 1FDTA 1T0IA 2XR1A 4UCWA 3UK0A 2HDHA 5IKXA 2Y1XA 1H23A 4DCVA 2W2TA 4FDAA 1PVDA 3LSYA 3EG5A 2PMDA 2PVPA 4OQXA 4TTJA 4WA8A 1Q1AA 4YGXB 4A0FA 4P2BA 4PCLA 1EZ1A 3CS3A 2XHZA 3BH0A 3QP9A 3A26A 2RHGB 5FBKA 4ISBA 4PRKA 2YFYA 4XD7D 4MO9A 3RWMB 2PSJA 1WF6A 2AL7A 3I2IA 3NEJA 4E2ZA 3LA6A 5KYXA 1AA6A 4EGCB 1M2JA 4EM6A 3I34X 3L4EA 5G0UA 3VR4D 4EG6A 1I7SB 5JSHA 3WO0A 5KQPA 2QL5A 3R9XA 2JB9A 2Q5JA 1LBHA 3HRIA 3K9QO 3OEEA 1ZM9A 1S4MA 1Q7TA 5T4EA 1F2TA 4QGAA 3PUZA 4IIXA 2ZTVA 4B7AA 4X64B 3V1TC 1G8JA 1K9VF 4G6ZA 4NCBA 1N0VC 1TOAA 2DFTA 4M46A 2Z8ZA 1MQ9A 2Y1FA 1VHJA 3TPFA 2E1PA 1G9XA 2HMYB 2HXGA 2P6UA 3LXUX 1D2AA 1ZI6A 3IDOA 3DBIA 3OE4A 1GAJA 5K3FA 3WDKA 4LF5B 3WIUA 1ZGJA 3SI7A 2RHWA 3CO5A 3UUGA 3LP6A 1QH8A 2QAIA 3ZI7A 1C9NA 1A7KA 2X8WA 3HKBB 2QMOA 1P8AA 1G5IA 4IX1A 3JQ8B 3M3DA 1GCUA 3COVA 1KE1A 4G25A 2G80A 1XRSB 4RY9A 4EECA 3C43A 3LH5A 4ALJA 3FVQA 3COYA 4KUGA 3WYAA 1JECA 3H5WA 3TGPA 5KO2A 4OHMA 1CR2A 3KRTA 4DN6A 5IK2D 3PITA 4GT1A 1SRRA 1UXJA 3WIOA 3T3EA 5JAMA 1CUWA 3C2QA 2IS1A 3EXHA 2HWUA 2XEXA 4DAOA 4S05A 4LE1A 2HMSA 2IS4A 1QF9A 4KR7A 1XCMA 3FSJX 3ZJTA 4FLFA 3TR0A 2Z8XA 4DLNA 2HA3A 5JUWA 5CK5A 2AR9A 2YIVX 3K70D 2OORA 1XZLA 4FNMA 1LEHA 4BWYA 1UOPA 2VAWA 4HGZA 1P8JA 1W36C 1NKVA 3D2CA 5EJAA 3HXKA 2ZTMA 1QHNA 4FI3C 5G41A 4YT8A 3GLFA 2JC3A 4FC6A 3U19A 2H1WA 4ZOCA 4JVMA 4BPRA 2GBPA 1PU2A 1MC5A 2AFHB 1P0FA 2GASA 2I7XA 2YWRA 3AFGA 3CWZA 4O2LA 1X70A 5D5HA 1DQZA 5HYVA 4C6RA 3H7AA 3SYNA 2F1KA 2VTVA 1E5VA 2JFWA 3FKSD 4L9SA 4DC0A 1PV4A 2AN9A 4MVJD 3L8MA 1GM5A 1DX4A 1VLLA 4UM7A 3B78A 4OQMA 2HAEA 1IY9A 3K0FB 4PF1A 4B2IA 3OTWA 3WZ2A 5D84A 2XRYA 3GUUA 3HHPA 5JPCA 1YJAA 4P1ZA 1CRZA 5EKSA 1A9PA 4FGUA 5H1YA 3WBJA 1RC1A 5FH9A 5A7FA 5GQSA 1V7ZA 4JYBA 1F2DA 4YPFA 1J7JA 3P5SA 4UFOA 3W8DA 2PZ8A 1NI4A 5AVQA 4KI7A 4DNFA 3ORSA 2Z57A 3PJEA 3Q2KA 1L4KA 1HEUA 3D4OA 4UREA 4NY1A 4KFCA 1EESA 2D2IA 2QRNA 4XRRA 5T7BA 1JJFA 1A7AA 1I10A 2BV3A 3DVAB 1P9RA 1NSYA 1OWMA 2BF7A 2Y2UA 3GCDA 3H1EA 3H9GA 3I9FA 3QITA 3V8VA 5MN6A 2WTBA 1OXBB 4RJIA 4WN3A 4WI1A 4KR3A 4MSUA 1UJ6A 3H1GA 5EYPB 5KQMA 2ARKA 1X7ZA 5BMOA 1ZN9A 3AU8A 1C1HA 1ZK4A 3A58B 2YDXA 4FIDA 2PVCA 4QLOA 3V2UA 1PP4A 1J1IA 1TZBA 1TUBA 3V80A 4C04A 5B58C 5HUHA 5KMGB 3KYDA 4ID3A 3SC2A 4DMCA 2HHHB 2NYRA 2AMLA 2P0EA 3O4GA 2HYIC 2XOEA 4CEJA 2PXHA 3VR5D 1RLJA 1P18A 4UDYX 3CMCO 3WYEA 2REXB 3H1FA 3O8BA 2F1RA 3PUYA 4MWZA 2QT1A 2OLJA 1M1NB 3GC6A 4RK1A 3SXJA 2P4QA 1JEQB 3H17A 1JXQA 1C3JA 1BHSA 3E4CA 3UANA 2XUZA 3FNHA 5BT8A 3G2HA 5J5VA 1ZNQO 4D41A 2P9TA 3VPDA 4M98A 1JAYA 1N8SA 2O2XA 2P41A 2YNMA 5JVDB 3UT5A 2H9YA 1YULA 1QG4A 2VA8A 3KP1A 4MXDA 5AK0A 1RI1A 4ENVA 2IYNA 4GM4A 2GXUA 4IRMA 2OFOA 1I3CA 3WAGA 1AKNA 1XZPA 5ES3A 1WIWA 1QCCA 2JGJA 1B14A 1UBUS 2OUIA 4AK9A 3FZNA 1VSTA 3FPLA 5FUWA 4MROA 4NSNA 1W88B 2XQGA 1JQDA 2H48A 3ELYA 1VHDA 5LDGA 2C0PA 4YASA 5JD3A 4LJSA 3EEQA 4L22A 4DLZA 3ZWNA 1C7RA 2DFDA 2BTEA 2VUTA 4K7JA 5KOJA 3A1NA 4KACA 1EUQA 1T1IA 2GEUA 1O95A 2AEFA 3RW9A 1QLJA 1GZ4A 4IDAA 4RA9A 3VTKA 1N57A 3MTDA 1VMKA 3A6HA 3PRKE 5AI6A 4QDTA 2C83A 3GH1A 4DGQA 4L8LA 1TEXA 5DM60 2W2KA 1RYYA 2RARA 3WMFA 1N5RA 3DLHA 2R65A 1VBFA 3PTZA 1IEWA 1KI4A 1NN0A 2H1RA 2H31A 3FGZA 5ITZA 4NMHA 3GGJA 2FZLA 4B4KA 1N2CB 1THTA 4AZ3A 2CV2A 2O5EA 2F67A 2Q5CA 3I05A 3INNA 5A4KA 1ILEA 1ICEA 5LMNB 5IVHA 3RFTA 4LK3A 3MUNA 1MABA 2J45A 4WK6A 7ABPA 1PR5A 1WSAA 4JLKA 5DNVA 3WLEA 4KMMA 3UB3A 5EN4A 5JSFA 2JIDA 3HEAA 3INYA 3C6QA 3OE7A 3DHYA 3Q9UA 3U81A 4D45A 4BY9E 1FLNA 3OCCA 3C45A 3ZWVA 1FMLA 1XZGA 3FRHA 3R0XA 3C41J 2H0RA 3DFIA 4KHZA 5DWQA 1YDHA 4DLTA 1T0BA 3LUHA 1KYTA 4CPDA 4NBRA 3NPMA 2FN9A 1NJGA 2MJLA 4KEAA 3KQUA 4KRFA 4B6SA 3E2IA 1FA9A 1Z5ZA 1Q84A 1C3OA 1WQ4A 3N3AC 2MSEB 4YJ3A 4CHTA 4E2WA 2JG3A 1L5HA 3WBFA 1FFCA 1TC2A 3D3JA 4G9BA 2NO6A 2XDQB 2WAYA 1GT91 3NKFA 1BE1A 4EPTA 4O2AF 2V9ZA 2RGAA 5GP1A 3SBEA 2YYAA 1T9BA 3WLHA 1JQKA 1IONA 1S8OA 5E7MA 1A04A 5F1OA 3KYJB 3WLSA 1KMQA 4JUIA 3GRPA 5LU8A 3EEFA 3QU7A 3QVLA 3I4CA 3VR5A 4FM9A 5GJBA 4IGEA 1IXSB 3FHTA 5EIHA 1YZYA 3E61A 3FE2A 4II2A 3OESA 3PEYA 4L85A 1X3LA 4HNTA 2UXCB 3CVOA 1FU4A 4EFLA 1PFYA 2AFRA 2NADA 3O91A 1O4VA 1UDAA 1XLWA 3A6DA 4FEYA 2OP1A 2PSDA 2Q8PA 4BO7A 1LZKA 3CNHA 1EAYA 1LQUA 1XI2A 1PTJA 1U7ZA 2GCOA 1ZRNA 3BWYA 4FQ5A 4N0EA 4X63A 2QRUA 1PYOA 5A62A 5I9IA 5E95A 2VPXA 5JQGA 3BRCA 3WWOA 5GZ3A 1PHPA 3K7EA 3VVLA 5AW4A 5KYTA 4AJPA 3N9IA 1YHYA 4LJLA 1GDDA 4GX1A 1AGXA 5E3JA 3WG9A 2C7PA 3CX4A 1UOOA 8ATCA 1KMHA 3EZNA 1U7PA 1U7TA 2OQRA 4MWGA 4RIFA 3ZWWA 5KSOA 4IS2A 3J81A 2B9VA 2HCFA 3R0ZA 3RU3A 3GPBA 1XJWA 4RSMA 4MUAA 3GJ6A 1DLIA 3FROA 4KYTA 4QYIB 3TL2A 1T2EA 2PUTA 1ZD5A 1UFRA 2WJWA 1SB8A 1HQKA 4I5DA 2QSYA 3EEYA 2IHBA 4D02A 5BOSB 2QM8A 2PMCA 1Q7EA 4BAZA 2I76A 1UAAA 5F1YA 3T0GA 4BO4A 1CLUA 1JFFA 1RBYA 2E6KA 1Z5NA 2VRWA 1RNLA 4DIEA 3RSCA 4Y6LA 4GIBA 3IT2A 5HOEA 4MVJF 2CLSA 3H2HA 3H7IA 2ODTX 2FN7A 3IURA 3KKZA 3FYHA 1NJFA 2GRJA 4X00A 5LYJA 1QMGA 1JNYA 1D4ZA 5MN5A 4UXIA 5CHYA 5FUQA 4BMNA 1SIBE 4ZDWA 3WGMA 1XDUA 3D3KA 4KH1A 3T52A 5EUCA 4IMJB 4Q5IA 3IKVA 5CG2A 1E0JA 1SFRA 4L50A 5TX7A 5DEOA 4BWGA 4RTPA 5SYNA 2GA8A 3RSQA 3WLTA 2BHNA 1XMVA 5GVRA 4JL5A 1F4LA 1A8HA 2O1SA 1RKVA 2OZLB 2V7BA 1QHGA 3JQBA 1NVKA 4TWJA 3V6LA 1VRVA 1QUFA 3IPLA 4LPSA 3SVTA 5HZHA 1A77A 3SQDA 4YMTA 2AIRA 4P34A 3OE1A 5TF4A 5K8UA 1FQWA 2AXNA 1X80A 2P5YA 3H1BA 3KXKA 3MAAC 4GOJA 4F3YA 2X86A 1CDZA 4BO3A 3CRNA 3OIVA 3NDBB 5FBZA 1O87A 3GGDA 4X6UA 4JNCA 4ZTZB 1LK5A 3RJMA 4F4CA 3QXSA 4X1YA 5FJJA 3HJAA 3A3KA 3CB2A 4IICA 3WKEA 2ZUDA 4HRVA 4CKYA 3AF2A 5LIPA 3H5NA 4HY3A 5GJVC 2YWDA 1SD1A 1UC8A 3QEMA 4KBFA 1NVEA 5IKOA 1HMPA 2PZAA 2R1VA 1BMQA 3RKSA 3LA8A 1GEGA 2C5GA 3MTJA 3N8DA 3PYXA 4JSRA 4MPDA 4CFYA 2JVJA 4DEYA 3ESYA 5KX5A 3MIIA 1M2NA 1E96A 3LL7A 1XNQB 2G9RA 3G8AA 1NV8A 1V8OA 2PRKA 3FDZB 1KYIA 3M49A 1M1YB 4ITUA 4QSHA 4GWKA 1IM2A 1N1MA 2NZXA 2R9VA 2QRQA 5SYMA 1ST2A 1Y7LA 4I5EA 3TG2A 3ZBPA 3T1HB 1YZ3A 1BS2A 3OG9A 4KSBA 1Y3CE 1GPMA 1NUHA 3LBIA 4HI0E 5EJFA 2AC4A 4HSGA 2PNJA 3CE6A 4AFNA 3WA7A 5AKGA 2GEFA 3ABOB 4S1NA 1ZESA 1P45A 1Q12A 4ILKA 5JDCC 3TZ6A 3CW9A 4UE3S 3IPRA 3Q3HA 1DEHA 2X6RA 1NJ6A 4M22A 4RGYA 3GN1A 3R3HA 3SX2A 3SZLA 4PRZA 4UDXX 4P7BA 3E05A 3WK5A 4EKNB 1RPTA 1HMYA 2BHSA 4M9ZA 3MJRA 2RHJA 4N6GA 1PR1A 1XWIA 2BFMA 1NHGA 1XJQA 2FW1A 2JGKA 3BXPA 4OM8A 1HFWA 2Y6VA 4CRWB 2M6KA 4JI2B 2C9OA 1KY3A 4KCGA 2MCFA 5AVUA 1FZTA 4E1VA 4MKXA 3W2EA 1TCUA 4OHUA 1AQUA 3IUJA 4G0NA 4CKBA 5IJ9A 2EQAA 3B70A 3FG9A 1L5KA 1UKBA 2YJNA 3BILA 1JV2B 2JAUA 3FYSA 3M7IA 5EUBA 4U7DA 3OP4A 4HR7A 2XZPA 1EWQA 3TW0A 3CVYA 3F6SA 3M89A 4L4ZA 1VIYA 1EJBA 3D1VA 3K6RA 4O4JF 4RY2A 3NT5A 4MAMA 5GJWC 2QTVB 1RPAA 1X6VA 5ALEA 4EFKA 2R0QC 2R6HA 3ZOZA 1BWQA 3A70A 3C8UA 3OLZA 3UA3A 1GP2A 2ZJOA 2P2ZA 3OFKA 4TTVA 3ICPA 4ZGGA 5L4LA 1N8TA 5CR9A 1LTHR 4UFPA 3BGVA 4C06A 1G4UR 4LF8B 1P73A 4YJHA 4NYIR 3WWZA 2V0CA 3NVAA 3GNSA 1EFVA 1U2GA 1RAEA 2PBZA 3ZLTA 1C30A 2HJVA 3CUKA 1I3OA 4GYYA 2GQ0A 5BWCA 1DC6A 4QEKA 1RJWA 3G5AA 4MPPA 4MJXA 4LHWA 3REGA 3NEYA 2ZJ6A 4A23A 2J3EA 2HF9A 3PT5A 3L93A 4JT4A 4AP6A 1OXUA 2V03A 3D6JA 2LUOA 5J2UB 3HJUA 1VSBA 3OICA 3AMVA 4O4LB 3CR3C 2YCLA 2CVZA 1S2DA 1VKZA 4O2BF 4YI3A 2P5UA 4B8YA 5KOHA 2HJ9A 1VP3A 2AG0A 1GQ2A 2CZGA 4CMIB 3ABIA 1BE6A 3UXYA 4C20A 3PUJA 2ZUVA 1CRLA 3F5DA 1QC5A 5B1SA 3VPBA 3FGNA 3OZIA 3R0VA 1QV9A 2O6HA 3BX1A 4AT1A 1Q1GA 4NONA 4D3XA 1Q1NA 1XA0A 2WJPA 4WX2B 3DKPA 4D80A 1JXOA 4BWFB 1NNI1 4YVFA 4FNGA 5FI3A 1C8LA 3SF8A 2X23A 5EJ5A 5ICEA 1ID8A 1SQGA 3L0BA 4QOEA 5BSTA 4J9UE 1S8FA 1Y9ZA 1SUAA 2VHVA 3ML1A 4JN6B 2YWCA 4FHGA 3A9RA 3N1UA 5HRCA 2DXIA 2ZI9A 4JNKA 1P44A 1N1EA 3EAQA 2J0VA 4WACA 1ECFA 4C30A 3FSEA 3NX4A 3GW8A 4PX9A 1ZCFA 2O8NA 3O73A 1U8AA 4M9UA 4PU0A 2GSWA 1H5QA 2XW6A 4KX3A 4BASA 5B6IA 2HA2A 1RADA 3HWWA 2EDAA 1SXQA 5DXAA 1LLDA 2R87A 2I33A 4ENSA 1JHZA 3STTA 3A9TA 3ER6A 3HFSA 3LQQA 1WV0A 4Q7EA 3GP8A 4KRGA 3PHCA 4C6TA 3K0EA 5AXCA 2P7IA 3DMDA 1L5WA 3TSWA 1QG6A 1HZJA 2NZYA 1JPVA 1OC2A 3OT5A 5BSHA 3IC5A 4B73A 1D2CA 1UL1X 2G5PA 2PFKA 1RYNA 3DXZA 3UICA 1JAHA 2C2BA 2G5CA 3NGLA 3PI7A 3INRA 2ZSIA 3FXAA 3KZKA 4JCOA 4JZYA 2BC9A 4XOIA 3D6NB 1ZRHA 5EG5A 3KAKA 3P94A 2C5HA 2W2KB 3VGPA 4RV5A 5CBPA 4GWLA 3Q3CA 4R41A 1MJHA 2G4VA 3MBIA 1OZ0A 1YFJA 2DHDA 2QRLA 2WF7A 4BECA 4IY1A 1H1LB 1CE8A 1QH9A 1IVNA 5CAEB 4XUDA 3TAXA 3UGKA 1NYRA 2ST1A 2NGRA 3LBHA 1HF3A 1SC1A 4HGQA 3O92A 2JJ8A 5KX5B 1F60A 3ASUA 3QY9A 5LZ4A 1J25A 1MX9A 3F5QA 2D7JA 3P2IA 1Q83A 1U4NA 3E27A 3OPMA 2R8OA 2KSQA 3VX3A 3VSAA 4BVJA 4DIBA 3CONA 1Z8FA 5J4KA 3ADPA 3U09A 2AN5A 3TK1A 1YKFA 4HXGA 1FLDA 3BFKA 4OHZA 2DHCA 4TS3A 4DOMA 2A3NA 2FDRA 1YR2A 2HDOA 3HJTA 4BQFA 5ALOA 4F3RA 4ZZIA 3LX5A 3ZLVA 3IIEA 1AJEA 5KMGA 3CC8A 2IEGA 4GWGA 3I2GA 5HRAA 4N48A 1TJPB 2GBCA 4QD3A 5DP2A 3UWPA 3RU2A 1YBMA 2DVMA 3MD9A 3UMBA 3VAAA 4G0VA 1JDUA 5A1TA 3DZBA 1TL7C 1PIWA 1SBQA 2YWFA 4UC0A 1YNOA 2IA5A 2BEVB 2HM7A 2Z30A 3GMTA 3EAFA 5IANA 3LUFA 2P5TB 3OFSA 1GL7A 3HV0A 4FYJA 4XGRA 2WT9A 4W5HA 3LRPA 2FP3A 2QD1A 2EARA 2HN9A 5JJIA 2ZJ2A 4EGJA 5ULLA 4K6OA 4XWAA 2DUUA 3VKWA 2O8FB 2IU6A 4MWCA 4LZNA 4QWWA 4E14A 4JFRA 5AOAA 3ZHTA 9LDBA 4A6EA 4G4SO 1G7CA 4R2MA 4E15A 4EO9A 4IJMA 2IXGA 2PGLA 2VVTA 3EQZA 4KXUA 4MLDA 3ZWPA 5LJLA 4UAUA 5HKOA 3FCCA 4NZPA 1N8KA 3R4VA 2F3RA 2J1LA 3SHTA 3HWX1 3WO1A 2X3YA 2YUTA 4JK3A 3BSYA 4C4PA 5DHPA 1GCGA 1F2UA 4JBYA 4DBLE 4D96A 2Y0DA 2L2QA 3D7LA 1HORA 3NHWA 4MS4B 3S6JA 4PZUA 1G21E 2EVWX 4ZQCB 2V7VA 1QE3A 3DXXA 4TMWA 2KJQA 2CNWA 1NLZA 3FVVA 3GI1A 3QQPA 4HDCA 5LLTA 1D6MA 1TQHA 2JAQA 3WXBA 5JQWA 2W2PA 4Q3DA 4B7ZA 3CLHA 5E7JA 2JI4A 3GIDA 1LF0A 3HDTA 4J0JA 1TGVA 4JBXA 3HJRA 2WSIA 3R09A 3GRKA 3CSUA 4OQNA 1THGA 1D2MA 2UYYA 1KOLA 4QEDA 2BEUA 2B8TA 2AG5A 4EBBA 2XMBA 2ZJFA 2IKQA 3IH5A 3TUZC 3LWZA 4H7DA 3AT1A 1IULA 2AC2A 3BFJA 3GFBA 4J4HA 1V5IA 4N82A 4X1IA 3TXAA 1U81A 4X45A 4DR3B 4B3MB 1NHWA 3SEAA 3DVSX 1OI3A 2O5RA 3EZFA 1AX9A 1WB9A 3HU1A 2JAOA 2BJHA 3H5LA 2HHCA 3OJXA 4HNHA 2JFHA 4DV0B 1T2NA 4ITVA 2K2QB 3U9SA 5JRZA 2GAFA 4HJXA 5DDIP 3TD6A 1GZ5A 4BLUA 3MS4A 4ETNA 1GR0A 3A27A 5DMHA 3M5DA 4HN4B 2OZLA 5HF6A 2Z4RA 1O6FA 4QLBA 2H4FA 1E1RD 1G55A 3SQWA 1KIMA 1XCLA 4DWVA 4GO1A 4NU5A 3F2IA 3M3HA 3ZVLA 2YV5A 2JA1A 1R5NA 1S2OA 3C1TA 3FBTA 4XARA 1R0ZA 1M8FA 4H7KA 2V8OA 1YUNA 3GDGA 1P75A 4TKUB 1F9EA 2W4MA 3PUKA 2C8LA 2C7VA 2P9JA 5FXMA 1CUZA 1LC0A 4BRWA 3AR4A 1X1CA 4ZCIA 1YB6A 4BZWA 2BFFB 2XNDD 3CLSC 2HSGA 2IPMA 1QPZA 4II3A 4AUMA 1CRPA 4QDJA 4CCSA 5BNFA 1GPJA 1T2FA 2VEOA 2MU1A 1E7QA 3AV0B 4P7KA 1XELA 4AY3A 4EFNA 4BMZA 2O50A 4LI3X 2ZTHA 1CUYA 1N7JA 2Z9BA 4KV7A 4EG7A 5LNK6 3UATA 3ZCSA 1RRVA 1T2DA 1XQXA 4F2WA 1W1UA 3DBRB 3DWFA 3ASVA 4N4AA 5HGJA 3VYTB 4CKEA 1EUDA 5C8VA 5C8YA 4A26A 3IQGX 4QLAA 3V00A 1HZZA 3I2FA 4ZAXA 4V0LA 5HS6A 2AEMA 4K2HA 3LCJA 3IALA 4UDOA 4ZDIA 3T3HA 4HYTA 1Z25A 1N6IA 2WMNB 2QTAA 4J16C 2NO1A 4GI5A 2PXAA 1ZC4A 3BWCA 2C4VA 4ARAA 3AP2A 2J0QA 1L8XA 4M0PA 1EA5A 2PLNA 4G84A 1G5TA 3IMEA 3JVDA 3PUVA 4XTRA 5AHRA 3ZUPA 4AWXA 1AD2A 1YJQA 1CSEE 4HDOB 2DUNA 1E1MA 2QJRA 2W22A 4Q02A 4ZEWA 4WBNA 1N2GA 4FR5A 5DCLA 4EJFA 2X0RA 2RBKA 4RK0A 2FF7A 4X93A 1FE8A 1ABEA 4B2LA 3IUBA 4X6XA 1IY1A 3OOHA 2ET6A 3IQXA 3HB4X 1SUBA 3CN7A 4ZI7F 1PFGA 1G5RA 2Z2YA 1DO8A 1U94A 2ZQ5A 1E9EA 3IJ5A 3N2KA 3A04A 4K03A 2IEDA 4F6LA 4G1FA 5DIZA 1VOTA 4B82A 2AFIB 1E4EA 2ZI4A 3AJ9A 2R11A 1ZH8A 2QG4A 4I36A 3GZNB 1M6WA 2J5RA 2Q3CA 5DYWA 2OEPA 1JDZA 2NVBA 4BTEA 1O94D 2ZAOA 4M37A 3HCNA 3N2EA 3AGPA 2ZK7A 3MERA 5AOVA 5MN4A 1AZWA 2N3ZA 3X2EA 2Z6UA 5JO9A 2YFHA 4R31A 5IH7A 4I5GA 4UMDA 4UEJA 3KE9A 1V6SA 5JRJA 1K7YA 3GZ4A 5ITWA 3JQAA 1QO9A 2KW5A 3OPYA 4MGIR 3H6KA 4ER5A 1V9CA 1G64A 2H5IA 2QS9A 3IUPA 1H42A 1C4KA 4QFBA 4URYR 1ODFA 1PR2A 3VUEA 1CZOA 2RK6A 2WJGA 3FTCA 3A37A 2JS7A 4A9AA 5JCZA 1PK7A 2ZJYA 4PO3X 3ZLBA 1NIJA 2QX9A 3AFIA 3LECA 4K9PA 5AW2A 2D4AA 2JHPA 3VZPA 4HAYA 3UZUA 2ZANA 3ODPA 2H29A 5I9SA 3R7FA 4AJOA 4CQMA 4JVNA 4LV6A 3LTEA 2P6OA 5JD5A 1PJ2A 4FCWA 4Z4GA 1T6YA 2XB2A 3B1KA 1FMCA 4JBWA 3TMYA 4GX2A 1THZA 5BQOA 3DOOA 1AK1A 3U7FB 3FHOA 5DTIA 2C92A 5GM1A 5LOVB 1ZQ9A 3F6PA 1L7QA 3QGMA 1YO6A 1RI2A 2IEAA 4PAMA 4TLCA 4WBSA 4D43A 4IEFB 5LXTA 1JG4A 1RLIA 1VB5A 4MYCA 1SVUA 2A9RA 3FDZA 4IJQA 3FJOA 1JBKA 2WVJA 1E3WB 3ESBA 1XTBA 4ZPJA 4CF5A 4QJ5A 2JD1A 5I3CA 2F17A 4HUJA 3WQQA 1I51A 4EHFA 2G06A 2X6QA 3RUEA 4ER6A 4EVQA 1CQWA 3TLCA 1W0JD 3IP8A 4ZARA 4ZK6A 3LO5A 1PFKA 2QUJA 2PX8A 1PT8A 1HA3A 4QGFA 5HBGA 3V4PB 3WJ2A 3EGCA 2K5UA 1QFYA 4PTZA 3OPNA 3WGHA 3ANLA 1Q0ZA 5DYTA 3OURA 4LHVA 4OHKA 3FDJA 4YRDA 3S70A 2I9KA 1AS0A 2QVBA 4URHA 3HG7A 5IH3A 2C2OA 3RVKA 4DDUA 4G0UA 3ICQB 1GTZA 2JFZA 4PLYA 1HT3A 4AUEA 3RODA 3C8ZA 1Z12A 2ZWAA 3JVUA 3GCZA 3TE7A 2Q5EA 3UBTA 1OWNA 4YUVA 2A58A 4B3SB 3F3KA 4B76A 2YN4A 1NQTA 5IW8A 3UMRA 3R75A 5GIOE 1FFXB 4LE2A 2WTMA 1JLSA 2NPOA 2VPQA 3CPHA 3ETCA 1XJ5A 1YS4A 2W6JA 2ZPAA 4G4GA 1U8TA 3N76A 1TUEA 1ZAYA 4NNPA 5DJ5A 2ZOSA 2C8KA 1YIOA 2YXDA 4ZAZA 1Z8DA 2HFKA 1N0WA 3PGA1 1QGZA 1TM3E 2OCDA 3LQ2A 4Q19A 4MW7A 4PY2A 4ZVOA 4C76A 1WAMA 1F8FA 4EMUA 1ADBA 1HWYA 1UM9B 3RSGA 1T36B 4V24A 1WUHS 1A1VA 2FRVA 3PE4A 3W5UA 1G9TA 1NPTO 1VFNA 2QZZA 3DKVA 4TV8F 4NS1A 3LGSA 2HLPA 3BJMA 3SQLA 1LZLA 1W52X 2YMPA 4AO8A 4W9NA 5FL7A 1DWQA 4QUAA 4BO9A 4H3HB 4D79A 4YRKA 1HDYA 4A3SA 3JQ6A 3KYDB 2IZ0A 2HU5A 4QJ4A 5SICE 2YICA 4DLKA 1DC4A 1ESMA 1TCBA 4US1R 3WL3A 3USZA 3H0KA 2WD8A 4KBGA 3PGMA 3GY0A 3HKDA 2H63A 4O5AA 3ITDA 4RLSA 3W7BA 1Z83A 2RH4A 4K1LA 3VOBA 5BSGA 1VHTA 2PSSA 2WM2A 4NFHA 2IIVA 1OLSB 5I9BA 1IXKA 2PD4A 1ANKA 4RFSB 3VHLB 1ZN8A 5DP1A 4YO7A 2FB9A 5EHQA 4UEQA 4ZVRA 5J2TB 2IRWA 1ZS9A 5AJHA 2AQKA 5IK2A 1EXDA 4JC4A 3UC5A 4LNAA 2JLBA 2PN1A 3LZCA 2XD4A 2YVUA 5DWVA 2JLRA 4QHTA 3SJBA 2ZFUA 4KGXA 4R7ZA 2JBAB 4WOKA 5DE3A 5EFZA 3ORQA 1HQYE 1R88A 4RAQA 4ZTUB 3PIIA 1GIAA 4JS0A 3JTMA 2AQHA 3K92A 5I3ZA 1CR4A 4GYWA 5IKMA 4KLZA 4LHYA 3SMQA 1GA1A 3NYWA 1ZJ4A 4FEEA 4ROSA 1OKKD 2KLBA 4LUCA 1IM8A 3G2QA 4Z2YA 3ZE0B 1YR3A 3GJ4A 4X1KA 4TV9F 5COAA 5ECYA 1RYZA 3HDYA 4ZYVA 5CNMA 1X7WA 2FQ1A 4JBHA 5JMPA 5HKLA 4PYNA 3UF0A 1JTEA 2UZ0A 1G3IA 1W49A 4Y9RA 5HM8A 3AIKA 2BUBA 1ZXLA 2FJ0A 1QOZA 3F6RA 3AUAA 2QR2A 2B92A 2GD2A 4DIDA 4GQAA 3ZK8A 2FLWA 1RVV1 3FNGA 1Z4LA 4MR9B 3V2HA 4U0JA 4WT7A 3OX3A 4UBKA 3ZOKA 4BCCA 1AQIA 4GXTA 4D0LB 3I62A 3D3QA 1PDOA 1T10A 1C5KA 3CKKA 2ZVJA 4I9UA 3R9WA 4TN1A 2GZDA 2G70A 3BWVA 3KU4A 1YJCA 2X8AA 4KRYA 4QXAA 3S3TA 3VAZA 1NXPA 3R76A 2PCLA 1JB1A 2MR5A 1UBEA 2W5UA 2ZUUA 1CUVA 4MS4A 5KYUB 3F9IA 1YTLA 4O8CA 4RPJA 1A76A 2OGSA 3T12A 1ZHFA 2IXFA 5HE8A 1J9ZA 1N3YA 3FCAA 5CXSA 3RF6A 2P3QA 3TQFA 4ZDJA 3T06B 2J59A 3G0BA 2DH5A 2DCUA 5IM4F 1JTVA 3H5OA 3BMNB 3W5DA 3KUKA 1H1LA 3ONEA 1ONOA 1KSHA 4YONB 1XPJA 4QPJC 5EXTA 4NJOA 5KU1A 2GPBA 5FA6A 1SKUA 4ND8B 1SHZA 2IK8A 3K4PA 4XASA 2GEBA 3VU9B 1PTJC 1QK5A 5FKJA 1MKYA 3ELDA 3MWJA 3RVJA 5DW3A 2EYQA 2IXEA 2D1SA 2OO7A 3BCHA 4PRYA 3B1XA 3UMVA 4ERNA 1H8HD 1UJ4A 3X1WA 1ZGHA 4QARA 4ZVSA 2GHIA 1MRZA 2C9BA 1N9GA 4O4HA 1UBMS 4TYMA 3ZCPA 4B84A 4DXAA 4ZQHA 1PCXA 1LU9A 3DMNA 4NJMA 3B2NA 1FX0B 4ZRDA 3OCYA 4TYWA 4D9MA 4MUIA 1XTKA 3DBHA 4BFTA 5CM8B 1C7FA 3WNDA 4G86A 2FFAA 5IT5A 2OA0A 1V3QE 5CLQA 3BAZA 1P62B 2B0JA 1RTKA 3EWSA 3BGSA 4G63A 4ZCPA 5H0IA 3WKAA 1MO2A 2X5JO 4MV1A 3WL8A 1E6MA 1Y6ZA 3D1JA 1R0WA 1HNXB 1N33B 3I5XA 2PUVA 3ETGA 4ONEA 2GF0A 2XUPA 3F8TA 4BQRA 2DFNA 4FGJA 3L7JA 4PICA 3NNSA 1P74A 4PONA 1T1GA 3BK7A 3LY5A 4KK4A 3KJNA 5LJIA 1SA0A 1ICIA 1ZLYA 4QTXA 1JG3A 2XKJE 2IVZA 4L51A 3K1AB 4B4WA 1L7NA 4TTAA 2GTPA 1EU1A 2I6TA 2WIFA 4ZVMA 5C5CA 4JB0A 4DBZA 3KFLA 4X85A 1BG6A 4A0HA 4BEJA 4KVFA 1XEXB 3THYB 3QQ5A 2QN8A 1M67A 3WDSA 1M1UA 3FTNA 4QO8A 4AJEA 1HNZB 4RAOA 1XDGA 4HDNB 3DZIA 3VSDA 5C46F 2CE7A 4YAUA 1BXGA 1NP6A 1GN8A 3KLBA 2GN9A 3QKSB 4J0DA 4KHPB 1FTGA 4K87A 4AO6A 4H7IA 1YK1A 3FVRA 3ZBTA 1QIEA 4INPA 2DSTA 2ZSKA 2AZDA 4Y9TA 1IAQA 3NWEA 4KH0A 3TRJA 4AWBA 1JSZA 5M3BA 3WRYA 1AZSC 1NTRA 2ZS8A 5K01A 3WIVA 4L75A 3TOZA 1SIUA 3WLJA 1P1IA 1U6IA 4PSAA 4AN1A 4EAAA 5HVNA 3E9YA 1JF8A