3AFMA

Crystal structure of aldose reductase a1-r responsible for alginate metabolism
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
258
structure length
258
Chain Sequence
MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAAKASGQTSAVISTGSIAGHTGGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASGYITGQVLDINGGQYKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase
publication title Molecular identification of unsaturated uronate reductase prerequisite for alginate metabolism in Sphingomonas sp. A1
pubmed doi rcsb
source organism Sphingomonas sp.
molecule tags Oxidoreductase
total genus 97
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.1.1.126: 2-dehydro-3-deoxy-D-gluconate 6-dehydrogenase.
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3afmA00
3OIFA 2O3QA 1DBVO 3WFJA 1DRVA 3KBOA 5CHEA 1WDMA 3A14A 1PJSA 4OO3A 1Z82A 1E5LA 4NFSA 3QVTA 5JW6A 3NX4A 3E18A 2RH8A 4WLOA 4P4NA 2X23A 1LRJA 3I5MA 4ZICA 5KIAA 2X86A 1R6DA 1ONPA 3B20A 3PWZA 1V3VA 3FNHA 1GZ4A 4KUHA 4PG4A 1TLTA 2BFOA 3NT4A 4CM4A 1WW8A 5BNIA 1QORA 4XYGA 3NAQA 2NV6A 2EIHA 1WZIA 2OBYA 3LK7A 1O5IA 3PQDA 3QHAA 4NJMB 4TQGA 4D3SA 4GX5A 4C7JA 4L4XA 3STHA 2AQHA 1ZJYA 1Q7CA 1HF3A 2A4KA 4OKIA 3JV7A 3Q2IA 2AE2A 3C8MA 5TJ9A 3UF0A 3W8DA 1WMBA 2B35A 3I83A 3RASA 3VAZA 1CRWG 1VLLA 3ADPA 3EW7A 5IF3A 3R6DA 3BMQA 4PIVA 4IIVA 3DWFA 5FEUA 1FDTA 3JD4A 1MUUA 4D3FA 1XU7A 3KSDO 1VL6A 1DAOA 1WP4A 1DAPA 4YR9A 3B1FA 3LU1A 1VKOA 3WWZA 2D5CA 3NT2A 1O94A 4A0SA 4CLOA 2CDAA 3EAGA 9LDTA 3D4PA 5COAA 1VC2A 4IXTA 1UP4A 3ENKA 4R1SA 1LSSA 5JDCA 1VJTA 4BNVA 4DBVO 3HADA 5A3JA 1P1KA 3PK0A 2EW2A 4Q3BA 3EHEA 4ONEA 1Y81A 2PGJA 4WLNA 1NQTA 3JYNA 3C1TA 3WYCA 3KV3O 2W2LD 3N58A 4BO4A 1FDSA 3BMNA 1Y7TA 3DBRA 3ZNQA 4RCVA 2AW5A 4LSWA 4GGOA 4BGEA 1U5CA 5L9AA 5JS6A 4RPKA 2OORA 2QZ9A 3MJSA 4GSKA 3HUDA 3IMFA 5DP2A 5HM8A 4HNHA 1Y8QB 3D4OA 5IDQA 4J9UE 3RUFA 2WMDA 3S55A 4WJZA 4OAQA 5EIOA 3H9EO 1KEWA 4AJHA 2C20A 2GR9A 1SPXA 4MVJD 3DBLA 1PJBA 4ALJA 4EITA 5C37A 3ZDFA 2HDHA 4L4RA 2C29D 2VYND 3FWZA 3AI3A 3FPLA 3ICPA 3HQ4O 4WGGA 3SBOA 4PCVA 4WEOA 3ZWBA 2H1SA 5F5LA 2VHXA 4YDRA 1GQ2A 3RIHA 3OQBA 2GF2A 1FK8A 3JYQA 4Y6RA 4KQXA 3WDSA 3DOOA 3F3SA 4IDAA 5JDCC 4K6FA 4BB5A 1BMDA 4HNGA 1IUKA 5IN4A 3LT2A 3C7CB 1ENYA 9LDBA 4FBGA 2WE7A 4O63O 5KJCA 1IZ9A 4W7HA 4R9SA 4IMRA 2PY6A 1R66A 4L73A 3IC5A 3VZQA 1ZK2A 2P9GA 3BTSA 3VDQA 3ZV4A 4CM8A 1YDWA 4RLHA 1O8CA 1UP7A 4BO3A 5J23A 4NQZA 4LGVA 4CMIB 3TWOA 2PGLA 3A28A 2RHCA 4XQGA 2C2YA 5IDYA 1X13A 3WGGA 1JTVA 4GQAA 1LQTA 3I3OA 4Z6KA 4JBHA 2IXBA 3TQHA 1ULSA 3NGXA 3WSWA 5JXWA 1GV1A 1K0UA 2VNAA 1YL7A 2AEJA 4XJSA 5TSDA 5JCXA 4FQ8A 4GX2A 4A2CA 4E5YA 5BQFA 2AQ8A 4FFNA 1PWXA 4CV3A 2DBQA 5A5EA 4AJNA 4XZ3A 1LDEA 1T2DA 4J7UA 1T2AA 4AG3A 3BZUA 3WGIA 3EVNA 3FNFA 1JU9A 2OOSA 4JIGA 4A7PA 2NVUB 3JQFC 3GY0A 1HE3A 3MWEB 3DZFA 3PGXA 1ADBA 4U7WA 2O48X 4JN6B 3IKVA 1JVSA 4EUHA 3P5SA 1YOVB 4CR8A 3V8BA 2FHSA 4GMGA 3EK2A 4A27A 1YL6A 5TNXA 3DHNA 1E3WB 2AEMA 1E0DA 1PJ2A 2P2SA 1ISIA 2IZ0A 2QQ5A 4MVJG 1WNTA 1KYQA 4JLWA 4OMUA 1C0KA 2D0IA 3PIDA 1E1MA 1DC5A 2HK8A 1H6CA 1N9GA 2AQIA 4PG6A 2FPPA 4BMNA 6ADHA 2ZATA 3PRJA 1I3MA 3OJFA 3V1TC 4IDGA 3TN7A 1M66A 1YBVA 3GH3A 4OSOA 5DDIP 1BDMA 4EEZA 3I4FA 3M2PA 3RUIA 4WLVA 2YYYA 2C54A 4TKMA 1Q7GA 1E3IA 3DZBA 4BNXA 3R0IA 3DZKA 3KLPX 2I3GA 3MWDB 4FD3A 1NBOA 1A71A 1GEEA 2VNSA 3MJTA 4RQUA 5EQFA 4IDBA 3NUGA 1DIAA 1HDGO 1PS8A 3A06A 3MOGA 3BHIA 3H7AA 5L95A 3RUAA 3VKUA 1B14A 3LT0A 1E3LA 3PTZA 5DN9A 4RGBA 1DRUA 1PZGA 3GNTA 3PHIA 4YAIA 2FOIA 5C3MA 5DP1A 3QVSA 1WAMA 5G2OA 4XYLA 2CZCA 1UP6A 1NTOA 4H7PA 1PZHA 3GVIA 1GAEO 3BMCB 4CJXA 2J3IA 1RM4A 4BO2A 3ONDA 2I9PA 3L6OO 5MDHA 3B1KA 1MA0A 3DZJA 1M6WA 2Q2VA 4RL6A 3OEYA 1C14A 3SC6A 4A26A 4BQRA 4NU6A 4HWKA 4LSMA 1T26A 3NDIA 4BGIA 1EE9A 2IEBA 4PVDA 3AOEC 2OGUA 3QV1A 5HTOA 4J0FA 4NFYA 3COSA 1Z7BA 3KYCB 3KTDA 2GLXA 4HUJA 4XYMA 3RROA 3PYLA 3GUCA 4YQZA 4TRMA 3L0DA 4LRTB 2O7SA 1G0NA 1K5HA 1XSEA 3JTMA 2EXXA 4PG5A 4DPKA 3RFTA 1E1LA 3IP1A 2GPTA 1EVIA 2HMUA 3AU9A 4X54A 4FGSA 4CM9A 4CLRB 1QYVA 1A5ZA 3RC7A 5JAMA 1ONNA 4XRGA 3GPIA 4BQPA 1PR9A 1NVTA 3PJFA 4TSKA 4YAJA 4BNWA 3MJVA 4GWGA 5B4VA 1W8DA 3OIGA 2Y93A 1PQPA 4XWYA 3H5AA 1DJQA 3ZV6A 3IL2A 4ESOA 2GYYA 4PLGA 4XKJA 4XR4A 1R0SA 3KYDA 4XYBA 2OP0A 3AY3A 4K6CA 2EF1A 1I0ZA 2GN9A 1KY5A 4B3HA 3SLKA 1Y5MA 3GK3A 1J5PA 3NDRA 4W4TA 3PHHA 3GMSA 3TF5A 2P68A 1Q7BA 5U9CA 4D3DA 3GR6A 4W9NC 5CG1A 1NNUA 3GZNB 3JQGB 1NQAO 4XB1A 2WD7B 2BKAA 3TFOA 1ZCJA 1ZEMA 1ZVMA 1UZMA 1ISFA 2Q4BA 2I5PO 3R3JA 3WBBA 1LX6A 4EJMA 3G79A 3ASUA 1B15A 4MO2A 2X5KO 5G0VA 3ZGYA 1Q1NA 1W6UA 1GFSA 1AXGA 1YQXA 1JAXA 3HN2A 4TRJA 4HFJA 1GUYA 5THQA 4Q3AA 2EEZA 3VOSA 3WX0A 4BNZA 1LC3A 1VJ0A 2RAFA 3VTZA 2BI8A 5JLAA 3V2GA 4JJIA 2WWRA 2YFHA 3AOEA 3C7DB 5TGDA 3MEQA 4IJKA 5CP8A 3ZI0A 1LTHR 2X9VA 4Y6PA 1M67A 3UXYA 1I32A 4CQMB 1MGOA 4BMVA 1GYQA 1PWZA 3RBVA 1DFHA 2C7GA 3PWKA 3PHLA 2O4CA 3R3SA 1NVGA 3PHJA 1B7GO 4GL4A 4OM8A 5A5FA 1U7TA 2O4UX 1QYCA 4AFNA 2C59A 3DZHA 2FWMX 3HDYA 2IDZA 1LDNA 2O3TA 2HK9A 4EEXA 2G17A 1FDVA 3GDFA 3L9XA 4PLTA 4MKZA 1OFGA 3CPSA 3W4JA 3M1AA 1Z45A 2X6TA 4FJ2A 1I3NA 5DOZA 1LRLA 5DULA 5B1YA 2NNLD 1E6WA 4KP7A 4BL5A 2CF6A 2DKNA 3D3WA 4RQTA 4D45A 5FF9A 3RJ5A 4K26A 2I67A 1SBYA 4BGVA 1P1IA 4Z0PA 4YTEA 1JKFA 2JD0A 4HFNA 3NTOA 2BH9A 1HLDA 3ZWWA 3RUDA 3FRJA 2JAHA 2VOEA 1P3DA 1P33A 4E3ZA 1DC3A 3ETDA 1I33A 3IIEA 1Y9AA 1UDAA 4GVXA 5IXSA 2YFQA 5KVSA 1YJ8A 4PZEA 3CIFA 4IQ0A 1P31A 3ZCXA 1AE1A 3SVTA 2Y0DA 4NI5A 3GZ4A 4KWHA 1V0JA 3L4BC 4FSHA 4NK5A 3ZN2A 4ALIA 4F3YA 4E0BA 5G0UA 4RVDA 3L6DA 4YJHA 5L51A 4DQVA 3DR3A 4B4WA 1GADO 3ZW8A 2Z95A 4BNKA 3U4HA 2GZ3A 5AQ1A 1DIRA 2GRAA 2PNFA 3DEYX 3SLGA 4WCFB 3ROPA 2I66A 3WJAA 1KVSA 2UUOA 4HXYA 3U62A 1UZNA 3AW9A 5AXDA 3ZU5A 4YJFA 4B3IA 1WDLA 2BGKA 3N74A 3D5TA 4QUKA 4YAEA 5EMHA 1WPQA 3JQEA 3O26A 2V6GA 3TNLA 3OQ1A 4XYEA 4J2OA 3LC2O 1H94A 2DAPA 3KRTA 2NTJA 3I4CA 5H81A 1A7KA 1C3VA 1T2CA 2B4QA 3IDSA 4H15A 4YVFA 5KKCA 1B8PA 3PZBA 1B26A 2HRZA 4HV4A 4U0KA 1IE3A 3LT4A 1T2FA 3QVOA 1ZO8A 5C7IO 5ITVA 5H83A 3RFVA 3AUSA 5AXAA 3TDKA 1Z7EA 3D3WB 3Q6IA 1CQJA 1K6IA 2DTDA 2I76A 5U1PA 2TMDA 1ISMA 2IODA 3AI1A 3JD1A 2VHVA 1CEQA 4OYRA 4EJ6A 2X7HA 1SB9A 2CVZA 4JJFA 5BR7A 4OL9A 2E4AA 4P38A 2HK7A 5GZ3A 3FI9A 4BNGA 3FPCA 2LDBA 4O59O 4U8GA 1MG5A 2OHXA 3DFZA 4GLOA 5B12A 5TJHA 3LC1O 4ZQFA 3ZHYA 4RJTA 1O0SA 3DBVO 5A9SA 1SCUA 3SXPA 2WE8A 4W82A 3UW3A 2Q2WA 3KYDB 1MXHA 2EGHA 4JK3A 1LRKA 4J1QA 1R12A 2EERA 3DC2A 3GVCA 3UUWA 4QFDA 1UH5A 4ZRMA 2Y99A 3RJ9A 1PZFA 3GEGA 1H5QA 3A9WA 4EGFA 1L7DA 5F1PA 3D1LA 3WGHA 3OJOA 2ZQZA 5G4LA 3QE3A 4XRRA 3V2UA 4BKUA 2ILTA 2YV1A 3L4BA 2YV3A 1PJTA 4KMSA 1T1RA 4RF5A 5ENVA 4LMPA 2JD2A 3RWBA 4YT2A 2Y66A 3FF4A 5DBGA 4BO5A 1LDBA 4FJ1A 3OJEA 5EERA 3ITDA 3WIEA 1F17A 4R4JA 2V6BA 2ZB4A 1GL3A 3G49A 4GX1A 1EUZA 1AGNA 2A92A 3HHPA 2FR8A 4MVJH 2GO1A 3ST7A 3WMWA 5HS4A 1ZK0A 3H6KA 3F6YA 2XF8A 1KVTA 3K6JA 2X8LA 4QX6A 5JC1A 1R37A 3F4BA 4OQYA 1X7DA 2JHFA 3PJGA 4TZTA 1A9ZA 3WWYA 3GN1A 1EVJA 2ZJ1A 4NBTA 5IZCA 2P4HX 4JGBA 5CDUA 3DDNA 3IJPA 4MKRA 1BG6A 4DIOA 1EFKA 1ZUD1 2QX7A 2BMAA 4RDIA 2PTGA 3QP9A 2PWZA 1UR5A 3DBHA 3G1UA 1DLJA 2EKQA 2GNAA 3H2ZA 5CEEA 1YQDA 3ON5A 3WQQA 1KC1A 2Q1WA 3W8EA 3WTCA 4BO1A 2I99A 2RIRA 3CZMA 4FFRA 3V5NA 1ZW1A 1DHRA 3DQPA 2VWPA 1MXFA 2VWHA 3TZCA 4ND4A 1GY8A 1YE3A 2FZWA 4ALNA 1GCOA 2UDPA 1DOHA 4AJEA 3PQEA 3UAGA 2J8ZA 3RSHA 3NTQA 1GR0A 1T4BA 2R00A 1EK6A 1QV7A 2GZ2A 1RJWA 2ZIZA 2E82A 1EQ2A 2EKLA 3WLEA 2YJZA 3I9MA 1BRMA 4QSMA 3WQSB 1D7OA 1MC4A 4DYDA 4QT0A 2BGLA 3PYMA 1HETA 1DHTA 3CMCO 4IY1A 3ZNOA 4E13A 5JC8A 1KS9A 5JBIA 2OUIA 1Q0HA 1E3WA 3KHUA 5IZCC 2FR1A 2VZ0A 3AU8A 3MJCA 2RH4A 4AJJA 3WLFA 5G0SA 3VH1A 1HLPA 2P9EA 1T2EA 1UDBA 3DTTA 4ZD6A 2NQ8A 5JDIC 4BNUA 4IGFA 4CQLB 3BMQB 5G0WA 3D7LA 1NWCA 3CSDA 2ZB3A 1Z75A 1WZEA 4I1IA 2W90A 3O8QA 4B4UA 2E48A 4ILKA 1FF9A 3E9MA 2JKVA 2VN8A 2B4RO 4RZIA 3L4SO 1KVQA 1K6XA 2ZTLA 1CETA 4U5QA 3Q1LA 3ZWXA 5U4QA 5A02A 1LC0A 1BHSA 3JD3A 2Y1EA 4RPLA 4MVJE 5T67A 3DMYA 1GD1O 1AHHA 4TMFA 1Y6JA 5BNTA 5HRUA 3HDJA 1C1XB 4ZQBA 1NHGA 2X5JO 1H2HA 4NJOA 2PZMA 1JQBA 5CDTA 3VHRA 2OFPA 3BA1A 3VH4A 4B7XA 1ZBQA 2GN8A 3ZU4A 3PZRA 3BTOA 3ANNA 4IXWA 3ZV3A 4OQZA 1HDYA 5AVOA 3INRA 3WYBA 4L76A 1C1DB 3UHAA 1BW9B 3WICA 3JQBA 4CLOB 3QWHA 4LISA 1M76A 3FD8A 3EZYA 3GEMA 2DVMA 2A9FA 5TC4A 1RM5A 3H9QA 5A1TA 1N7GA 4FDAA 2IEDA 4N5MA 1G0OA 1QRRA 1ZXLA 2VZ8A 2V6FA 4ZJUA 4MVJM 3U4IA 3JQ9C 2HAEA 1T1SA 4Y67A 5IJZA 2FPIA 3I9LA 3S2GA 3EUWA 3FNEA 1ORRA 2JHGA 1E6EA 2Y1CA 3PI7A 5KJEA 3I9OA 3V1YA 3K73O 1KVUA 4NH4A 4R68A 1DPGA 5A3VA 3UKOA 3PYXA 4PLCA 1M6HA 5A04A 4JROA 3K9QO 3DB2A 4IZIA 3I9KA 4EZBA 4MDHA 3TFQA 3AUTA 1ISJA 1E7QA 3AWDA 3JQ7B 4ZQHA 4KWIA 1CIVA 1VJ1A 1RM3A 3V1UA 4DRYA 4RVGA 3VPSA 3NRCA 4WUVA 4MP8A 3IP3A 2NU9A 4BB6A 5IAAA 3P2YA 4BNIA 4ZQEA 5BSFA 1GQYA 1EE2A 4LVUA 3TJRA 4AJ2A 5DT9A 1E5QA 1J49A 1I2CA 2H6EA 2WTBA 1AXEA 1T25A 3RCBA 1YB5A 1PGNA 5F3RA 1N92A 1X14A 4NMHA 1UDCA 3INGA 3LLSA 3GA0A 4YA6A 1HE4A 3QA9A 4RF2A 2YUTA 5L3ZA 3GG9A 2NVWA 4CQMD 1DIHA 5JYDA 1AN9A 2VUUA 3ADOA 2PKRA 3AUAA 3PJDA 4IQ8A 3QVWA 2Q46A 5KVVA 3U5TA 4JP3A 4B8ZA 4PVCA 1I24A 2C5AA 4YEDA 4XCVA 5DBFA 2W2KA 3DZIA 1HSOA 4CMIA 3LVFO 5ENDA 4CLEA 3NEPX 4G81A 1HYHA 3FTNA 3JD2A 4Q9NA 4D41A 2UUPA 2D4AA 1ID1A 5LDGA 4E21A 4K9DA 4J4HA 5B4TA 1S7CA 3G3EA 2EJWA 3WMXA 3JQ9A 3F4LA 3HG7A 1ZK3A 3KYCA 1NAHA 5F5NA 4GSLA 1KC3A 3GEDA 4GMFA 4GVLA 1CQIA 1CJCA 4WASA 4R16A 3TZ6A 2V6MA 3EC7A 2JFHA 4N18A 4P22A 2IXAA 3QIVA 3W8FA 4ND1A 4QQRA 4NU5A 4YJGA 3ULKA 4PLWA 3VPGA 4F45A 2X1HA 1IHXA 5KJFA 3JQAD 1F14A 3FBGA 1QP8A 3IJRA 3KSZO 4UVDA 1JN0A 1YB1A 3AM5A 4Y9DA 1YL5A 3BHMA 4TZKA 4CMGA 2YDYA 3JQDA 1F06A 2CD9A 4EYEA 2CVQA 3GUYA 1PU2A 2X4GA 1IHYA 3HB4X 4ZVVA 4R01A 4EJ0A 3FR7A 1GTMA 4WOKA 3IQDB 1BGVA 4C4OA 5G0TA 4ID9A 3K30A 4TRRA 1OC2A 2Q1SA 3MTJA 5LC1A 2ZTVA 3VTFA 4BNLA 3B6ZA 5THKA 3OJLA 2WYUA 1H9BA 3K8ZA 1ISHA 5A9TA 5GZ1A 5T8KA 4DLLA 1P44A 5JCJA 1VPDA 5IG2A 3ZU3A 3AJRA 1H2BA 3Q11A 5AOVA 3OIDA 2W2LA 3I9NA 4EUEA 4B7CA 2NLOA 3PIIA 3K5PA 2VHYA 3VC7A 1R16A 1PL7A 2UAGA 4IS2A 3TPCA 1VL8A 4RF3A 3U9LA 1UZLA 5FYDA 4YRBA 1MFZA 2H63A 2GUGA 2ZTMA 3DMTC 1KEPA 1Q0QA 2X22A 1NR1A 3C3XA 4R3NA 3GVXA 4PLFA 4BKOA 2G5CA 1ULUA 4GAEA 4JBGA 2B37A 4CUKA 2VRCA 5F1OA 1IPEA 1I01A 2QRKA 3GHYA 4MIYA 1M2WA 5I7SA 4J4BA 2EJVA 1A4UA 2D3TA 3ROKA 1SOVA 4UULA 4FW8A 5DCWA 2BFMA 1L1FA 1R0LA 4URFA 5TX7A 3GT0A 3KO8A 4EUFA 5T6BA 1X7HA 1ZK1A 4DL9A 4YXFA 3T4XA 2P5YA 1NM5A 4PRKA 1HYEA 2AG8A 1YWGO 1GPJA 2GN6A 3WGOA 1KIFA 1HDZA 1HTBA 3PFFA 2V65A 3NDJA 3GRKA 1VRWA 2G1UA 4BNFA 3LZ6A 4GKBA 1HL3A 1J4AA 1X7GA 1DIBA 3WOHA 2FSVA 3RC1A 3GG2A 2IZZA 1P77A 3DZGA 2C7VA 4CM4B 4UEKA 3RUHA 5EN4A 4OOEA 4CM6A 1V3UA 2JL1A 3JQ8B 4YWJA 5TT1A 5ITWA 1FMCA 4CMCA 4D46A 1HE2A 2HLPA 4XGNA 3DMTA 3U4CA 1B3BA 3JQAA 2AXQA 4CM5A 1BTOA 3ZU2A 1QYDA 3BIOA 2GN4A 3GGGA 1DB3A 2BELA 4R69A 4BO7A 2A35A 1HWYA 2QRLA 1XLTA 4PLYA 3JYLA 5JNLA 2FZEA 4E5PA 3DAFA 1NQ5A 1H6AA 4FIZA 4ND3A 4E30A 2DM6A 3ZW9A 3G0OA 2ZCUA 1R4NB 2OO5A 5L4LA 2I3AA 2J3HA 1U28A 2PR2A 3KB6A 4Q39A 1PSDA 1X0VA 5EJ2A 4I9HA 4KUEA 2NU8A 1PEDA 3PLNA 2X9NA 4DVJA 4RPGA 3O9ZA 3U3XA 4BHTA 1IB6A 1IYZA 3R1IA 4FOSA 3RD5A 4DTIA 3D3EA 2FSSA 1UXHA 1LNQA 1OOEA 2QG4A 4AL4A 2G0TA 2DC1A 1I10A 4IMPA 1YGYA 5K6AA 3OECA 3BAZA 2VYNA 1A72A 2YHIB 4HKTA 1KY4A 2X9GA 5KKAA 2PZJA 4UEJA 3CE6A 1GZ3A 4DIBA 1Z73A 5EQDA 5H82A 5I7EA 3NJ4A 5BSEA 3JQ8A 5GMOA 4MKXA 2Y1GA 3KXDA 3GHHA 3RKUA 2EGGA 1YRLA 3S2FA 4J91A 2D59A 1ADCA 5ER6A 2Y0CA 3ANMA 3BXXA 3OP4A 2YV2A 3S2IA 3VVBA 4CV2A 5CG2A 2W98A 3WTBA 4WLUA 4J7CA 1ML3A 1H93A 4RVFA 4FB5A 2IZ1A 3KOUA 4JQCA 1QLHA 1AUPA 2IYPA 2O3RA 3BMOA 3MCVA 1TXGA 1PGQA 4EDFA 1P1RA 1P1JA 4LRSB 4AVYA 1PJQA 4B4OA 1RWBA 3RAJA 2FY8A 4BNTA 1TB4A 2IYOA 4KZPA 3I6QA 4OSPA 3C24A 1I30A 3NTRA 3OFSA 5L7TA 2BHLA 3KLMX 4KQWA 5KVCA 1RM0A 1PJ3A 2J5KA 4ZGWA 4O0LA 4R3WA 2RHRA 4WCFA 5K6AC 4H16A 1A7AA 2ZYAA 3DOCA 2XXBA 1U3VA 3D0OA 3W4IA 3TZKA 5L7WA 1X1TA 4FS3A 3SJ7A 3HSKA 4DIFA 1P1FA 2JCVA 4YJHB 4RVHA 4FC6A 3OHSX 4I5DA 1UAGA 1ONOA 3H5NA 1TVEA 3VVCA 2CFCA 4I9UA 4BS9A 4PLVA 1JVBA 3GGPA 2JCYA 3INTA 5B4UA 4B8WA 2CDBA 5ILOA 1QXSA 4OGWA 1VKNA 1I2BA 3EY4A 5DCUA 2POQX 4WLFA 4ALMA 3KUXA 1X1EA 2VZ9A 4DYVA 4XB2A 2WYWA 4KUGA 2YHUA 4CLHA 2BFAA 4F6LA 1XA0A 1ZMOA 1U3UA 4Q3EA 3WNVA 1YKFA 4E12A 3OA2A 5I8WA 2NVBA 3CZRA 1C0LA 4CMKA 3L6EA 1ADGA 2Y1OA 4IIUA 3WYEA 4K28A 3VZSA 3ZV5A 1B8VA 4B7UA 1RYDA 3JQ7A 1TA4A 4GI2A 1JLLA 4J4TA 3WGYA 4CQLA 4YQYA 1EBFA 3EMKA 5K0ZA 1XQ1A 4XX0A 5F21A 1U2DA 4WCFC 2DUWA 3C1OA 5FI5A 1YXMA 5GY7A 2RCYA 4AJIA 4FFLA 4DPMA 1ISGA 2GD1O 4BUCA 1WMAA 2W2KB 3T7EA 2DBVO 3ETEA 1CF2O 1YQGA 1GUZA 1D3AA 3C7AA 4M54A 5JYEA 4UAGA 2EW8A 3WB9A 3GFBA 1UXGA 1PTJA 4XJTA 2YW9A 4LCJA 2NADA 3VZPA 3D5QA 1N8KA 1SO8A 2EP7A 2DPGA 2B69A 5I9NA 1NWHA 2FPGA 1YDEA 3QRWA 2BLLA 2DBRA 4XEHA 4YT5A 3AM3A 1SEVA 2P91A 3ZWOA 4DUPA 3MJ4A 3HE3A 2CVOA 3H4VA 3JSAA 1Y8RA 4U6SA 1WDKA 2CMDA 5LDHA 1JWBB 3OETA 3FWNA 1R0KA 3ZWAA 1D4FA 2WM3A 3PP8A 1ENPA 2VUSA 5KTKA 4WNCA 5TRTA 4W9NA 1PQUA 4E6PA 1SEPA 4JNKA 4E33A 4DLBA 2UV8A 1LBEA 1E7MA 4XQCA 4ZRNA 5FWNA 2QRJA 4JCOA 4L8VA 4UREA 1LSJA 4NPCA 1NXQA 5JSFA 4CODB 5JMWA 4AICA 2H9IA 4L75A 1GV0A 1R4MB 3WGTA 5IN5A 3DFUA 3OEWA 3WXBA 1K3TA 4N54A 1ZIDA 4I5FA 2O50A 4B4VA 3M2TA 3RFXA 4CMAA 4BOYA 3GGOA 1QR6A 3TL3A 4IGEA 5L45A 4DBZA 4M8SA 2DTEA 2W4QA 3CKYA 4YBZA 1TT5B 2H5LA 4IUYA 4C7KA 3L9WA 4G5HA 1ZJZA 4J43A 4OXYA 3PQFA 4WK6A 5TLSA 2NU7A 3BTVA 4U0JA 3C1AA 4O5OA 5TS3A 2FRDA 3JQ6A 3TL2A 4J7XA 1XWFA 4B3JA 5CPBA 3U09A 1WVGA 1E92A 1QMGA 1LEHA 3E6AA 2OBNA 2J3KA 1ZSNA 4YAGA 1EDZA 3HNPA 2ET6A 3OBBA 4ITUA 4L4SA 1S6YA 1EK5A 4XDZA 4I9NA 2EP5A 1ADFA 2Y05A 2PK3A 3KSUA 3U4DA 1J0XO 2X0IA 3OJ0A 3QWIA 1VI2A 3SJUA 1FDUA 3JQCA 4HFMA 3LYLA 2CDCA 3V2HA 1UJMA 3F5QA 3OM9A 4JX8A 4XDYA 1UXJA 2J6IA 3ONEA 1BW9A 1JKJA 4JBIA 4M55A 4XQ9A 1VM6A 1XU9A 2PKQO 3ROQA 4DREA 2VTDA 4YYZA 3FR8A 4KDFA 4R54A 5CEFA 2OXIA 1V8BA 2E6UX 3LSYA 4BO8A 1IULA 2UYYA 1Z74A 2GSDA 3JD0A 2QW8A 3GF4A 4QEDA 3TSCA 3WG9A 4IQGA 4CMHA 1C1XA 1XDWA 4O1MA 4IINA 2GZ1A 1U5AA 2W8ZA 3FNGA 4FFPA 1DDOA 2GDZA 5JO9A 1LXCA 5TIIA 4N7RA 5IDXA 2GCGA 5JFOA 2E49A 1LU9A 3I52A 4J2HA 3W4KA 2Q1UA 1BXGB 3FSRA 3AI2A 4E5MA 1SMKA 1OMOA 3WNQA 2VRBA 3K96A 1W73A 2DPHA 3O8QB 2PD3A 1UXKA 1ARZA 1XKQA 5JAQA 4IJWA 1HEUA 4YAKA 8LDHA 3FHLA 4OXNA 6LDHA 2ZB7A 1NYTA 4FFMA 3VKVA 1NASA 1GCUA 1LSUA 4Y8VA 3IUPA 4A03A 2FP4A 4D79A 5A9RA 3WSVA 3QWFA 2EG9A 2B83A 4BNMA 1N9GB 2YQ5A 1SNYA 4JP2A 7ADHA 4NFHA 3LF2A 3WGQA 2R00C 4J16A 3ZHBA 3RKRA 3WBFA 5TT0A 3MTGA 1JDJA 1MV8A 2Z5LA 3GAZA 4FPXA 5AXBA 1XEAA 3K2EA 3UFXA 2AQKA 2BRUA 1F0YA 4TROA 4PLZA 2Y67A 5DCYA 5IFLA 3W1VA 2DFVA 1RYEA 4FFOA 4BV9A 1TT5A 4CLXA 1NFFA 3DBHB 1QKIA 1U1IA 4O6VA 2XOXA 4KTTE 4CUJA 5IZ4A 4HFRA 3AY7A 4KOAA 2J5QA 4A10A 2R2GA 3GRPA 4YRDA 1HYGA 1XG5A 1HDCA 2O2YA 1HDOA 4G65A 3CXRA 3E5MA 3A4VA 4ND2A 4TKLA 3O4RA 5AYVA 3TRIA 2IE0A 3JYOA 3H8VA 3UCFA 1F12A 4MVJA 3U49A 4M86A 5G4KB 4EBFA 1OC4A 1MLDA 3GPDG 2DQ4A 1YB4A 1ZSYA 2WD7A 3OA0A 3EYWA 4Z3KA 1HSZA 3AFNA 4LVCA 4CV0A 1GDHA 4XA8A 1ZXBA 4Z9FA 4CLRA 5L7YA 1U8XX 4CM3A 2VRCD 2FMUA 1GPDG 4BO9A 4E31A 1BXKA 5JY6A 4S3MA 3E8XA 1BSVA 1NFQA 4R9RA 1L7EA 4WEQA 3MOIA 4E5NA 1MFPA 1PQWA 4R1TA 5ICSA 2BGMA 4IDFA 3I1JA 1JW9B 3ANLA 4JJGA 1I8TA 5IXYA 3AY6A 4A5OA 1E7WA 1P1HA 1U3WA 1YJQA 5TQVA 1A4IA 1BXGA 5A03A 1DIGA 3CMMA 3S1LA 5EINA 1XHLA 4BKPA 5EESA 1DLIA 1I5RA 2EHDA 4MPDA 3QW2A 5A05A 2ZJ0A 5L53A 4DC1A 3E5RA 3HWRA 3NV9A 1O89A 4MVJP 4GX0A 3CTMA 3AFMA 2EWMA 1SAYA 1EFLA 3I23A 4RF4A 1BVUA 1E7SA 4CM1A 4RORA 2AG5A 1OBFO 2I65A 4M89A 4BGUA 1YO6A 2GGSA 3OSUA 1EMDA 4WECA 4D44A 4MIOA 4II2A 3LDHA 3PFWO 4Q3DA 4ZN6A 4IDDA 1H6DA 4IDCA 1JAYA 2NQTA 2X0RA 4ALKA 4D42A 1A9YA 2O3SA 2HJRA 4RO0A 3RUCA 3HFGA 5DBIA 1V35A 5HWSA 4QECA 2P5UA 4D7AA 1MX3A 3DONA 2HMWA 1ENZA 3GLQA 4Q3CA 4FN4A 1O6ZA 1PR3A 3GNSA 1Z6ZA 3RU9A 3DBRB 2PA3A 2HMSA 3GOHA 1PJLA 2Y1FA 3PHGA 4Z0TA 1TT7A 1YBMA 2HJSA 4J1NA 4ZHSA 5BSGA 4E4YA 2HO5A 3JCZA 1WLYA 4W99A 4YJFB 1KEUA 3VH3A 2O7QA 1PL8A 3D4NA 2YDXA 4L9RA 4BNYA 4J6FA 3ENNA 1HKUA 1NVMB 1GQQA 1NPTO 5BNFA 3KETA 4YT8A 1E1KA 3EDMA 5ADHA 1U4OA 4W7IA 3KVOA 3KYBA 2ZTUA 4XIJA 4QFCA 3KM0A 3GFGA 3DL2A 3K31A 3WQRA 4J90A 2F1KA 2WD8A 3H9UA 4YCAA 1YOVA 2P4QA 2VUTA 4WNIA 4CPDA 1LDYA 2C2XA 4RLSA 1MB4A 3QY9A 5CPFA 3ZWCA 3X2EA 2CUKA 4MJLA 4QTZA 1NX6A 5CFZA 2A94A 4P4LA 4NBUA 3VH2A 1GYRA 2O2SA 4FR5A 2E37A 4CMJA 1EZ4A 3G17A 5BSHA 1IOLA 4MOWA 4CM9D 3I6IA 2JAPA 4LK3A 3VPHA 1R4MA 2RBEA 5KOIA 4BKRA 3PDJA 1ZK4A 3OH8A 3PXXA 3RQSA 1E3SA 1K89A 3HN7A 1V6AA 1U3TA 4IJVA 2AE1A 3PGJA 3E9QA 3TZHA 1OZAA 4CR7A 5JDIA 4UUMA 4Z0HO 2Q45A 2DU8A 4PFJA 5I8ZA 4ZU3A 5JPIA 3WFIA 4DGSA 2XXJA 4N5NA 2PLAA 2GERA 2HCTA 2PKQP 1EVYA 3FTPA 1HE5A 4R5MA 2PZLA 2O3JA 2VYVA 3PVZA 3AUUA 1ZH8A 3EGOA 5I9MA 2NACA 4NG5A 4IM7A 4RVSA 3RBZA 1PZEA 1P0CA 1FJHA 4J0EA 4YB8A 4BKQA 1PGJA 2VWGA 1EUDA 2NU6A 4CQMA 4WPGA 2WDZA 2AEFA 5DNAA 4DMMA 1LJ8A 1NP3A 1QV6A 4F46A 4P4GA 5COBA 2HU2A 2OMEA 1JKIA 3QJ5A 2OP1A 2PGDA 2IRWA 4DC0A 2NSDA 4E2YA 1DC6A 3AK4A 1EVZA 1F8GA 1C0PA 1GEGA 3OMLA 2QZZA 1OAAA 3O03A 4XR9A 2OZPA 4AJKA 5KWEA 3HFSA 4CV1A 3JQBC 2WSBA 3QLJA 1LLCA 2BI7A 4M87A 2D2IA 5JAIA 1W0CA 3JYPA 1E6UA 4P8RA 1X0XA 1TI7A 3JQAB 1O95A 4NR0A 3DTYA 1MG0A 4R41A 5HA5A 2VCYA 3DAPA 4ALLA 3U0BA 2BF7A 2VT2A 5DOVA 2FN7A 4Y6SA 4KTVE 3VPFA 4L74A 3GDOA 5G4KA 3F47A 1NR7A 1BDBA 2NVUA 4LCEA 4Z9XA 2Q50A 4WE3A 3D64A 1VSVA 4R1UA 4J1SA 1YBAA 2Q2QA 2EV9A 4RZHA 5ER9A 4J49A 4AJPA 5A9SB 5A4DA 1VE9A 1KEVA 1U8FO 4Q3NA 4GPD1 4FJ0A 3WGZA 4D43A 2D5AA 2PH5A 4RDHA 3UH1A 1UAYA 3BYZA 1GU7A 5HS6A 4CLDA 3E1KA 1CWUA 2Q3EA 5C7LO 2C0CA 1H6BA 3HB5X 3LT1A 2GASA 2X0JA 5CDYA 2J3JA 3HZZA 3IAHA 5T64A 2Q49A 3ZZNA 4MVJF 2WYVA 1AHIA 1NHWA 5AXCA 2BFPA 3IUSA 3CINA 4UVHA 3CH6A 2ZYGA 3QVXA 3E82A 5ICMA 3IKTA 2P9CA 2Z1MA 1DC4A 1I3LA 1VSUA 4NNJA 2AMFA 3L07A 4IPTA 3PWSA 3ZWMA 2ZCVA 3QSGA 1HDXA 1B2LA 1FXSA 1ZEJA 3CEAA 1PJ4A 4ZA2A 5C5IA 3JQFA 1HZZA 1XR3A 2YZ7A 4TRNA 3X2FA 4HADA 2PFGA 3Q3CA 3T7CA 3RC9A 3UICA 1PIWA 3L77A 4FOOA 3BMNB 4DXHA 3Q9UA 5A06A 1DEHA 1P45A 1LSOA 3GAFA 1E7RA 3H3JA 4G2NA 3ZWPA 1T4DA 4PG7A 1A27A 2B5WA 1I2ZA 4HBGA 3DHYA 2VTEA 3BMOB 4E2ZA 1BWSA 1LI4A 3IS3A 3PDUA 1E3JA 1N5DA 5C7OO 2VHWA 2DTXA 3G1TA 5T57A 1JA9A 1U9JA 4IBOA 1LA2A 4E2WA 3W6ZA 4MINA 4N5LA 5EPOA 3S2EA 2V7PA 3DOJA 2HUNA 1SB8A 2VT3A 4XQEA 5BT9A 4E32A 8ADHA 3F9IA 3DBLB 4UVEA 1ENOA 3H9GA 4H3VA 2HRBA 3RVDA 2NM0A 3ICCA 3UVEA 3ZNNA 4CM7A 3RI3A 1DRWA 2EKPA 4MVJI 2QYSA 5KVQA 4HX5A 4D0RA 2CNBA 1B0AA 2WEKA 1BVRA 1DJNA 3UCEA 3HDHA 4CMEA 4CUZA 1XCBA 2D1YA 1I36A 1K2WA 3F46A 1KETA 1G1AA 3BTUA 4WOJA 2HKIA 3ONFA 4UVIA 3ZNPA 3MJEA 1HRDA 4IZHA 3BHJA 3C85A 4Z9YA 2O23A 4YRAA 1PGOA 1PS9A 4LMRA 3UOGA 4INAA 4Y98A 1ZZEA 3FCOA 3QQPA 2UVDA 1YH3A 1Y9EA 3E03A 4NBRA 4BO6A 5CAEA 4K1LA 1GUFA 4HP8A 5EL0A 2HQ1A 4M1QA 4NK4A 3TZQA 1RKXA 3UN1A 3KEOA 1Y5RA 1X15A 1QLJA 1IL0A 4TVOA 7MDHA 5T8KC 2YQ4A 1DXYA 3B1JA 3ETGA 4WCDA 4D0SA 4YJDA 4IS3A 3K2BA 4XD2A 1CERA 5GZ6A 2JCXA 5LCXA 4DPLA 3NKLA 4B79A 1QYXA 5F1KA 4YT4A 2HSDA 3ZH2A 4FC7A 3QWAA 4UVGA 1DSSG 2XAAA 1B3RA 2G76A 2Y0EA 3B70A 1LLDA 1IZ0A 4E5KA 3MZ0A 2PD6A 1EUCA 4GWKA 1DFIA 3TOZA 1H0KA 2Q4EA 1U4SA 2FR0A 4M49A 4AJ4A 1ZSVA 1MC5A 3EZLA 1HXHA 3SX2A 2X5OA 1GYPA 2CSUA 4U6QA 1IY8A 4MIEA 1ZKMA 1NFRA 2B0JA 3WS7A 5K9ZA 3IOYA 1D8AA 3RC2A 3I9JA 4PZDA 1H9AA 3JQGA 4OHUA 1C0IA 4OJNA 3GZNA 3ZWNA 2JFFA 4UEOA 5I7VA 1P9LA 1DO8A 4XIYA 4DMLA 3W6UA 4BMSA 5DF1A 3O38A 4CL3A 3LQFA 2CY0A 3RUEA 4DWVA 1I3KA 1NPDA 1NAIA 2JJYA 4RV9A 1R15A 3F1KA 3OQ6A 3LF1A 1OI7A 4R5HA 1T24A 4FCCA 5HBRA 1E7YA 1Y8RB 4AJ1A 1QYWA 4BV8A 3ZHZA 1DFGA 3T4EA 2XPCA 4NIMA 4UUPA 2Y68A 1PS0A 3WIDA 5MGBA 1D1TA 1O9BA 4I8XA 2QHXA 4JXKA 3OICA 3SEFA 1N7HA 2NUAA 4ZQGA 2O3UA 5I7FA 2AHRA 3NT5A 5JE8A 4DLAA 5KNLA 3P7MA 3ZWVA 4R51A 5JO0A 4S1VA 2DFDA 1LUAA 5COQA 2JFGA 1IPFA 4NBVA 4QXMA 2CF5A 3H9JA 5FI3A 1J6UA 1B16A 3GN2A 3ITKA 5CDSA 4RPJA 1E77A 1KBZA 4EI2A 1MP0A 1LLQA 3LLVA 4NBWA 4CM8B 1ZNQO 1TEHA 4XGIA 2B36A 2HMVA 3NJ8A 4UUOA 4IJUA 1KOLA 2BD0A 3UGKA 1YONA 3GDGA 4RVUA 2ZKLA 1EQUA 1VL0A 1XQ6A 4OXKA 3S8MA 3E48A 2F00A 2DLDA 3WJ7A 4PZCA 3Q9NA 5JCJD 3ASVA 1Y8QA 2PZKA 1V9LA 4ND5A 4GLLA 3VPXA 1SOWA 1N2SA 1B8UA 2SCUA 1JWAB 1NPYA 4GKVA 1U2GA 1E3EA 3EVTA 3M6IA 1K6JA 3FN4A 3BMCA 1N1EA 4Z3DA 2R6JA 4GBJA 1Q0LA 3GQVA 2Q1TA 4UUNA 2J5RA 4BNNA 5CEJA 3AOGA 1SC6A 1P74A 2QYTA 2B4TO 3A1NA 5L40A 4PN3A 2NTVA 1ZFNA 1BXZA 3FBTA 3ZHXA 5IDWA 1U7HA 3P19A 4E2XA 2Y1DA 4EW6A 1RPNA 5B37A 3DXFA 2C82A 3OF2A 4RPHA 2PD4A 1HZJA 1D1SA 1P0FA 3H2SA 4LN1A 1Q2XA 1YS4A 1WWKA 2WJPA 1HDRA 4OOFA 3RBXA 4BNHA 2NTNA 2DT5A 2D8AA 4CR6A 3RU7A 4L0QA 2ZYDA 3H65A 1ZMTA 2G82A 3K92A 3PPIA 4GH5A 4J9VA 4F6CA 4MP6A 4I5GA 4IDEA 4DQUA 3DO5A 1M75A 5ILGA 4I5EA 3VZRA 2X58A 4NDNE 3F1LA 2Z1NA 2VWQA 1R4NA 5L4SA 4CMBA 4AJLA 4OH1A 2AA3A 2DUUA 4I08A 4KDEA 1Y1PA 1LDMA 3GC6A 4BIIA 3Q2KA 4FGWA 3DHEA 4TVBA 1YVEI 1EBUA 3Q0EA 3E9NA 4DQXA 4HY3A 1G6KA 3ZWYA 3VDRA 2VYVD 2VOJA 1CDOA 2PV7A 4WLEA 5DZSA 5T5QA 1PJCA 1XELA 4OIMA 4PRLA 3WR5A 4CMEC 5FFFA 1W4ZA 3H5RA 4II3A 3ORFA 4YPOA 4PLPA 3UCXA 1EEHA 2PH3A 2Q99A 3M1LA 3NYWA 3HDQA 4J1TA 2NWQA 4W6ZA 1CYDA 4ROSA 1PX0A 2VHZA 1NQOA 3QWBA 1SZJG 2VQ3A 4MP3A 3ROMA 1PL6A 1UXIA 5JAZA 4TWRA 5I9LA 3GVPA 3KZVA 2JD1A 4XGKA 4YJGB 4BO0A 1GZ6A 4QO7A 3N7UA 1KVRA 3H3FA 3HJAA 4NJMA 1LQUA 2OL4A 1V3TA 3GVHA 1FDWA 4NHEA 4PLHA 4QO8A 2C5EA 3NGLA 4BNJA 1F8FA 1UUFA 2YY7A 3GNQA 1PGPA 2C07A 4NZ9A 5JY1A 4YACA 4WKGA 4R1NA 1QG6A 3TOXA 4J3FA 3CUKA 4CL8A 1QSGA 1KERA 2ZK7A 4PGFA 3GMDA 3F5SA 5L4NA 3DAGA 2YHIA 1XGKA 1XIVA 3SC4A 5KCZA 1N1GA 1WXDA 1C1DA 2B5VA 5JMPA 4A73A 5KJ6A 3PJEA 2ZQYA 4DA9A 1HT0A 3ABIA 1E1NA 3PLRA 3AM4A 2HMTA 2TMGA 4GGPA 2QIOA 5CDGA 3KEQA 5ES3A 3P2OA 2LDXA 2DBZA 2I6TA 2X0NA 2ZB8A 4BVAA 1EDOA 5KJ1A 1XYGA 1LLUA 4LW8A 4OKNA 3LC7O 4PG8A 5TF4A 1LDGA 3PEFA 4AJOA
chains in the Genus database with same CATH superfamily
2ODAA 4BP8A 2PBFA 3B52X 4BWFB 2QX4A 4IHJF 1DBVO 1CZUA 4YCBA 1P18A 3GWGA 1JEEA 1KO4A 1WDMA 3A14A 4EPWA 4FXOA 4D9HA 1Z82A 3GLGA 1Z83A 2ZGVA 4NFSA 2EBWA 2WM2A 1N0WA 2G80A 6NULA 3QF4A 3NX4A 5ANRB 5I48A 1SBZA 2UUCB 5LPNA 1T1JA 4RACA 1KY2A 421PA 3TTSA 2X23A 1FS6A 1H23A 1WMEA 3JQQA 5FBHA 3U26A 1QUEA 3B20A 1ONPA 3DEFA 1H9CA 1V3VA 3FNHA 1D04A 5FP0A 2F4VB 5FAXA 3PPVA 4OK6A 2FWBA 5GV7A 3EGXB 4CM4A 1KI6A 1MTZA 5ALVA 2CXNA 2DBYA 4INJA 3NAQA 4QRDA 1WZIA 1M1ZA 3VBCA 1NF8A 3P0JA 3D7KA 4F7WA 2VF2A 4M1KA 2HJ9A 1Z16A 1RCTE 2RAVA 1TUGA 2Y2VA 4LNUB 3STHA 1MABA 1ZJYA 1Q7CA 2W6JA 4JQZA 2A4KA 2JFPA 2H92A 3H4TA 3KKKA 3HB1A 3NIGB 2D06A 3IV9A 2H1RA 2OLJA 2A0FA 4DY4A 1U7WA 2B35A 3DE1X 2COKA 4L27A 3WO1A 1MO4A 4BVGA 1CRWG 1MQSA 2JLVA 1SVUA 3IBSA 4HLQB 1KOFA 3FWHA 2WFLA 1UEJA 5JOQA 1DX4A 5FEUA 1O0BA 5CIQA 5DHFA 3CW8X 1GZDA 5EC8A 3DM9B 1IHDA 1XU7A 4H7DA 4NBNA 1WP4A 2W58A 4ZVSA 2H9AA 2HR1A 3WWZA 1U7UA 3RDPA 4V02A 4CLOA 5IWAB 2ZR7A 3OWXA 2FWRA 1R4ZA 3EDOA 3MN1A 3DJFA 2A5LA 4R1SA 5ES4B 2V4MA 2WWTA 1I6MA 2XNSA 4MS4B 4DBVO 5A3JA 1P1KA 1U2SA 2HQOA 1NV9A 3LPLA 3PK0A 3EHEA 2FEMA 4FCVA 3U7QB 4ONEA 4WLNA 2PGJA 3PFGA 1W7AA 2W2LD 1EP3B 4Q1CA 5HKBA 4HDAA 4W6QA 3UK7A 2O2GA 3DBRA 1MO2A 1KJQA 2P8JA 2IOQA 4Y2HA 3JVIA 3FAKA 4NCBA 1V5EA 3N0VA 3I6BA 3TTWA 1JT2A 3ETJA 4DC9A 1ZVVA 3U3RA 2QZ9A 1BDHA 1I5EA 3R24A 4X8OA 1WB6A 1YRHA 2QR3A 4J3NA 1RRKA 4FOLA 1NXPA 1FX0A 1MC8A 3FKJA 3OLVA 5CX1A 5IDQA 2QP3A 3R3ZA 2H65A 2WMDA 1QLWA 1XROA 1IRIA 4EECA 4OAQA 1YQUA 3A1SA 2LBPA 2LZ0A 3W5JA 1GPLA 3RSOA 4EHKA 1SPXA 3H83A 3DBLA 3F98A 1I14A 2BV3A 3V8PA 5EWJB 3TR6A 1NMQA 5DX0A 4L4RA 4M2LA 1KL7A 4FU0A 4HS4A 2XDYA 2BT4A 2M6RA 2AI3A 4MJ7A 3RYIA 3W9YA 3HQ4O 4WEOA 4P6VF 4YJKA 3T1QA 5F5LA 1NW4A 1V2GA 1GQ2A 1V1JA 3OQBA 3CRNA 4YASA 1U9IC 2C1XA 3JYQA 2XGMA 1XRJA 4UPEA 4KQXA 3KCQA 1RYNA 3NAZA 1KR5A 3F3SA 1FPMA 4IDNA 3MTAA 3MAJA 4K6FA 4L0CA 3OTQA 2QN2A 1EYZA 3C7CB 1WL8A 4WBNF 3EDYA 1BA2A 2GCIA 1FB5A 5M29A 1HFJA 1Q1GA 2DPXA 1VZ3A 5KJCA 1ZA1A 1FUEA 3NHAA 4W7HA 4R9SA 4E09A 2ZZMA 4GBED 5BOSA 2PY6A 4NENA 2QTFA 5EP2A 2P9GA 3AEQB 3BDAA 2BTOA 3BTSA 2J6HA 1U1DA 3T9FA 3NIWA 3AUKA 4C1BA 4CHTA 2WIBA 1K7XB 3KZKA 1WR8A 4KK4A 4DCJA 1XDBA 1YDWA 4OHBA 3RYFB 4YRIA 1UP7A 3G9UA 4HDMB 3UGJA 4KKVA 4N5HX 4CMIB 3AB8A 5L3SA 4BRZA 4O1IA 4Y9UA 4BX9A 1VPEA 4KVGA 3HBFA 4XQGA 5EJFA 1X13A 2I4RA 5IDYA 5KSZA 2O8CB 4GQAA 2QT9A 2EX1A 5KTTA 1A5AB 1MX1A 1LQTA 3CLRD 4F38A 1JIIA 4ND7A 3KSAC 1H0SA 5MN4A 2RKBA 1M2EA 4OX9Y 4FYMA 1S8FA 5JXWA 1GV1A 1HQDA 1K0UA 1AN0A 2KLBA 2VNAA 4XJSA 5JCXA 1ZN9A 4A36A 2G88A 5BQFA 3IDOA 3R4CA 4Q4DA 1S01A 3ZQUA 1F5NA 3HK2A 3TS1A 1UBCA 1LVHA 2XCLA 2VBGA 3RVPA 4PZYA 4DEYA 4KNVA 2WU1A 1R8QA 3ZVKA 5DNUA 2FWPA 1VCOA 4WIAA 5B6JA 1WV1A 2OPBA 3LO8A 2CBGA 3EPJA 1T9KA 4R9UC 1EZZA 1EWKA 1OXXK 1T2AA 1GG2A 4J7UA 2BBWA 3VR5A 2HFKA 3LUCA 1PFWA 2NU9B 1XTUA 1ZIYA 2VNHA 3V00A 3WGIA 3DJYA 4MA4A 2BH2A 3VVMA 1IQPA 4N4AA 1M54A 2WIFA 3ESBA 4O4LA 4XCQA 1YD7A 5I7WA 2QN6A 3B6MA 1JFTA 3JQFC 3GY0A 1HE3A 3TLCA 2HNKA 3COYA 3HP4A 4YQFA 1M2HA 3DDHA 4JN6B 1X70A 4M0KA 1JJAA 2G06A 1YOVB 4CR8A 4G3XA 4WXHA 3KKLA 2FHSA 4QUBA 3FUTA 4HX2A 4XIGS 1SPBS 3EK2A 2ZUDA 4A27A 2PS3A 2ZJAA 3HCDA 4QXQA 1E0DA 1F9AA 2GI4A 2GTIA 2Q9CA 1WNTA 5DM4A 4EHLA 3AESA 4HXGA 1K75A 1RABA 2RI6A 2WILA 3HA5A 1E1MA 1YZKA 1NP6A 2JFYA 2YN2A 1U2ZA 2G9VA 4JT9A 5LKAA 3I72A 1V16B 4KK3A 1TU0A 1RYFA 2QN7A 3ZOZA 1PUJA 2MT9A 4B83A 2QU7A 3M34A 3FGPA 2Y0PA 3DVAA 2F3TA 3DE4X 3EXIB 1LK7A 2CMGA 1FOEB 4IIXA 4JHXA 3T3GA 1M66A 1IXRC 2XYHA 2ECOA 4OSOA 5DDIP 1KK1A 4BNDA 2PMCA 2F1HA 1BHO1 2WHYA 1UBRS 2YYYA 1G8FA 5HDBB 5BSUA 2ZWIA 3JVUA 3HBNA 3QE4A 4HTFA 1OBHA 4AKIA 3FB4A 4H08A 4CF5A 3R0IA 2J0UB 4GUDA 1SUEA 2I3GA 2VK1A 3U44B 3MWDB 5B3JC 3CGGA 4H9GA 4B4KA 3C7TA 4HMPA 4ZYVA 1SBTA 1QU3A 4IDBA 3TXXA 3NUGA 4RIHA 4NZZA 2AEEA 2G40A 1HDGO 3AH8A 4OI4A 2AT1A 3H7AA 8AT1A 1LVGA 4FZRA 2RGAA 1DKUA 1ZD9A 5EVCA 3K1ZA 2EJUA 2WV7A 3HR8A 1N3IA 5DN9A 5J63A 5JSZB 2N3ZA 1DRUA 1PZGA 2ONCA 5EHGA 5JWHA 3PHIA 2O8VA 1KZ7B 3P2IA 3L1UA 3OQPA 4NTZA 1NN0A 3CZ5A 2VA8A 4XYLA 4QYTA 3EF0A 1NTOA 1YZNA 1PZHA 3GVIA 2P9BA 3BMCB 3FVWA 3R5TA 2F48A 2J3IA 1RM4A 1GHTA 2XITA 2XQGA 4A6DA 2AFIB 3CR8A 1TOAA 5JQGA 4Q19A 2PH7A 3CUWA 2WOOA 5F7XA 1DAMA 4EPVA 1E63A 1TIBA 3EMBA 1T26A 3NDIA 4BGIA 5LQNA 4HLUC 2PRJA 1VGQA 4PVDA 2ASVA 1Q7TA 4OYHA 3C4QA 2CGEA 4RJKA 5EE3A 3R0XA 4L3WA 1SBNE 2B1IA 2R44A 2PT6A 3KTAB 4XYMA 3RS9A 5E1BA 2OD9A 3GUCA 1JIJA 5KI6A 4YQZA 4UPVA 2BCJQ 2X2EA 3CNNA 4RW0A 2ZIWB 1A8SA 1T8RA 1K5HA 4JLNA 4I1VA 4PG5A 3AR4A 3UG6A 3EC2A 2C8JA 3SC2B 2YOHA 4C76A 1WOMA 3N76A 5E0OA 3AZQA 3AU9A 4X54A 2WVHA 4D6XA 2G07A 4K9MA 4NBSA 2MSDB 1BS2A 1QFZA 3NRBA 4CLRB 4R3UC 1G8YA 3T7RA 4HAIA 1A5ZA 2CBXA 3HM2A 3RC7A 3RHSA 4HQRA 4B6FA 3C3DA 4KPYA 4YAJA 1XJ0A 4GWGA 3LBYA 4HEA6 5B4VA 1W8DA 4QXOA 2OBLA 1KI8A 1N7JA 1TEVA 2OOKA 1PVOA 4R9NA 4ESOA 2GYYA 4O4JA 4UNQA 1SXJC 4XKJA 3GFPA 2KBEA 1MEOA 1R0SA 3GFFA 3AY3A 4P31A 3EG9B 9ATCA 3V4RA 3DLBA 2AI1A 2FW8A 1XZ8A 3KLBA 4X65B 1R0RE 3TM4A 1KZ4A 1OE0A 3X2SA 1V2HE 5KU7A 1ZLXA 4B3HA 4CIAA 4CRWB 1Y5MA 2ZBPA 3KJGA 1XDZA 3O8CA 2DQKA 2Z30A 4RHXA 4MSUA 2GD2A 2IPAB 3EB9A 3KEGA 4HZGA 3F96A 3NVDA 4D3DA 4DUGD 4JKOA 3CUVA 5FLXA 1C1HA 2E5WA 2PMDA 2XOKD 4EENA 4LJSA 3K9HA 4XB1A 5HW0A 2P6PA 1XQXA 1BX3A 1G42A 3DDSA 2A1UA 2BKAA 3ILHA 2R6GA 3JZFA 1PJAA 3OPNA 1ZCJA 1MAVA 1JDUA 2IPLA 4TWJA 4Y9SA 3SYRA 1ZVMA 2H54A 2Q4BA 2I5PO 2PIDA 3ZQKA 3R3JA 4ZHQB 2H2GA 3A37A 4OXXA 3TRHA 3O91A 1H8EA 1VCIA 4U2CA 4GVPA 1B15A 5G0VA 3F9CA 3G85A 2DY1A 5D3KA 4AYTA 3MMPA 5D86A 4B7ZA 4TRJA 3GROA 5EJ9A 4RE6A 4F8JA 1GUYA 5THQA 1WQ3A 4PRYA 5EHQA 3PUZA 3WX0A 4BNZA 2RAFA 1VJ0A 2C61A 3VTZA 3TG8A 5JLAA 4KN5A 4JJIA 2WWRA 3CNOA 4NAVA 5CP8A 2R1ZA 1ZX1A 4Q1AA 5JJKA 1SD2A 1FP6A 2NU6B 1I32A 3UXYA 1DUVG 4BMVA 3R9IA 1GYQA 4G5XA 1P2UA 4WESA 4YUWA 1Y37A 1DFHA 1RACA 2C7GA 3C3KA 1U3FA 4U2EA 1UK8A 3RBVA 3L0CA 3PHLA 3PWKA 4FT2A 2YJNA 1N5OX 5DK6A 3TR5A 4CFZA 1KKLA 3TZBA 1DBIA 2Z1DA 4GL4A 3ROTA 1VJ5A 3W1EA 3BE8A 5A5FA 2O4UX 2I34A 2C59A 2XV1A 4KAXA 2EKDA 3HDYA 1B2RA 1L5KA 2FX3A 2WJWA 4JODA 2V9ZA 2WJ6A 3IBGA 1BFDA 3QVJA 4G63A 3PPYA 4EEXA 5C5DA 2QE6A 2VQEB 3L9XA 5K3AA 1OFGA 1Z6XA 4FJ2A 2Z6AA 1I3NA 3COWA 4LHVA 5GZ1A 3RS2A 3EY9A 4LRXA 1SUCA 2PM8A 3FHCB 2Y9MB 2XX3A 4BL5A 4BEVA 2WIAA 2I91A 2CF6A 1CVIA 3I04A 5CX1B 3IYLW 1X7XB 5FF9A 1ZONA 4QWWA 1US8B 4Q01A 2W6CX 4RMIA 3V3TA 1P1IA 2QB5A 3F3YA 4Q34A 2JD0A 3L8GA 1Q20A 1Q83A 3NTOA 2BH9A 2ODEA 4HNQA 4K3UA 3HUEA 3ZWWA 4WL0A 3SBXA 5JS8A 2JAHA 2XNCA 3THYA 1QK5A 3SQOA 4E3ZA 3MMXA 4M7OA 4WZAB 1GTG1 4PQYA 1XZQA 5BVGB 4GVXA 3EWSA 2W00A 5KVSA 1YJ8A 3HVKA 4PZEA 2V1UA 3ML1A 3SVTA 1HY3A 2ZJOA 2AN1A 1OBCA 1W85B 3FCUB 5FUBA 2XXAB 3L4BC 3UJBA 4IP0A 3R5FA 1HX7A 4ASUA 4F3YA 3JAKB 2ZRLA 1CQJB 2VDUE 2XDAA 4G1VA 2RB4A 1GADO 3K4PA 3ZW8A 4BNKA 3GEPA 3U4HA 3DPUA 4C0SA 3D8SA 3H0EA 4FX2A 2A9QA 1SOUA 3R5HA 2I8AA 1E66A 2YNMD 3NYRA 4LRWA 4YHBA 3ROPA 1B23P 1QZUA 3LOQA 4HXYA 4QXPA 4YJFA 4GM1A 5EJMA 4B3IA 2XRZA 1BE6A 2H57A 2J46A 4QU8A 1SBHA 4R05A 2C4WA 3OJCA 2XRFA 3R9XA 3O26A 3WGMA 2V6GA 4J2OA 3OY2A 2AXEA 4OHCA 4Y9TA 4EMUA 1EXWA 3H97A 2NTJA 1XNRB 2BJWA 4GPBA 1RKUA 1UMCA 3BGVA 5FBRB 4Q4AB 1C3VA 3IDSA 5KKCA 4KC0A 3PZBA 1TFUA 2RGUA 4Z99A 4HV4A 1FFEA 1XO1A 2EBUA 4LRUA 3AONB 1IE3A 3QVOA 5JVDA 4AI6A 2A2ZA 2DUJA 5JJCA 1HFWA 2QF7A 3ZDQA 2Q5CA 2ZDQA 4IH4A 1K6IA 2TMDA 4BAZA 2DCMA 4TLBA 3CN7A 1DRKA 3AI1A 1CEQA 3P0HA 4TYPA 5FKJA 1V5GA 4RY0A 1GR1A 1ECPA 3W1WA 5GZ3A 2RHGB 5D01A 4JGIA 5LB4A 5LA6F 4E4TA 4ZTUB 3LWNA 3E1SA 2R97A 3FI9A 1XZPA 2YH2A 4O59O 1JSXA 4LYJA 3V4PB 1KARA 3ZDAA 1EGQA 3M83A 4GLOA 1TTTA 3EIXA 1GPUA 5B58T 1G8HA 2QQGA 3D6JA 1Y8AA 1OTHA 2YIDA 2IU4A 1DWQA 2REXB 1O0SA 2H48A 1SCUA 5A9SA 1I4OA 2IX9A 1DXQA 2YWXA 3KYDB 1MXHA 2EGHA 3Q88A 5FLKA 1GTJ1 3R20A 2B1GA 5GP1A 2W4IA 5CM8B 3DC2A 3UUWA 4OJTA 4DDHA 4F5WA 1NKTA 1UH5A 1W87A 2KMLA 3U9SA 1H5QA 4MQEA 1LPOA 4CIYA 4KL8S 3YASA 4L7QA 1MW9X 2EWWA 5A7HA 3WGHA 3ZVLA 3OJOA 2LTAA 1J0CA 1J70A 3O1LA 3I45A 4XRRA 3V2UA 3LD9A 5J2TA 2XKAA 2GEJA 2WG2A 4XAQA 1FNSA 2YOGA 4B73A 5IT0A 2D8MA 2BUAA 4QIHA 4LMPA 4YT2A 3RWBA 3VHXB 1RQRA 1TTHA 1BH2A 1O58A 3FF4A 2PO5A 2O0HA 1LDBA 3ORQA 4MLPA 4BO5A 5ILQA 1KQ3A 3VO9A 1EFHA 1JIQA 4AULA 2OB1A 2NX2A 3RE1A 2RJ3A 1GFIA 5E2BA 4YLEA 4L6CA 4YV7A 3LCVB 4GX1A 5EJ7A 3BE5A 1AGNA 1UPAA 4ARZA 2NYVA 1MB2A 3EPLA 3ST7A 3WMWA 1A8QA 4H1VA 4V0SA 3JATB 4JJ7A 3F4KA 2C2MA 5DYNA 4ZI2A 1XLUA 1DWPA 2HLDA 2CV1A 4Y2XA 1U31A 1KVTA 1RJ9A 2H4ZA 1H0HA 2X8LA 5JC1A 2JDID 2P6RA 3EGIA 4OJYA 3ZD7A 1A9RA 1VPTA 2ZSBA 4TZTA 2NUTA 4P3XA 1A9ZA 3JASB 1IM2A 2CNLA 2ZJ1A 3A6JA 3VNBA 4LUCA 4EB8A 1YT5A 4LQCA 4JGBA 1ORHA 2V59A 3JZDA 3DDNA 1V41E 3PWTA 4MITA 1OYYA 4RM2A 1OGYA 5CDUA 3DMGA 1U7ZA 5EIBC 2BGUA 4DIOA 3ENVA 1DEXA 3CM0A 2H4FA 3HLKA 3HNOA 4MV8A 1H2XA 1F0PA 1SHTX 3AHCA 3KX2A 4HH4A 1UR5A 2QNIA 3DBHA 2MWMA 4XLZA 5B1DA 1DLJA 4X44A 2LCQA 4BLRA 2GNAA 3NP9A 4YRKA 5CEEA 3G2KA 1UINA 1SQSA 1I2AA 2ORED 3DCYA 1V6SA 4KYVA 1N4AA 2OSBA 5K3BA 2HSGA 1MOPA 1Z8DA 5TQ2A 4B46A 5JBQA 3BGDA 2I99A 1QFXA 4TS3A 2VDVE 2FFBA 1UIRA 4HBZA 1UOEA 5CX4A 1X7ZA 2BGTA 1VSTA 2VWHA 3TZCA 4OXIA 3KQPA 1E18A 4ALNA 5HKLA 1RWPA 2ESRA 1PQ4A 1W4AA 3F74A 4MWCA 4JYZA 1AO3A 1ZINA 2FSGA 3HUTA 4OB7A 4OLFA 3UAGA 3ZGLA 3SHVA 4B3MB 3RSHA 3EARA 1HC7A 1XYYA 3G0CA 3NTQA 2CHGA 1Z15A 4RLQA 1T36B 1T4BA 2R00A 3COPA 5AK3A 1P6XA 4F93B 4XQ0A 2Q07A 4WUTA 4J07A 3CRRA 2ZI3A 4AY3A 5CH5A 2JZOA 2OR3A 1BRMA 1YCHA 1SWWA 2PUDA 1BKDR 1GZVA 5H5JA 4CQJA 5KTYA 1J0BA 2B6NA 1F0NA 1U8TA 1ZIXA 5JC8A 5AM0A 2NW6A 2C7BA 3E3MA 3D3KA 5EPUA 5EGSA 4EY6A 1AX9A 2VHUA 3ETHA 3VPAA 1E3WA 4O4IF 2JBAA 5KOJA 1RBZA 2RIPA 3AU8A 3QX9A 2C31A 3MJCA 3N05A 4E3WA 1GOTA 3WLFA 2YYZA 2W48A 3JALA 1SRQA 3LW8A 3VH1A 4DCVA 2RFLA 1FVXA 2FK7A 3DTTA 5B1IA 5BQPA 4BNUA 4IGFA 3P9YA 2PKYX 4RKFA 4C7MA 2PU7A 4MRNA 3BIJA 1NWCA 3UV6A 3OY7A 1B6SA 2ZB3A 4I1IA 2E48A 1DCKA 5KCMA 2ZJ4A 2HIMA 3AR8A 4FGKA 1RPAA 2VN8A 4RZIA 2X8JB 4G0YA 4HL6A 3BFXA 1JHVA 1XBTA 4AQYB 4ESHA 1KVQA 2PGNA 3ZWXA 1CETA 1U8EA 3HY6A 5U4QA 3UK1A 1NDQA 3T38A 3A6EA 4NFLA 3KVNA 1JSZA 5AP9A 4BE4A 1YOBA 1M5TA 5A02A 4P0PB 2Y1EA 4RELA 1JPNA 1RD4A 1XMXA 2R25B 4GBGA 4CDRA 2VDQB 4RPLA 4EY3A 1DDGA 5DEIA 3U7FB 3NC4A 3DMYA 4HNUA 3I3SR 2OEPA 3WV5A 3TQCA 1JFRA 1MN6A 1TYEB 1Y6JA 4MS3A 4TMFA 4I50A 2YVUA 1AKQA 3DT8A 3HDJA 4ZQBA 5EE9A 4DBLC 4DAEA 4G09A 3Q9LA 5CDTA 1ZCBA 1G2OA 5SYAA 2YWBA 2GN8A 2VT6A 5K0NA 1IWBB 1FBTA 4XWWA 2ZAIA 4ENWA 1MAAA 1HRKA 1TK9A 2R84A 3NORA 2GJ9A 3INRA 3BWMA 4ZVUA 2KSQA 4FYPA 4HVLA 3C6BA 1A76A 1GXSB 4MRAA 1C1DB 2RHTA 1EWTA 4K9SA 3OFNA 1BW9B 1GZHB 1MIOB 1RCUA 2X4IA 2I7CA 3AFGA 2R85A 5KHAA 4LISA 2OAEA 1IEQA 4H6XA 4XFKA 3O3CA 4WJLA 4C2UA 5B5SA 4KZKA 1DJMA 2IIQA 4O25A 4M6WA 2MR5A 2HHCA 5A1TA 3H9QA 4PFKA 2D0PB 2IEDA 2Q29A 1QRRA 1HURA 1RPJA 5K6RA 4ZJUA 4I0WB 1V71A 4MROA 5FTKA 4X93A 4A0HA 5A4IS 2WAAA 5J2TB 4ZCLA 1QC5A 5IJZA 2DB3A 2FG5A 2HT6A 3I9LA 4LSGA 1ZD5A 3GT3A 3D6UA 4EGAA 2OXCA 2GRJA 2JHGA 3PI7A 5KJEA 1BYIA 3I9OA 2JIRA 4WH0A 1BJRE 3K73O 4O29A 5TVKA 1V8FA 1ULZA 2NO5A 5BW8A 3PYXA 3JAMA 4KH0A 2FE1A 3FMVA 2HD4A 1J0DA 1UFQA 3OIWA 4IVNA 4CN8A 4HQLA 3K9QO 3FUWA 3GP3A 1I0IA 4MCIA 3DB2A 4BQEA 3WNDA 5M7EA 1TKBA 3EGDB 3TFQA 5IANA 2PUTA 1DKMA 1ISJA 1E7QA 3AWDA 1E9AA 1XDUA 3AHFA 3L49A 1V6CA 4YRZA 4U4AA 1X7WB 1CW2B 1SK9A 2CLIB 3ELYA 1X94A 4BLOA 1FNNA 5MN5A 4DUGA 1IXSB 4OPMA 5F78A 4DRYA 2GEVA 4MRPA 3RVQA 3VPSA 4MI6A 3R3YA 1E3TA 4YWHA 3T5TA 1ZYUA 3G8DA 4IEEA 5C4IA 1NC3A 2QMOA 3HBJA 1G3QA 1X3LA 4OB6A 1EFDN 4B40A 3NDPA 4S0XA 5BSFA 4I66A 1KGSA 4LVUA 1QS0B 3LXMA 2J31A 5KSYA 2P7HA 3OZFA 4JP8A 4B34A 4L6IA 1J49A 1W94A 4KXQA 4LBYA 3V1KA 2QL7A 2QRZA 1M0SA 3QJGA 4G84A 3JY6A 4Y6OA 1T25A 1EUCB 1EXMA 1G3RA 2DWPA 4EYQA 4GWLA 5HRCA 1N2CB 4KE8A 1VE7A 3CVVA 3K94A 1YR7A 2MU1A 1N92A 1X14A 1ZN8A 3LYAA 1C50A 1UDCA 2XDQA 3LLMA 4IGIA 2HRQA 2V7QD 5DO9A 3GA0A 3HCCA 2A7QA 1FFXB 3GG9A 4LHSA 5GINE 3BH7A 2R8BA 1AN9A 4OQ4A 3PJDA 4HGRA 2PKRA 2HGSA 4MH0R 3MK31 4DQ0A 5JWRA 4PVCA 3LI2A 4JB3A 4YEDA 1WHTB 2EZ8A 3WV4A 3MYYA 3FJOA 3F49S 1Z39A 2EP8A 1HSOA 2YWJA 3OC0A 4M0CA 4CMIA 1ZIOA 2HC9A 3LVFO 3G6KA 5ENDA 4CLEA 3NEPX 1HA3A 4AQ7A 3DVQX 3FTNA 4H7EA 1RI3A 5CB8A 1O57A 1ID1A 1GAWA 3OPYB 5LDGA 1S7CA 3PE6A 4HHEA 1K6EA 3B60A 3G3EA 3NVAA 4L3VA 4TV8A 1KFBB 3L01A 3IEMA 2BFCA 4F1WA 5AUPB 1ZR4A 1VG9B 3LYHA 1DKQA 3RHZA 1ZK3A 4U7PB 3W5BA 4DOMA 2XUJA 1WHSB 3IOBA 4GSLA 1KC3A 4ZFNA 1NXSA 4G1MB 1GNQA 3QU7A 3WIUA 1KBQA 1QVZA 2VJMB 4DDWA 3EVDA 1MB0A 4R16A 4WKBA 1XCLA 2JFHA 4N18A 3W8FA 3OX2A 4BU1A 4BLPA 4W5OA 4FDLA 1R9NA 2E7ZA 2OCAA 3IODA 2AOVA 3DL7A 1XRNA 4ZT5A 3FBGA 3KSZO 2AZXA 2A0UA 3EBOA 3TD9A 1L4FA 3AM5A 3T8YA 1DUIA 4X7RA 3BHMA 4E70A 1FMLA 2ADFA 1XEFA 2YDYA 3AERB 3T7SA 3P9SA 1OH5A 1F06A 2D0DA 4TTJA 3CUEF 2RGGA 2UZAA 4WOBA 4AP5A 2ETXA 2ORVA 1XVTA 4HC4A 5FI0B 5FLEX 2JG3A 3C16C 2X4GA 1JEYA 1KXJA 3F5FA 2IOHA 4L6AA 3VX4A 1Z5ZA 2P9TA 1K8RA 1QK3A 3OKFA 4EJ0A 3W2FA 2BUCA 4KMMA 4ZAXA 5A7GA 3B1XA 1O77A 1A9SA 4IO1A 4IJ6A 4TRRA 2BZGA 3VTFA 3O0TA 5THKA 3GNLA 1Y89A 4O4LF 5EUCA 2VSOA 3QVGA 1KH2A 4G4SO 4MR8A 3FA2A 4UARA 5T8KA 4LMAA 4Z1MD 3OFND 5IJ0A 2DWOA 2IH5A 2BGIA 1E8MA 2ZYSA 5TEVA 1UOPA 4P82A 4PR3A 4C4ZA 2UYQA 5LBUA 4CCYA 2HPAA 2H31A 4AUEA 5EIHA 4ZZ2A 1J9EA 3ZD8A 1RLTA 5LQDA 5AW9A 1U3DA 4DJEC 3WLPA 5BW4A 4MA5A 1VL8A 1YJXA 3DEIA 3T6KA 3U9LA 1JE1A 2CLHB 3BULA 2GUGA 1CZNA 3IP7A 1NI4B 2ZTMA 4ZP1A 5J1TB 1D5CA 2AG1A 1CU1A 1D2RA 1Q0QA 2ZUFA 2ACWA 5HE9A 4KQCA 3W34A 1VBFA 2XQIA 4YRTA 5JLJA 3KU1A 1ULUA 1G21E 4X95A 3HXKA 2HFJA 1W36B 3AVYA 3S28A 2G7MC 2EW1A 3A1WA 3G5AA 2B37A 4GZ5A 4LXTA 4PSVA 1YDMA 2PRYA 3ID6C 2RKWA 1OYOA 2HCRA 3PCRB 5KYUB 2QRKA 4MIYA 1XZFA 4MXDA 5I7SA 3N2LA 2AMVA 4BFLA 4M83A 1A4UA 2D3TA 4D0GA 5I9BA 5DCWA 3JARB 1L1FA 1R0LA 4AS3A 5BQOA 3T4PA 3MERA 1U04A 3U4MA 1EXNA 3HB0A 3KEFA 5TX7A 1SIUA 5T6BA 3B6KA 3EXHA 3O1HB 4GKAA 5LYJF 4ZOEA 1NA5A 3KZNA 1FSZA 2JA1A 1HYEA 1YWGO 2EC5A 3ZLJA 2PHZA 2YWFA 1KIFA 1STOA 2Q5IA 5AW4A 4J03A 4HDSB 4E5VA 5A4AA 1VRWA 2G1UA 1IZZA 2QAGA 3LZ6A 4DMFA 5H68A 1WBJB 1E3QA 2UVPA 2AFIE 2Q1YA 1TD1A 3WOHA 3FTDA 4MX8A 4UJ5A 3RC1A 5K4GA 4PO1A 5HKOA 3CNLA 4UEKA 5ALYA 1T5LA 4OOEA 4U7HA 3EAFA 5F9MA 1ESNA 5TT1A 3MBIA 4IFTA 3BN3A 4ZOLB 1Z5WA 3QTBA 5H1YA 1IEXA 2HLPA 2HSEA 3CXUA 1U65A 1M1XB 2AXQA 2H7XA 4UFNA 1BTOA 1YAHA 2C98A 1WRBA 4X41A 3ZU2A 4AKSA 1JIXA 3S8YA 3GLGB 1IAQA 1DWOA 4NYMQ 1DB3A 4S2EA 1R6BX 2BELA 2F6RA 5MFZA 1XCJA 1HWYA 2JDIA 3JYLA 3EXEA 4UUQA 1H6AA 2FXVA 4FIZA 2A9OA 4ANFA 5C8DA 1FX1A 3IMCA 4WXMA 2G1PA 2QD5A 3MSCA 3PC7A 1A7JA 2M2IA 1DT5A 5EXXA 5JH7F 3N2ZB 4NXMB 1O5TA 1Y3HA 2PR2A 2EATA 4OV6B 4CKWA 2GCPA 3DR5A 2NU8A 3UGQA 2GM3A 4HJRA 4TV9A 5JZMA 1ELOA 3B89A 3S7ZA 3R23A 1VL1A 1KO7A 3EXFA 4LQDA 3RTDA 6PFKA 2MSKA 4HNTA 5IWCA 1CB0A 3D3EA 2J6BA 2FSSA 3DCIA 4NS4A 3R7LA 4AL4A 3AO0B 1VPVA 2BZ0A 1CR0A 2II6A 5CA0A 3M4NA 4A15A 3LQ2A 4BIMA 5IXJA 1A72A 2YHIB 3HVHA 4KO4S 5FUYA 3VU8A 3U3OA 3U6KA 5TMEA 4DHWA 4UM5A 1Z4LA 1G2QA 1ND6A 1JDNA 1UXOA 2PL1A 4KXFB 5ECYA 3FX2A 1GZ3A 2ZP1A 5ECWA 4E14A 5I7EA 4EYGA 4RTRA 1BKSB 3R40A 4YY3B 2Q0QA 3JQ8A 3WLLA 3P52A 3KXDA 4UQLA 1OASA 4G97A 4F3RA 4ARSA 3S2FA 4J91A 2D59A 4QDTA 3CZCA 2G9ZA 3C8DA 3OP4A 4IHJA 3VVBA 4X71A 3WTBA 1Z0AA 3UXHA 4P3PA 3IXMA 1D6SA 1QX4A 2IXGA 4FEYA 3SIPA 2IZ1A 1ITZA 4GYKA 3B9BA 2RE8A 2AOTA 1P1RA 1G2IA 5KAPA 2X7JA 4CXMA 1PJQA 2HHAA 2WR8A 5EJGA 2QMYA 5FL7D 4I1SA 3PNVA 2IYAA 3TLGA 3VM6A 4C6HA 2PWYA 2BEUA 2I1VB 1QPZA 5F23A 2IYOA 4L22A 3I6QA 3IAAA 4BFYA 1ABFA 2BFEA 3BSSA 1YTLA 3OFSA 3OM1A 4JUIA 4KQWA 1M2JA 1QOPB 4KQ2A 3BB4A 4MYTA 1DOZA 4AB1A 5HM6A 5JQGF 4MUHA 3FFTA 3IKJA 3SD7A 2AUMA 1GNPA 3QFHA 1EJBA 2PX0A 3PQ5A 5EWMB 4Z49A 2RHRA 1U2DC 4DR3B 3DOCA 2XXBA 3I5UA 3OPQA 1ZLYA 3DFMA 5DV9A 2CJXA 1X1TA 4OH7A 4FS3A 2CEAA 3D7SA 3GLHA 1F51E 4MPJA 4YJHB 2JCVA 3S1AB 4RVHA 2E4VA 4TLAA 3TVYA 4I5DA 3QPDA 5CB0A 1PVDA 1W96A 5DU2A 5BYJA 4JDPA 1R5NA 2IP4A 3REQA 2JCYA 2P2NA 5B4UA 4OJQA 2QM8A 1M0EA 4NMXB 4ZZ3A 4UBIA 4AM8A 4HUQA 1CTQA 4OQXA 4BFSA 1GGMA 1OQAA 4NYIQ 1GILA 4QGGA 1NGSA 1RE0A 1QKKA 2JVIA 5K5EA 4ZOQI 2JB9A 2PFKA 5JMTA 4KUGA 4HDQB 3SSNA 4BTVA 1T0BA 2JJMA 1FYEA 2CJWA 1NUUA 1XA0A 3I2YX 3ROFA 4NU8X 2ZRQA 1L5QA 2E9SA 2CFOA 1AM4D 3TQQA 4H7KA 2FNAA 3RFUA 4GR4A 2F8MA 1JEYB 4EG6A 1PDWA 2XHZA 1B8VA 4XUCA 3ZV5A 4B7UA 3Q5GA 4RNCA 5DNWA 4ZDJA 3A4LA 4J4TA 4KE9A 2R0QC 4MW9A 3ZV7A 1NN1A 1JS1X 1QFMA 1VKJA 2JARA 4OLJA 4DMRA 5FDFA 1DKOA 1QFJA 3H1TA 1F7VA 1U2DA 5GY7A 1NC1A 2RCYA 3PUIA 3V2IA 4NJEB 3G5LA 2GD1O 2ZROA 3E15A 3D7MA 4ZAFA 3OTWA 3O95A 3T7EA 2C4HA 3ETEA 3JVDA 2AC7A 3REGA 1ZGBA 3N8HA 4DMKA 3TGWA 3GJ5A 4PCLA 5DGIA 1D3AA 3C7AA 2JIZA 3I37X 2CWWA 2WUEA 1UK7A 3R5KA 4QOJA 4WTOA 3C3BA 4U9HS 4XJTA 4WOPA 3WB9A 1EFRA 2OV3A 4FFDA 4JUDX 1BDJA 1O9HA 5DM2A 5BVHA 3OTOB 4QL3A 3PRKE 4M8KA 1JWLA 1H2RS 3LQ4A 5J43A 1PT5A 2GBLA 4EABA 2B69A 1NWHA 1ZH4A 4NOMA 5GONB 1OR8A 2Q41A 2YJ3A 4RADA 1FXWA 2DHQA 4OI1A 2CD7A 3H13A 4LKRA 5LWQA 4HQ6A 2HJWA 2CVOA 3EFOA 1ZN7A 4U6SA 1RAIA 1WDKA 1KOGA 3QM1A 4DFDA 4E94A 2VAVA 2FPLA 3H6GA 4OLAA 2Z04A 4TLMB 1JG6A 4OY3A 2HK6A 3FMOB 5JJIA 4RFSA 3I2FA 4HSGA 2ATXA 1A9OA 4RYLA 4WNCA 4YH1A 5TRTA 5JD4A 1PQUA 1SEPA 3AUJB 4JNKA 1OU0A 1P62B 1FFBA 3TOVA 3G2LA 4DLVA 4E33A 4XQCA 1TM5E 2BDEA 5J2UB 3IAM1 5F12A 4B09A 5CDFE 1Z2EA 4KO3S 4FWBA 1QTQA 2GTHA 2QRJA 3LA6A 2PJUA 1Z33A 1TCBA 2C4MA 2P77A 3LHKA 3SBDA 4DIDA 1GA4A 4L8VA 1T91A 1UC8A 4UREA 3O1IC 4Y1RA 1N2CA 2HA7A 2PVPA 2ZIVB 5JSFA 3KSBC 5C8YB 3AI7A 2ZRDA 5C3UA 1TQDA 2BI4A 5SZHB 3TBHA 2GHTA 3EFHA 1GKIA 4M0MA 4XVRA 5K01A 1M3SA 3SKYA 3HCPA 4I36A 2H9IA 4MUJA 2Q5EA 5JVDB 1W8IA 1R4MB 3WL4A 2IHVA 1YRWA 5FTNA 4R2WA 1NYQA 2PGOA 1K3TA 4GP9A 3TFWA 2I71A 3B5EA 5EIAA 2O50A 4NY1A 3M2TA 1C4WA 3DH0A 3IBCA 3RFXA 3RJTA 5JYBA 3GGOA 1QR6A 1QH8B 3TL3A 4PGAA 4YAUA 1A1VA 4IGEA 2NZ8A 4BLQA 2EFEB 5L45A 5CD1A 3ME5A 1RHUA 5GJBA 5C46F 4EB0A 1UJNA 3QTTA 2Q6KA 2EZTA 3CKYA 4YBZA 2H5LA 2HU7A 4IUYA 2Z3WA 1DV2A 1ZJZA 1PKEA 1XXHA 2J9RA 1X1DA 3PQFA 4CKEB 2GLUA 3AUXA 2JK0A 4O5OA 2ACVA 1JAZA 3A32A 2HYIC 4C0BA 2WTXA 3GXBA 1IVNA 3D1VA 1JF8A 4QTUB 1N3BA 1SUAA 1L2TA 3GXOA 2GETA 1XWFA 4AX4A 3L0IB 4R6WA 3E6AA 4RENA 1OXKB 2EOAA 2J3KA 3JU3A 3HNPA 1F8XA 4DR1B 3FIUA 4NOKA 3U1VA 3PQ7A 5TXGA 1EK5A 4HEJA 2ZWMA 4I9NA 3EJWA 4LXHA 3W9BA 1NN5A 1E2FA 5ERXA 5B1HA 2EEPA 3QWIA 2M6LA 5EUBA 3W77A 7REQB 1R8SA 6ABPA 3AUYA 3CZ4A 4KQIA 3DW1X 4E1BA 1BGWA 5DYTA 1UQTA 3FUXA 3L7IA 3MAGA 4FE4A 4KR3A 1PFGA 1RRMA 2GHIA 1YCFA 2JJ1A 3EDQA 5MFPA 1HNZB 5FTWA 4XDYA 1M8JA 5D1HA 1UXJA 1ECJA 4BQOA 1XEWX 3PU6A 4NCIA 1BW9A 4PPGA 3TIVA 1JKJA 4M55A 4YYZA 2PLNA 3B1VA 2E6UX 1V8BA 2D5LA 2AN9A 4JLOA 2O1SA 4HWTA 5HKKA 2JJQA 2P65A 2UYYA 2XGSA 3K4HA 2CUTA 4LBWA 3F78A 4AN0A 4EFMA 2H08A 3P4XA 1HQCA 3SYMA 4CGZA 4XCXA 1BA3A 3A31A 5F77A 1W29A 4BFUA 2UUBB 3N87A 3VSBA 1JJIA 2GZ1A 2W8ZA 1L4KA 3PXGA 4FFPA 1DDOA 1LXCA 4RU1A 1KYIA 3HKDB 3L0ZA 2FJPA 2JNWA 2P0YA 3EN0A 3PIRA 4N7RA 3QOWA 3UBMA 5K45A 5TIIA 5LZ7A 3OIVA 4FZ5A 2VJMA 5JFOA 3ZJTA 1LU9A 4I55F 1P7PA 4W5JA 2F9LA 3R7BA 3CZ9A 2A9RA 1ZDMA 4CG1A 2CWDA 2Q1UA 1BXGB 2ZVPX 4D8UA 1SMKA 1UBTS 2Q9AA 5ECDA 1ISSA 4AN1A 1W73A 1FJXA 2QN8A 1GPAA 1AGYA 3VU0A 1C9KA 4JLUA 3R3UA 5JAQA 4IJWA 4YAKA 2HA0A 1GP2A 1J24A 2ZBFA 2ZB7A 2QS9A 1HFKA 3Q41A 1LVUA 4AUMA 4BYGA 3IUPA 3SZMA 1RMTA 2EYUA 5CA1B 2BN4A 2ZI4A 2PRIA 3VR5H 2UU9B 1OFUX 4HGYA 3NHSA 3UV7A 1AHNA 1ZD2P 2PJDA 2Z9CA 4R81A 1SNYA 5KQPA 3PD0A 3E3OA 4NFHA 1G5IA 2QM3A 3THXA 1CUSA 2ADOA 3TKYA 2Z5LA 3GRUA