3AKYA

Stability, activity and structure of adenylate kinase mutants
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADFLNKLGKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE
publication title Stability, activity and structure of adenylate kinase mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Adenylate kinase
total genus 75
structure length 218
sequence length 218
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 1995-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akyA00
2ZJYA 4Q02A 2YWGA 1TF2A 1E96A 1W46A 2NPIA 2VRWA 2GK7A 4NYMQ 821PA 4HLCA 3K0EA 4NZYA 5EP2A 1CF4A 4IDPA 3I3SR 1IY1A 3IO3A 1QHYA 4PR0A 3SJCA 4URZR 1UDXA 4C3ZA 3C4JA 4TTRA 2V7QA 1G3UA 4EPYA 1FUKA 1E1QD 1FP7A 121PA 2PLRA 1X8KA 3D8BA 4C7OB 2V8OA 4LUCA 1N6HA 2ZVQX 4Y0VA 3N2IA 3UATA 4AG5A 3ADCA 2EFDB 2IYYA 4IEEA 1TX4B 4DCTA 4GSYA 3O8BA 5AJWA 3AVOA 2O8CA 1OE0A 4PAMA 2FWRA 3P27A 1U81A 1HE8B 3WRYC 1E0SA 1VHTA 3KKQA 1LF5A 4MH0R 3SJAA 1N25A 1YR8A 2AD1A 3RVBA 3U7HB 4KO8A 1SVKA 4DLSA 4ERNA 1Q44A 4MYCA 3HPQA 3V9PA 1NKTA 3U3OA 1F5NA 3CPEA 1NN5A 1UAAA 2ODEA 2J41A 3CB4A 1P4SA 3ZDQA 1A1VA 4AKHA 2K5UA 2XSZD 5JS7A 1W2GA 2ZI5A 1Q0UA 3FWYA 1U8YA 2B6HA 2JLQA 2P5SA 2L0XA 3C16C 3CRQA 2MSEB 1P9NA 1IM2A 3R20A 1M1YE 2ZEJA 1SVWA 2ORVA 3BC1A 4DCSA 4TLCA 1GKYA 5AUNB 2ZYVX 3VU9A 4UNNA 1CXZA 5FTJA 3ZH9B 4TLDA 2OLKA 2KE5A 2CLSA 1P72A 3A4LA 4BFXA 2C2HA 4RFSB 1S3GA 5CDFE 4KLNA 4EUNA 4YXWD 2GJ8A 3ICEA 4RD2A 1HUQA 4PO9A 2FV8A 2YC4C 1S96A 2CNWD 4EFNA 4Q1DA 2GETA 2VP4A 4WA7A 4JMPA 3NDPA 1HYQA 1E2DA 1KI6A 1TU3A 3A58B 4ZIRA 2WWHA 2BV3A 4M8NE 5JSZA 3FDIA 4ITRC 1NG1A 2BWJA 1FOEB 2QGZA 2WSSA 3C41J 4OHWA 1QHHB 5CM8B 3PXGA 4EPRA 3ECCA 2JLSA 5J4KA 3B5JA 4RCYA 2ZS9A 4DHEA 1SZPA 1YRAA 3QSYA 3ADKA 1E9FA 5FOUA 3RS3A 5B57C 3KXLA 4IVRA 4DCNA 2J0UB 2ZJ8A 1C1YA 2R6CA 4BPBA 3EPJA 1GRNA 3QXXA 4FMCB 4XVRA 3QJYA 1E9SA 1NBME 4KFRA 4B74A 1AM4D 4I1UA 3RDPA 1SKYB 1E4YA 1Z6TA 3BGWA 2ZJ5A 5CJ2A 3U7GA 1E2IA 4MRNA 5LB2A 4FCVA 1E94E 2RAPA 5G3ZA 2O8EB 2EYUA 3ZS8A 4DLXA 2AWOA 3IGFA 4PZZA 3I8SA 3LX5A 4RJLA 5KPJA 3CIOA 4JJZA 4P0TA 4PAOA 3MSXA 3BORA 4NCKA 3CF6R 3B1WA 4DIDA 1QHHA 2CVFA 1EXMA 1QVAA 4U5XA 1KI3A 4OI0A 3SJBA 4L9WA 4BLQA 3LVQE 5C46F 3CH4B 3V4RA 2OEPA 3FKQA 1AZSC 4TT3A 2ODWA 4EPWA 2BOVA 2D06A 4C0LA 3AV0B 2XB4A 2AX4A 2ZPTX 1KK3A 5HCIA 1JJ7A 1OXXK 1JALA 4HI0E 1WMSA 4DXAA 2H57A 3DM5A 4GT1A 3TLXA 5FBQB 3M4YA 3CR8A 1QRAA 2R6FA 2IT1A 2BKEA 3L43A 1OIWA 4GOKA 5L3VA 4QXAA 3EA5A 1LS1A 3GLIE 4EPXA 3THYB 4Z51A 4TMKA 4M1OA 1XJQA 4PFSA 1OV4A 4F4JA 2FDCA 4HAVA 1EESA 2RGGA 5C4GB 4TMZA 3TJZA 2REBA 1AGRA 3P32A 3TVTA 2IYSA 4BFZA 2NZJA 4A9AA 1I4TD 1HT2E 3HR7A 3WMEA 5CLLA 4NYIQ 4JVLA 4PHHA 2OCYC 3TVDA 3JVVA 2LKDA 4I4LA 1NMXA 1OFIA 1P61B 1PZNA 4NH0A 5GVSA 3AKYA 4S2EA 3HR8A 3U44A 1QHIA 2YJTD 1CR4A 3AGQA 4EFLA 4WIAA 5F9FA 4XSGA 1CP2A 5JLJA 1KI6B 4ZIRB 1KSGA 1DOAA 2GCPA 2ONKA 4AYXA 1G41A 2BCJQ 1P60A 4B32A 2ZRGA 1IN7A 2ZTSA 3ETLA 4KHZA 4B71A 2ZJAA 4B3XA 5FUYA 2A30A 3R8FA 2J0QA 2WHXA 3EPLA 3VAAA 2ANCA 2VBCA 3LQRA 1SKQA 2W6IA 1Z0KA 3HU3A 3T1OA 1HT1E 2X77A 3UG6A 2VP2A 4LYFA 4DLZA 1HTWA 3EAQA 2NO9A 4LJ7A 1KY3A 3DM9B 3GEEA 4B3BA 4PQFA 3LBHA 1JB1A 1FPMA 3LA6A 3DVLA 1OB2A 4MKHA 1J8YF 4WXRA 2V6JA 2C98A 3PIRA 4Q9JA 4LWZA 2F1IA 2FX3A 4TMWA 1IBRA 5BN3A 3F3YA 3BRWD 1WQ1R 4M1WA 5JI3E 3TQCA 1E9BA 1Q1QA 2IYLD 3K1JA 2OV2A 2F9MA 3PR1A 3H0KA 1JPJA 1S1CA 2IC5A 1E69A 2B8TA 5HZHA 2JEOA 4UQOA 4A2QA 4XTCS 3EWAA 3WYFA 1P73A 5BQ5A 3MAAC 3BS4A 4OQFA 1NSTA 1UPTA 3QXHA 2A78A 2GCNA 2UZIR 2FGJA 1N0VC 2XEXA 2BMDA 1ZP6A 2IWHA 3SE0A 2E9SA 1XX6A 2IYTA 4IDOA 1YVDA 2Z5FA 2F55A 2YWHA 1SXJD 3MWJA 421PA 3Q7PA 4US0R 4XVUA 2JLXA 2W6JA 4PXAA 2ZRFA 1XEWX 1ZNWA 2W2XA 1YZQA 1ZRHA 2FEOA 2HCBA 1KDOA 4IFBA 1E9CA 3V4FA 4E07A 4TQ9A 2YWFA 1NI3A 1A7JA 2Z0MA 4G5GA 1N2CE 5HR5A 1HQYE 5EP4A 4HB3A 3EIHA 1M7HA 5L3RA 3QPWA 5GVRA 1W48A 3K53A 2CDNA 3IKJA 3L0IB 5FBWB 1E2MA 3KJEA 3TK1A 4OI1A 1WBBA 2F43B 2LWIA 2XNDD 4M1YA 1XCGB 2EYQA 3A8TA 4HB4A 1IONA 3UMRA 4EJSA 1JXOA 4NCJA 1MOZA 4TMXA 2VTKA 3GJ3A 1IAQA 4OQXA 1AIPA 2BMJA 1UBFA 1VG1A 4FMBB 2AXNA 5KUTA 1CJKC 3U7EB 1SVIA 3CONA 4OBEA 1S9HA 2IX3A 2IBMA 5J47A 3PUZA 3EPKA 4ACAA 3EARA 1KY2A 4C0JA 4N0EA 4JL5A 1NLYA 2WVJA 2PMKA 4AKGA 4ZCMA 3ZS9A 1E9EA 1M74A 2B21A 2GXQA 1CJMA 4R98A 2IEYA 5EUQB 2B7BA 2ECKA 3BAFA 1PLKA 2ZRLA 1A5TA 4QC2A 2NPFA 4C30A 2J7PD 4BEBA 3OAAD 3OZXA 1Q1EA 4IDHA 1H8HA 5TARA 5AR1A 3Q85A 5D3QA 3B9PA 1R0YA 3ND9A 4EQ6B 4IVPA 4XWKA 621PA 1AQYA 4ZI3A 3C14C 1JNYA 721PA 3MMPA 1T3SA 1WF3A 3TH5A 4P3YA 1XU4A 2QY9A 3P4YA 2GAOA 2OILA 4M0LA 1YU9A 4JLDA 4HLUC 3KX2A 1X3SA 1SXJA 2ZANA 3SHFA 1W36B 3EZ7A 2FFHA 2FSGA 4URUR 5JBQA 4JYCA 5DN6A 4PO8A 2A5DA 3FMOB 3AVXA 5EE3A 4H1UA 1MABA 1YR9A 3PVSA 1FNMA 3WMGA 2DHRA 2C96A 3FOZA 3ND8A 4KITB 2HJGA 1GIAA 3I5YA 4JYBA 2VP9A 3QXJA 1YZKA 1AJEA 3GJ6A 2EQBA 4LI0A 3HYTA 4A6XA 4M9QA 2G0TA 4NONA 2NGRA 4M1SA 1E9RA 1L7VC 1W0KA 3QIAA 1V5WA 1U9IA 2RGBA 4J0QA 3ZVRA 5CB6A 1NG9A 2QAGB 3U4QB 5KDDA 4YQFA 1M8PA 2J0VA 5SZKB 4HUQA 4HDQB 1Z6XA 3TR0A 3LLUA 5DO9A 3LBIA 4Z54A 2YWEA 2GCOB 4AIIA 1KO1A 1KAGA 2ZS8A 3BFVA 2Q21A 3AF3A 3K9HA 2FPMA 3OFND 4P33A 1W36D 2QL6A 3MD0A 1ETUA 3IPXA 3KZ1E 4JJKA 4KODA 3REGA 2KBFA 4RKEA 2R8RA 3SBDA 2EFHB 1P9WA 1R10A 2TMKA 2A2ZA 4CT4B 4Q4JB 4QHTA 4DZZA 1CR0A 1T5LA 2IHYA 5B30A 3DZDA 4PQYA 1FP6A 2EFCB 1LY1A 1Z08A 5LBIA 3F5FA 1KMQA 2PJRA 2OE2A 1Z0IA 5EZ5A 5K8IA 3FKSD 1DAKA 3EX7C 3IUYA 3SQXA 1XZQA 3RNLA 5CIQA 1E79D 3VMFA 2C9CA 1T8UA 3OIUA 5JWRA 2I3BA 2XXAA 2ZXUA 5HZKA 3JZMA 4PSKA 3GLGA 3GJ7A 4Q47A 1CRPA 4QGGA 1NVUQ 2G77B 3VKHA 1II0A 3F0TA 5E3HA 2O0KA 1KNQA 1U90A 1MV5A 2AFIE 1A2BA 1ZMXA 4B43A 1A4RA 2ZI3A 3GQBA 5JS8A 2JLYA 3EIQA 1NBMA 4RCZA 1J70A 3T1VA 1T8TA 4Q19A 5K8UA 1KO4A 2AK3A 2V7QD 4IXMA 1GRQA 2JLUA 1XTRA 1Z83A 1VG9B 3L0PA 4IRUB 4NBSA 4NE2A 4R7ZA 4ACBA 5L3SA 4IXNA 3K0CA 2DBYA 3TR5A 2KWIA 4P4SA 3ZD7A 4EJSC 1EX6A 3SYLA 1EWRA 5K8TA 5KHOC 2ZE6A 1T0HB 3MLEA 3K0AB 4C0KA 2OCAA 4MYHA 1G21E 1UADA 1NL3A 1OXUA 3ONWA 4OQNA 2QTVB 3U61B 4HDOB 4ZKEA 1DBSA 3T1QA 5KSZA 2NQ2C 1XNJA 1XTKA 2QA5A 5K8LA 1W0KD 3LY5A 1Z2CA 4NMMA 2V3CC 2MMGA 3GD7A 4AKIA 5AUQA 3U3RA 1ZD9A 1FX0A 5FUXA 4M9XA 1Q3TA 1K6MA 1E2GA 1B0UA 2D7CA 5G3YA 3EA0A 1E99A 1Z8FA 3GJ5A 2OCPA 1S1MA 4PC2A 4CYMA 3WHLA 2QRZA 1B23P 4DKXA 3LFUA 1OJLA 4GMDA 4NYMR 4X8OA 2GJAA 1CJTC 1N6KA 2OBNA 2OFWA 3X1ZA 4F93B 4OK3A 3CNLA 4JLOA 4MRSA 2ATXA 1KSHA 1VTKA 3TNFA 5GADl 3U6BA 2VHTA 2P0EA 2JJ1A 4DB4A 2QMUA 2ZETA 3BH7A 3QE0A 521PA 2C77A 2VEDA 2X19A 1XF9A 2ONJA 3P20A 3MGCA 2GJSA 2QBYA 1A82A 4DSTA 4WVFA 3REFA 1SQ5A 3U6KA 1R2QA 2IEZA 4V0OA 2WM9B 2IYUA 2G1JA 1X8LA 2WWGA 4A0HA 5C1BA 5L8VA 2XNSA 2XITA 5FL3A 2DPXA 3G0HA 1PUIA 4BEJA 2EWVA 2IUTA 5E4FA 2NZ8A 4G5RA 2D62A 3KTAA 2FU5C 1KI8A 3CNOA 1I2MA 3IIKA 5IRCD 5LD2B 1QHGA 3VKWA 1GNPA 1NN1A 3K9GA 4XWOA 4JLKA 1NN0A 3QKRA 4CEJB 2REOA 3LX8A 3B7GA 5JWOA 2CK3D 2V55B 3MCAA 4RVCA 2MSCB 1X1RA 1T3HA 2JATA 3VR2A 4HAWA 4ZCLA 3EZFA 1KZGB 4FINA 3B6EA 3CZPA 1XMJA 1II9A 5J4HA 3UKDA 3FFBA 1OIVA 4Q7MB 5A0FA 5KSYA 2A9KA 2ZE7A 3OIWA 3AP1A 1ELOA 4PSAA 4GP6A 1N6PA 2BC9A 3AVWA 2C5LA 2VH5R 1F2TB 1YZUA 2JLVA 3AKEA 3WXMA 3WYGA 2A5GA 1JAIA 2R9VA 2KSQA 3UXMA 4JSTA 3SYKA 4AD8A 2WWIA 2ZSFA 2Z4RA 1XCMA 5CK4A 4JVMA 1PJRA 1SGWA 1RZ3A 2FA9A 2YOFA 4TSFA 1FL9A 2DCUA 4PPFA 4AKEA 1OKKA 4BLRA 4TL7A 2JA1A 5KDOA 2QRNA 5KSPA 4QJ4A 5FBLB 3B9QA 1GKIA 1IOZA 4Q9IA 2IS1A 1DG3A 1TMKA 5IDVA 1S2MA 3RLFA 3ZQ6A 4FN5A 3PEWA 4YONB 3HYRA 1RRPA 3BERA 4QBHA 4AYWA 3RS2A 3SJZA 5LD2C 1KTVA 1JAHA 1UM8A 2ZJ2A 3RRMA 2O8BA 4A2PA 3OEHA 4YMWA 4HB2A 1XXHA 3GLIB 2BM1A 4KFTA 3BWDD 2NIPA 2AK2A 1L4YA 1HV8A 2GXSA 5HKKA 3GLHA 4W9MC 4TYPA 1AGPA 2V9PA 3DEFA 1KOFA 3BOSA 4ILEA 4PTLA 1CTQA 4EDHA 4IFEA 4QKQA 4Q4LA 1E9DA 3VR3A 2Q6TA 1H8ED 2FNAA 1P2TA 2ZJZA 4HYYA 4B3DA 4RFSA 1UDWA 2H18A 2JJ8A 4LJ9A 4MYTA 2R6DA 4BFVA 2O8FB 4LCBA 3U2QA 3UG7A 3C5CA 4BRUA 5AJYA 1ZCBA 2BEKA 3CWQA 3SS8A 3IDQA 4B3CA 3GLGE 3BB3A 2J0SA 1IHUA 1T6NA 2IS4A 4PPQA 2OO7A 2HXYA 2VYFA 4OQMA 4P4TA 4TL9A 2BKUA 4JL8A 3TAHA 4E09A 4TYYA 1L2TA 1XTQA 2EFGA 1OXTA 4H9GA 2XX3A 5DHFA 1UEJA 3UMSA 3C15C 3EPHA 1E3MA 1GZSA 3OEEA 2WJHA 2CJWA 4MQBA 4DLTA 2GJKA 1R0WA 4Q4AA 2GBLC 1NN3A 1ZU4A 4URYR 2NO1A 3EW9A 4WW0A 4ESHA 1ZAKA 2ZSDA 4V0LA 1P2VA 3VHXA 3BIFA 3FPAA 5CB8A 1KI1A 2GF0A 1YZNA 1VYTA 1W0JA 4B2LA 3O8DA 3K0FA 3EC1A 2CL6X 1FTSA 3B2EA 1GOTA 2O0JA 1JECA 3GEIA 1MT0A 4KCGA 1DTSA 1XPRA 2AXPA 2GWHA 4JL6A 2J9RA 3T5DA 4Q4AB 3H86A 2KJQA 3OEED 3QG1A 4BFSA 3B1XA 1E2LA 2DWOA 3M1IA 1FX0B 5D3MB 1BYUA 3CRVA 3L0OA 3Q5DA 2BBOA 2F7SA 2PEZA 2JASA 4A8JB 2A5YB 4U00A 3T15A 3VFDA 2QP9X 2GEVA 4A0GA 1KJWA 1G9XA 1JEEA 1E2KA 3U44B 1MO6A 3PUWA 1CR1A 3QY0A 4QFMA 4A4DA 4B48A 1DO0A 2ZYWX 1IJEA 4BGDA 3E2IA 5G41A 4GBMA 3T06B 4IOLA 2PX3A 1OT3A 3EZ9A 5EE0A 1SVLA 1T3LA 4PPNA 4AURA 1VCIA 1H8EA 1Q12A 2RHMA 3RRYA 3Q9LA 1BIFA 2QM7A 2PLFA 3NHAA 3RRNA 1KIMA 3QXCA 1ZYUA 2HF9A 3BD9A 4M4SA 3GLFA 2J46A 4TT3D 1LFDB 4D26A 2O8CB 2P5TB 2UZ3A 5L3QA 3T1TA 1ZD1A 2ZR0A 3WRXC 5FBRB 1W4CA 1KI2A 4C7OA 2YOHA 2DFNA 2JJ2D 4XD7A 5DI9A 4G01B 4FWTA 5HE9A 5JJLA 1G3QA 1KNXA 1VECA 2CCKA 3CW2A 3KQNA 1JEDA 3VR5A 4LC0A 1Z5ZA 5B64A 3K70C 2QMOA 2ZRCA 1F2UA 2IYRA 2AKAB 3ASYA 4JLMA 3FMIA 4LHVA 5EXSA 2H7VA 3TKLA 1E6CA 1GP2A 1W5TA 4Q1FA 2Q3MA 4YC7A 4XTRA 1M7BA 2B92A 3OE7A 3PEYA 3K9LA 5DNYB 2CLCX 1XMIA 4A2WA 2JLZA 5AJZA 5J4YA 4ZDKA 1EFCA 4LJYA 1TQ6A 4Q7LA 2Z43A 4D0LB 3GP8A 4L9SA 1Q1ZA 2JIZD 4JIMA 2DWQA 5BYJA 4IW3B 3NDBB 1ZM9A 4URXR 1Z0JA 1ZUHA 1IXRC 4Y0AA 5ELXA 1F2TA 1KDTA 1Z2AA 1XWIA 4LHYA 5IF9A 3A6PC 2GILA 2ODBA 5CITA 1YKSA 3QKTA 1CJVC 1XJ0A 2H5EA 5J40A 3U3JA 1KJZA 4OHVA 3RRZA 4Q00A 3GMTA 4EFMA 3SYNA 4KAXA 3A1WA 4CEHB 1OSNA 2ZI9A 3THXB 4CGZA 4DJTA 5JEDA 1FTNA 2HDNB 2IXGA 2WSMA 3B8HA 2DFTA 2IYZA 2VF7A 4GP7A 2CK3A 2IYQA 4ON9A 3B82A 4WBSA 1G8PA 2YYZA 3W6NA 4A36A 1FQJA 4BFTA 3A1TA 4GOJA 2YZ2A 1LW7A 3AQ4A 4Q9KA 3RC8A 5EXXA 4V02A 1AS2A 3C8UA 1O87A 4E03A 2FSIA 1J90A 2WBLC 2OAP1 1XRJA 4NL4H 1YHNA 4GNKA 3U3KA 1IXSB 2D3WA 3DDCA 2IF2A 2WMNB 5FUWA 3WHKA 3AF2A 4LHZA 1HURA 1NVXQ 4OJQA 2ZRIA 3BH0A 1SXJC 3RS4A 3UK6A 5C4MA 3HPRA 2RB4A 1AZTA 1KO5A 2HLDA 5GJVC 4I1SA 1NVWQ 5TV2A 4KVGA 1S4QA 4MGZR 5FPYA 4D4KA 1HQCA 1US8A 4B3GA 3CF2A 4ESVA 1G7TA 4KU4A 4MGIR 4JSYA 3QF4B 3QKSB 1Z6AA 2WPDA 1UF9A 1DPFA 3BBPA 4PC1A 5HTKA 1RC8A 5E7JA 1WRBA 3H2YA 1ZUNB 2FOLA 1S9DA 4XSHA 4B47A 5D3MA 3VR6A 4C0BA 3N5CA 5EJEA 4V0MA 2QP4A 4RZUA 4XWAA 1H8HD 1AS3A 3OHMA 2QI9C 2HYIC 3PG5A 1U0HC 4GL2A 2ZI6A 3RS0A 4B2IA 1A2KC 2ORWA 2ANBA 3CBQA 4I81A 4BFYA 1E2QA 1XTIA 4LV5B 1D2NA 4ZPXA 4YMVA 1XFAA 2ZSBA 4BE7B 1G5PA 2WSSD 2FG5A 3KFVA 3CPHA 3QVVA 1TADA 4X8MA 3MWYW 4TN1A 3I72A 3NHBA 3A36A 1OHHD 3SEAA 4URWR 1E0JA 1BO6A 3L82B 2GKSA 2FPLA 1JJVA 3K70B 1E2EA 4UNRA 4MKGA 4DT1B 2QPOA 3A1SA 3PENA 1OYYA 2CE2X 2J59A 4LBYA 3ZZTA 3C7KA 1VG8A 2O8EA 4B6EA 1F48A 1EGAA 3Q8XB 1MRNA 3NXSA 4LRWA 1DELA 4MGYR 3QF4A 3GJXC 2D7DA 3T34A 4BRWA 1G18A 1G7SA 1VDZA 4LK2A 3VNVA 4JLPA 1E1RA 4MKIA 4ASUD 4HLDA 1COWD 1II8B 1VYVA 4TYWA 3KKNA 2WOJA 2AD5A 2QG6A 4LHWA 1YR6A 5HE8A 2EWWA 1MRSA 4TMTA 1TQDA 1TPZA 1ZC3A 3P26A 1ZBDA 2F1HA 1Q22A 3LAWA 4GDFA 4FXPA 2HF8A 3ZVNA 2Q3FA 4C0HA 4Q21A 3X1XA 2WWFA 4CZ2A 3I4LA 1XD2A 4X8HA 2ZI7A 4QNMA 5EP3A 4C4PA 5JECA 1AKYA 2CHQA 1W0JD 3K09C 2D2EA 1T5IA 1XPOA 3BH6A 2KBEA 1HA3A 4TLEA 1YJ5A 2QAGC 5FPHA 4G1UC 3JVUA 1NVVR 4CEIA 5CLQA 4G5QA 3NBYC 1QG4A 2PH1A 2YC2C 1G19A 2HYDA 3LVRE 5FTNA 1Q57A 2YV5A 3THWA 2FN4A 3AGPA 2NG1A 4RZXA 2IUUA 4HUTA 2ZRPA 1R5OA 2AHOA 4R9UC 4FD2A 3LXRA 4Z1MD 1COWA 2DFKB 2XZLA 3T12A 4JKYA 5DIFA 2WWYA 3AEZA 3RWOA 5BWMA 3U3MA 4R2IA 1AKEA 1JQLB 3NEYA 1KMHB 3FGNA 2F1RA 5FOTA 5FOSA 2GZHA 2GTPA 5JHHB 4JBWA 5JWHA 1W49A 2ZROA 5JHGB 2H1LA 4DDUA 3QQ5A 1Z6YA 1OIXA 3QEJA 2RCNA 2ZE8A 4LOAA 1OH8A 1NVVQ 1W2HA 3KL4A 2PZEA 1RJ9A 2QE7A 4HZUB 3A1UA 4M21A 1OW3B 4IHQA 4M53A 2VHJA 3NC0C 5JMTA 4TMVA 1NIJA 1U9IC 1OPXA 2J3EA 2R2AA 2V1XA 1GNRA 4JT2A 4RKFA 3UMFA 4FIDA 3PEUA 3DZ8A 3DKVA 3EXAA 1NSFA 2XOKA 1XBTA 5UKDA 1ESNA 1R6BX 1ZUIA 4M22A 4DLYA 5TXGA 1TU4A 3HWSA 4ZDJA 1OH5A 1R8SA 4Q4HB 2VSXA 1CRQA 1OKKD 2G6BA 2JGNA 2YOGA 4PHGA 3RHFA 1L8QA 4KJZA 3FE2A 3FHCB 1XTSA 1E32A 1QHXA 1KSJA 4KI0A 3MUFA 4KYIB 2N42A 2WJVA 2BDTA 4LYAA 3R7WB 1FZQA 1II8A 2P6UA 5DGXA 1KSFX 2NO0A 5DE3A 4DLVA 5JEEA 4TZ0A 1GVNB 1ZD8A 4BASA 3O8CA 4Q03A 2HT1A 2QBYB 3ZZUA 2HT6A 2O8FA 2VPPA 1CS4C 3D31A 3CF0A 3OF5A 2W2VA 4OK6A 5ANRB 3D6TB 2VSOA 4Q48A 3LQQA 4D4LA 2F9LA 3H84A 3IILA 4JVNA 5DHAA 3QUSA 2NTYC 2QSZA 4DEXA 5BN4A 4NKRA 3I5XA 1Z63A 2NO7A 2GRJA 1OYWA 1BYIA 4ABYA 2P6NA 4GI7A 1GG2A 4TQUS 1O3YA 2ZYTX 4DWJA 1OLOA 5J4VA 4V0KA 1HEIA 1E98A 5AK0A 4LBWA 1W44A 5KPDA 2D2FA 1E2NA 2O8BB 2IYWA 2YINC 4D4JA 1OHHA 1T91A 1HE1C 2CNWA 4UJ5A 5E7IA 2CCGA 2VQSA 2GXUA 4IVQA 2BJVA 1RJ9B 4NYIR 3VQTA 2GEDA 2ZM5A 1OF1A 4HEJA 2UKDA 4ZO4A 1OH7A 1TUEA 2N1BA 2YNMA 5JZVA 2A5FA 1BMFA 1H65A 4M9ZA 4NU0A 5KTYA 3VNUA 3MRSA 3KKPA 4Q01A 1UEIA 2RHDA 3LV8A 4L16A 4GFDA 3UWOA 3TBKA 3CNNA 2F43A 1V43A 4BWYA 1LF0A 1KZ7B 3GJ4A 4QBFA 4QL3A 5KYKA 3LNCA 4WXPA 2XTMA 2OFXA 1KK2A 3V00A 3A1VA 2JDIA 1RRFA 4JLBA 2C04A 3RC3A 4A92A 2FH5B 2O8DB 4DLWA 3UIEA 2RH5A 2XTZA 1RIFA 2REXB 5JCZA 4P4SB 3L8YA 3I32A 5JFGA 4FMDF 3CRRA 2RKOA 4FCTA 4KXFB 2OESA 1WBDA 3RAPR 2GVDC 2ZS7A 2CCJA 2PZFA 2BEJA 3E1SA 5JRJA 4QM7A 4LX0A 3BB1A 3D7MA 3MG9A 3WP1B 5KNDA 1D5CA 3ZZ0A 3SDZA 1N5KA 4KBGA 1FMJA 1ZJ6A 2RGCA 2IYVA 4ZDWA 3SBEA 1W4RA 5FI1B 4H1VA 3HU2A 1VCOA 2RGXA 2G3YA 5H68A 4AG6A 5FH9A 4GZLA 1XXHB 3TE6A 3GLIA 4Q9HA 3GLGB 4POAA 5EZ6B 2QROA 4OK5A 3DL0A 4QHSA 1RKBA 4G5OA 2F6RA 3I92A 5J5CA 4B34A 1E0AA 1VCMA 4DIEA 4PO1A 5LDDC 1OH6A 3Q5EA 1HY3A 4RD3A 3H4MA 5AUOB 4BLOA 1OFHA 2ASEA 1Z29A 3CX6A 2ERXA 3QXSA 1ZINA 4G3XA 2ZUBA 1P6XA 3AUYA 1KK0A 1EWQA 5BW8A 2OBLA 4PAQA 5E95A 1IN4A 5FI0B 5G53C 2V54A 1F60A 2OCBA 3C5HA 3HP1A 2IW3A 2P2LA 4HAXA 1Z22A 5FR2A 4WAUA 4HAUA 2ZU0C 1YQTA 4Z1MA 2AL7A 2OM2A 3QI2A 2VHUA 4F7WA 1GUAA 3MWKA 3K0SA 2IXEA 2GK6A 1DAHA 2WKPA 2CL7X 4B6FA 5DI3B 2GA8A 4M2LA 3NH6A 1JBKA 2MMCA 2QMHA 1N0UA 4KBFA 3SN6A 3WNDA 1SVSA 4M1KA 4QJ3A 4YDHB 3CX7A 1W47A 4Q1CA 3S1AA 2VSFA 1XEWY 4YDSA 4A0RA 5CJPA 1VPLA 1RVDA 3CRMA 1SXJE 3NTUA 1ZIPA 2AR7A 5IK2D 3QF7A 3GLHB 1UKVY 3AF0A 1VCNA 5EXTA 2XJ4A 2NO6A 4M1MA 1OFUX 1IY2A 3KTAB 3AH8A 1XD8A 1JR3E 3ZYCA 1XDBA 4O0MA 4M9SA 4YMUA 1M7GA 1KI4A 4C0AC 2QE7D 3EC2A 3QBVA 3NBXX 4DDWA 4MKFA 2J1LA 4NYJQ 2ZQ5A 4RD4A 1KJYA 3TIFA 2EW1A 2QNRA 1W4AA 2PT5A 3AVQA 4JLVA 1D6JA 1PV4A 1X86B 2CVHA 3M6AA 5DLQC 2JAQA 3W90A 1G1MA 4KSBA 1L4UA 4QBGB 1UKZA 2Y8EA 5KSOA 1EFRD 2RGDA 2CHVA 3FTQA 4RSGA 4F38A 1KDRA 1Z0DA 3PQCA 5KO2A 2IHBA 3SU8A 4TQAA 1SULA 1K5DA 2HUPA 1XEXA 2PX0A 4JZKA 2ZR9A 2NOAA 1G5TA 1G17A 2QM8A 4TZ6A 1R7RA 3MJHA 4LY6A 4HAZA 3ZVMA 4PC7A 2XGJA 4KVAA 1OXVA 1LB1B 2FSHA 2H92A 3GJ8A 3FMPB 4FMCF 4IDNA 2WJJA 2OSBA 4UKDA 5AJVB 4BFWA 3KQUA 2YKGA 4NPHA 1BKDR 2W2TA 3LD9A 2W58A 2QQEA 3W9YA 3AM1A 1ANKA 2C99A 2H17A 4FWIB 3RSOA 3T61A 2P67A 2QTHA 1KYIA 4LBZA 3THWB 3MJRA 3K09A 4P4UA 3ICQB 2WICA 2QGNA 4L5BA 1J7KA 1E2HA 1IQPA 2YHSA 5DN6D 4UXIA 3IQXA 1E79A 3NBZC 1TQ4A 1MO5A 2HXSA 1RPZA 4K8OA 4Q9LA 2FEMA 3HDTA 1JQJC 1N5LA 4PHFA 3IEVA 1ZM7A 4GMXA 2C9OA 3PUVA 4V0ME 3SR0A 3IO5A 4HATA 3GLFB 4F92B 1Z6GA 1U8AA 2GESA 2PEYA 1TTTA 1Z47A 2OUKA 2FFAA 4HAYA 4Z8XA 2IWRA 2ZRBA 2EFEB 4URVR 1CEEA 1ODFA 3VX4A 3FYHA 1ZM4A 4B2PA 4QGAA 4PX9A 2J7PA 1ZM2A 2LCFA 4QBIA 4V0NA 2OXRA 3DOFA 1ESMA 1F2UB 3GCGA 3KDSE 4NP6A 2C8VA 3R7WA 1C4OA 2OLJA 4MUBA 4TTQA 3LW7A 1XMSA 2LKCA 2GJ9A 4DUGA 4F4CA 4MRVA 4AY2A 4CEIB 4BZXA 3EG5A 4PHTA 3AKCA 1KGDA 4LZZA 4QJ5A 1W1WA 1XB2A 2BHRA 3FFAA 3TMKA 4ZCIA 4HSEA 3LXXA 4MDFA 3RS7A 4GOXA 2DWPA 1UFQA 2PMDA 1G3RA 4Q4HA 4EIWA 1DAFA 1E9AA 2YVUA 4ARZA 2VIIA 2C03A 1NMZA 5DYIA 3IHWA 3CWZA 2QPAA 2FF7A 1G291 3QENA 1UKEA 3OEHD 3LWNA 3O8RA 3KB1A 2MSDB 4Q1BA 3SFVA 5KU1A 1VIYA 5J4LA 2EU8A 3THXA 2X2EA 3BK7A 4LHXA 1FMLA 1G16A 1P3JA 2WAXA 3UWKA 5FTKA 2BJWA 3ASZA 4HDCA 4LBVA 1XD9A 2ZRAA 2ZRNA 4IOKA 4UXJA 5KDLA 5A5GA 1QBKC 1VG0B 4XH9B 1RYHA 1YZTA 1E0KA 3U60B 4BUJA 4WZAE 3D3QA 3X1DA 2JIZA 2WIAA 4D0GA 3W3ZB 2A7QA 1BS1A 3RANA 4EKDA 2XSZA 4HB0A 4TSFD 4CIDA 3SQWA 3Q72A 2ZRMA 4B44A 4JLJA 5EE5B 4O3MA 1PLJA 4IDQA 2W6JD 1NNEA 1CIPA 4KSCA 3X1WA 5LPNA 3AVVA 2ZYUX 5TB5A 1G6HA 3T35A 1C9KA 2HLDD 4HZIA 4JBYA 2JCSA 3UANA 1N5JA 3DMNA 5M04A 3PUXA 4MITA 3OAAA 1LTQA 4I1OA 2EVWX 2XZPA 3I61A 1Q20A 3LW8A 4CW7A 1AA9A 1YE8A 2QT1A 5TMPA 3GJ0A 3DOEA 4NCNA 2QENA 3AF4A 4I99A 1PUJA 4G0NA 1X1SA 3ZLJA 4OHXA 2A3RA 3IIJA 1ZNZA 1DAEA 2BVNA 1DS6A 5H70A 3BJIC 3QBTA 3TQFA 1GTVA 4UNQA 1VKJA 1M34E 1KI7A 4F91B 3RYTC 1P2SA 4MUAA 2ZAOA 3N70A 5CYOA 4JT4A 2OFOA 4O2LA 4YXWA 4NCIA 5DSZA 2C95A 1R5BA 4BECA 5FPKA 4HZUA 3X1YA 3VR4A 4LC1A 1F6BA 4KV9A 4FMDB 3SI7A 2R6AA 3KJHA 1US8B 1QHNA 5C2JB 2FJUA 2I1VB 4KFUA 2DB3A 2GZAA 2ZE5A 3PEVA 1N6LA 3AVTA 2R44A 3HU1A 5GJBA 5HCNA 4P31A 3AVUA 5FOXA 2WJIA 3KUDA 2GVZC 4HLUA 4A82A 2X1VA 1OB5A 1J99A 1EG7A 5FOVA 2I1QA 1G8YA 4C0QC 4OKSA 3PITA 4B75A 3QKUA 3P1JA 5BYKA 5JRZA 1JR3A 5EP1A 4RD1A 4FCWA 1DAMA 3NEJA 1G8HA 3WBKA 4K81B 1N6OA 2G88A 4BZQA 5IK2A 5FL7A 2IA5A 3BXZA 3VX3A 2VF8A 2QP3A 4KYUA 1FW6A 4AK9A 1X6VA 2E1RA 1MH1A 5F2EA 1SHKA 1QG2A 4UJ3A 4TYQA 3WYAA 1GKUB 3M0EA 1G4AE 1GL7A 2QAGA 1G8FA 3R9XA 4DC9A 1IY0A 4AC9A 3TRFA 3LLMA 4EPTA 1DARA 5HPYB 1TEXA 2SHKA 1WDTA 4XIGS 4XD7D 1SVOA 5DISB 3T5GA 3CLVA 1N6NA 3QEOA 4RFVA 4B33A 5C18A 4D2IA 1XD2B 2VO1A 2G9NA 8OHMA 1JI0A 4N0DA 3SOPA 2VP5A 1J8MF 2J87A 5IHPA 2O52A 1F3OA 3SC3A 2XZOA 2WWWA 3VTKA 2IS2A 2WJYA 4DSNA 3W6PA 3OFNA 2QEQA 3KQLA 1KI9A 4IKEA 2KI5A 4EPVA 1JR6A 1EFRA 4O2RA 4YLGA 4PC3A 1SKYE 1E2FA 1KHTA 1D2MA 2CE7A 5F9HA 2ZUDA 1U2RA 2Z83A 3QKSA 4LPSA 1ZM3A 2V1UA 3AF1A 3B1YA 3LDAA 4MYUA 1QVRA 5DYGA 1EK0A 1TEVA 2G0NA 3GEHA 2OHFA 3RWMB 1RW4A 5AWFC 2R6GA 5JI2E 2WMOB 2VL7A 2W6ID 4D80A 4OI2A 4DLRA 1R0ZA 2D74A 3ZQJA 3KKOA 4C2UA 1S3SA 4LYHA 4DCVA 3PJRA 5CYPA 3W5IA 4B73A 1XTJA 3K9NA 3OESA 3L8ZA 3I62A 1DVRA 4D25A 1UJ2A 4WZBE 1K8RA 2OBMA 3N2EA 1VMAA 1IN8A 1X8JA 5EUMA 5L3QB 2IF0A 2OAQ1 2ZRHA 2FZLA 2KB0A 3GFOA 2AN9A 2GBLA 3Q7QA 4BQSA 3K0FB 3E5HA 2GEUA 2CL0X 1JPNA 4GZMA 5DH9A 4LV6A 3SZRA 2WPDD 4Z8YA 4NHOA 3WNBA 3TUIC 2GAAA 6Q21A 3W8NA 4TTPA 1P7CA 3G82C 3S1AB 3OIYA 1WE2A 1JR3D 4W5WA 1G20E 1ZCAA 2H16A 4JBXA 3U5ZB 2XTNA 2QSYA 4E22A 1P9RA 3U7FB 5DI3A 4NCHA 3ZJYA 4CRWB 1GWNA 4A8JA 4X8LA 2IK8A 1T0JB 1Z06A 2WIBA 2WKRA 1E1RD 2Z4SA 5TVKA 3WY9A 1NJGA 4O25A 3AP2A 4DT1A 4PZLA 2ZRDA 2IL1A 3FVQA 2IYXA 5CK5A 1WCV1 4W5HA 1LVGA 1BMFD 4M1TA 1OFTA 2WWXA 3BFXA 1XJCA 4KFSA 4RZ3A 2PJZA 1GILA 3K8YA 3WBJA 1N0WA 3DO6A 2O5VA 4OHYA 4UNPA 2ZJOA 4LYJA 1VIAA 3CM0A 2RGNA 4AWXA 2XAUA 2ZREA 1S0UA 2QQ0A 2W00A 4IJMA 2WTUA 2ZU6A 3GFPA 4QNRA 4UXHA 2ZRKA 5FTMA 3TW8B 3IBYA 2WJGA 1QHSA 2O0HA 4BLPA 2Q9AA 1DAIA 2DR3A 3K70D 2W0SA 2FPKA 1P2UA 3IEUA 3NWJA 3CKLA 3J81k 1G64A 4LJ8A 1I4DD 2RMKA 1XCPA 3KFXA 1CU1A 2ZVPX 1E2PA 4A15A 1NMYA 1NKSA 2C9YA 2IS6A 3QNUA 5AJXA 2HV8A 1W4BA 5KOYA 4II7A 3GFTA 4ZV4A 4MRRA 1AQUA 1EFHA 1XXHE 3THYA 3ZD6A 2FFQA 4QOSA 5L3SB 1Z3IX 2QMEA 3TSOA 3FHTA 2ZRJA 1G7RA 2Q0HA 1TUIA 5EQTA 3FB4A 4GRAA 3A4NA 3R8CA 5JSZB 3TSZA 1FUUA 3CR7A 4I1VA 3ZGXA 5A4JA 1Z0FA 4PSVA 4ASUA 3B60A 1U98A 2WZQA 4DB2A 3SNHA 1KO8A 1GFIA 2XOKD 4LJ5A 1YZGA 1QDEA 2CLDX 2AKYA 1EFTA 2JJ2A 2CXXA 4TLAA 1TNDA 3O47A 5G40A 2RGNC 2JLWA 1CKEA 5FOWA 4B3FX 1NIPA 1VYUA 5FTLA 3LBNA 4DCUA 1BH2A 4DDVA 1NLZA 1VHLA 2PCJA 4L15A 2PCLA 5JJKA 2H8KA 1NLFA 1I2DA 3AVYA 1P62B 1Z07A 3TSWA 2E87A 3FHOA 4RD6A 4LGMA 4PPGA 4OJKA 4FI3C 4MDEA 2J5XA 3WNCA 1KKMA 3EWSA 1GITA 3W8RA 3KJIA 2O8DA 1G3MA 4PZYA 3THOA 3R9WA 1GL6A 1SHZA 1GSIA 4L4UA 4JKIA 1SXJB 3CX8A 1GL9B 2Q3HA 4AI6A 4RY2A 4YMSA 2ZIAA 2ODNA 3GLHE 4MA4A 4HUQB 1KK1A 2VP6A 1KDPA 2CHGA 4B35A 2DYKA 5H8WA 4C0SA 1Q1BA 3EZ2A 1NP6A 1GRRA 1ONBA 3TAUA 2B8WA 1TAGA 1DE0A 1LV7A 4W5JA 5F98A 3CUEF 2BCGY 3P4XA 4NTZA 4OQLA 1N5IA 2JJ1D 1E4VA 3CRW1 3I8XA 2ATVA 3KXIA 4PC6A 3KKMA 5EXPA 4QGFA 2Q9BA 4U02A 1TL7C 5LB4A 1Y63A 3SHWA 3DMDA 3X2SA 4Q7JB 4DDTA 5BXQC 4P32A 3KQKA 4DEYA 3E70C 5FL7D 3B13B 4ZKDA 2CJWB 4C2TA 3ZVLA 2I4IA 2IXFA 2AFHE 2VA8A 2IUSA 3A4MA 1N3BA 3EZ6A 2R62A 4US2R 1D9ZA 2WOOA 3BB4A 2XXAB 2RGEA 2PZGA 4WOPA 3K0AA 1SVMA 2GXAA 2GF9A 4FW9A 3WP0A 1UBEA 2V6IA 4A1FA 4Q7KA 1NY5A 2BMFA 2VP0A 3NG1A 1ZU5A 5JJIA 1G3IA 4CT5A 4LJ4A 3TW4A 4JS0A 1Z28A 4R2HA 5KNCA 5EE1A 1ZIOA 4JVSB 1W36C 5B2ZA 2QU8A 5KNBA 4EQ6A 1U0JA 1R5NA 2ERYA 4HLQB 4US1R 1YR7A 4D6PA 2GHIA 2WV9A 1PLLA 3EIEA 3BE4A 4V03A 1ZW6A 3NKVA 2ZSAA 1WA5A 5FR1A 1WXQA 4DLUA 1EFUA 2GZDA 3NC1C 2PBRA 2R65A 5HKKD 1K5GA 5SZIA 3QPUA 1RFLA 2A5JA 4D0NA 3DKPA 2FFBA 1R4AA 5GJCA 4CVNA 4TL6A 1NBMD 4DVGA 3RABA 3BFKA 3F8TA 4CEHA 3W3AA 4IOJA 1ZVQA 1RRCA 2QTFA 4LSGA 5H1YA 2F3RA 3PUYA 1UBGA 1I4LD 4Q66C 4EAQA 2BBTA 3I1FA 2XJ9A 2FZ4A 3QKRB 4CEJA 1P5ZB 4CDGA 3IIMA 1RYFA 2VHCA 1W7AA 3TUJC 4W7SA 3GPLA 4OI4A 2FSFA 1NF3A 3AKDA 3L0SA 4U7DA 5P21A 3ZIAA 1XEXB 1CLUA 4MRPA 4LJ6A 1Q21A 1EX7A 1QZXA 4RZ2A 4IOMA 1R0XA 4GPTA 2BM0A 2WKQA 2OZEA 3QG5A 2F3TA 4DBLC 4TWZA 5EE9A 1UKYA 5TDHA 3ADBA 1N6IA 2P3SA 1CR2A 2X8AA 4N1AA 2P65A 3U4QA 5CDFA 4D81A 4BLSA 1LNZA 3VKGA 2CEAA 3W5JA 2ZAMA 3I73A 4TYNA 4DSOA 1G5RA 2B7CA 4QHYA 1G8GA 3CPJB 4LJAA 4E5UA 1ZNYA 1GAJA 1WB9A 3QPVA 4B76A 2J7KA 4LPKA 5FPSA 1KKLA 2BBSA 4TLBA 3L2OB 1NRJB 1XZPA 2ZJBA 1IN6A 1MO3A 1KAOA 2F1JA 2FMXA 3KB2A 3IBGA 1YRBA 4OHZA 4A0FA 4L8GA 4NYJR 4QGHA 4ZI2A 4QM6A 1PVOA 3HJNA 4XVQA 2QZ4A 2W83A 3ADDA 4PQRA 3B1ZA 2HJVA 5B58C 3IQWA 2RGAA 3IPYA 3UPUA 2J45A 5CIWA 2QUZA 2XNDA 2ZR7A 1Q3HA 1ZC4A 1T4GA 1BOFA 1DEKA 2QPTA 1U99A 2V4ZA 3MFYA 3VU9B 3KQHA 2CMKA 4S35A 4PANA 221PA 1HH4A 3MWLA 1DG1G 1DO2A 1TF7A 4Q1EA 1IN5A 4N3NA 1M2OB 2Q9CA 3NBFA 4KLZA 5AUPB 2BIFA 4CF7A 1RE0A 4A8JC 1AS0A 1MO4A 3ZIAD 1U0LA 2OXCA 1IJFA 3CH5A 3VR1A 1TQ2A 2VLIA 1WP9A 2FE4A 2QT0A 5FPTA 4NDZA 1KMHA 2G1KA 2ORIA 5SZJA 2GCOA 1W5SA 2ZITA 4BZPA 4UNSA 3NVAA 3QOFA 1FFHA 3B78A 2WAYA 2JDID 2ZI4A 5JCPA 1CULC 3Q3JB 4LDJA 3B1VA 1XMVA 2OT3B 3LH5A 3LO5A 4QG7A 4YMTA 1XEFA 1IXZA 2G83A 2GDJA 1E1QA 4ARZB 2ZSEA 5SZHB 3WMFA 2PT7A 5TY0A 4RD0A 4AYTA 5BN5A 3NIBA 4ZDIA 3VHLB 1KO7A 3FMFA 1TF5A 2GNOA 3OIVA 1GNQA 3AUXA 2VHQA 3DPUA 1XP8A 4OYHA 4F4IA 1FNNA 2JLRA 2W0MA 3TGPA 1Z0AA 3JZAA 4WZ6A 3W6OA 3LRPA 2NMVA 2X2FA 3QVUA 1OXSC 1G4UR 3RSLA 2UVQA 2ZUCA 4DUGD 2HCJB 3PV0A 1P75A 1Y3AA 5E7MA 3GLFE 3B85A 4Q18A 3DHWC 1LS6A 2QN6A 1NY6A 3SFZA 1AN0A 4QRHA 1DAGA 3NH9A 1R8QA 5GJWC 4BLTA 3RS5A 1GM5A 1J2JA 3W34A 1D9XA 1CJUC 3K0CC 4DRZA 4IEIA 2AWNA 4K46A 2PL3A 4A6PA 4XOIA 3R9IA 5FBVB 1M6NA 1G7CA 1DADA 1U94A 5IT5A 5F3WB 3AVPA 4Q5IA 4DSUA 4G5SA 3KXKA 1GDDA 1ZNXA 1S8FA 3G5UA 2XB2A 1CBUA 3OE7D 1XPUA 1FQKA 1QF9A 1G6OA 3CZQA 3KUCA 2BMEA 2QAJA 2CBZA 3KJGA 1T9HA 2Z6VA 4TL8A 1AK2A 4XJXA 1UBCA 2QORA 5FFMA 5FUVA 4OL0A 1MKYA 1NJFA 2C78A 3FKSA 4D82A 2D4HA 3H1TA 4C9BA 1D8TA 1YZLA 3PCRB 3TUZC 5CM9C 3PFIA 4EJSB 2OG2A 4D4MA 2N46A 4JLNA 1D2EA 1E2JA 1MR3F 1MABB 2DFLA 2HEIA 3CO5A 1U8ZA 1RRGA 4LV8B 1N6RA 2DY1A 2P6RA 3AB3A 4BFUA 2BBWA 4R71A 3EASA 3IHLA 4JLAA 2J0UA 3AP3A 4MGKR 2FGKA 1JXMA 3A37A 4Q1AA 4Q4JA
chains in the Genus database with same CATH superfamily
4Q02A 2WU8A 2P40A 4WQMA 4UEWA 1E96A 2WUFA 4RA9B 4XI9A 1FZTA 4V2IA 3ILHA 3M6VA 3GV0A 4HLCA 3K0EA 1CF4A 4TYMA 2PBLA 3GAAA 1NJSA 3PHHA 4IDPA 3KE9A 2OC9A 4U63A 1IY1A 3U1VA 2WJ3A 2WU3A 2IH4A 3G2QA 4PQEA 3H6KA 1UZUA 5IYZB 3OEYA 1FUKA 2R68A 2OCLA 4M37A 3NHKA 5BN5B 3KQWA 1HK7A 121PA 2VJCA 4OQZA 5DX0A 3W5AA 1N7GA 2O3UA 1IHYA 4LUCA 4FLEA 2ZB4A 4R3WA 1UUFA 5FQNA 4CWAA 2FXVA 2WHYA 3LF2A 3G5LA 2JCYA 4GSYA 1SC9A 4ND1A 2O8CA 4WCFB 5JQGB 2X0EA 1CUSA 1U81A 1WOYA 1Z26A 1E0SA 1VHTA 3GBSA 3P27A 4JFAA 4HZGA 4MH0R 4KX5A 4RM2A 1YUNA 1V2HE 2R11A 3OFJA 5FEUA 3U7HB 4UE3S 1SVKA 4NS1A 2AMFA 4ISBA 4ZHQF 1IN1A 5JSUA 4MYCA 1KAMA 1NKTA 1TZ2A 3GCXA 1F5NA 1UAAA 4G1BA 4RFLA 3BT7A 2J41A 3E18A 1AHHA 3CB4A 3PUHA 1TDJA 1O94D 1V1RA 2XSZD 4F60A 3W9BA 5JS7A 4JJ8A 1LLCA 2GTHA 3JR3A 3PRYA 3A9WA 2B6HA 5ADHA 5B3AA 2GZ2A 1FLNA 1P2DA 3OQPA 5H59A 2WUVA 2MSEB 1T10A 3IB6A 1YA6A 5GM1A 3THSA 4IQ0A 2NU8B 4NEGA 4DCSA 5DK4A 4NEQA 2E37A 4G0ZA 4EJ6A 4MCIA 4TLCA 1GKYA 2IHVA 2ZYVX 4WH0A 3UUWA 1CXZA 4S1OA 2NUTA 3ZH9B 3RUFA 3L93A 1AZWA 4K28A 1YA4A 2CLSA 2JAHA 4U4AA 5FWYB 3TZHA 1U9YA 4KLNA 1BHO1 1DAOA 1JVBA 2CNDA 2C88A 2JL1A 4EUNA 3JD4A 1XDSA 5HJ7A 1PEYA 3L05A 4QO7A 3M6IA 1HUQA 1UFKA 3I9NA 4C20A 4CIVA 1GVHA 2YC4C 2CNWD 2ZSJA 4EABA 1T6ZA 2D1TA 5TQ2B 3O3MB 1T2NA 4RYDA 3KR1A 1UWKA 1C1DA 1TU3A 3JTEA 3ORFA 2I2BA 3B70A 3EQZA 5IC6A 1EPUA 1YQDA 5K09A 4OATA 2PU7A 5JSZA 1Y9JA 3HJTA 3KYCA 1NG1A 1PTJA 3FPKA 4BV8A 2JH8A 4P82A 4PZAA 1NRWA 1BXRA 1EVLA 1QHHB 2BZGA 4FFDA 1IUPA 4AF8A 3LVBA 3DZBA 5TF4A 2JLSA 3RS8A 3ZHZA 4EPRA 3D3WA 3DOCA 5F9MA 3B5JA 4RCYA 3T5CA 1ADBA 1IUNA 2A9PA 2BTQA 2AV6A 2BH2A 4J0KA 2ON6A 3ADKA 3G6WA 1WXEA 3RS3A 3VPHA 3D6UA 2HNBA 2Y93A 3CLSC 3NM5A 3MUOA 1SUDA 2R6CA 4BPBA 2LE0A 2REQA 3N2NA 4MW4A 1Y7LA 4FMCB 3K1YA 1I0ZA 2P7HA 4KFRA 1Z7WA 2JJYA 1EK6A 3NORA 4B6SA 4E0BA 4KR7A 3GVPA 3IOMA 4YO8A 1Y7HA 1SKYB 2ZQZA 3WDSA 2H06A 4P7BA 4HDMB 1J2EA 3M6UA 4ANFA 1TKAA 5JSYA 1WPGA 3E61A 4CHGA 3PF8A 4HBGA 4Z4IA 4MRNA 2J3LA 3E05A 4C4OA 2XYPA 3AINA 3C7DB 2YJNA 4X60A 3WKAA 4YV1A 4LISA 1MUUA 3ZWPA 2IXAA 4D3DA 5C8DA 1S2IA 3I8SA 1C1DB 1LQTA 1WDWB 2A5LA 2FWNA 5C8VA 5KPJA 3OX3A 3S2EA 4O5AA 4P0TA 1TUGA 1WD5A 4PAOA 1BCSA 1JLHA 1PFUA 2EV9A 3JWEA 4H15A 4YB8A 5ALFA 4DLPA 3SHVA 3G9QA 1UMDB 1QHHA 4UBMA 5D5HA 1ECCA 3TXAA 1QVAA 1OMOA 1QDLB 1X7DA 1KI3A 1ZK1A 2VUSA 1CDZA 3MHTA 2O2SA 3CH4B 3IUNA 1BZYA 1YZFA 1AZSC 4TT3A 5EA2A 4YAJA 4EP1A 2LIPA 3F46A 3QMMA 4MDYA 1BD4A 5BQPA 1TCVA 3DXYA 3L0YA 3F97A 5AI9A 2ZUWA 2AX4A 3FUCA 1OXXK 2IGBA 1C3EA 3AOEC 4KQXA 5SICE 4GHWA 2H57A 3IIEA 3UUGA 2XA1A 1KYWA 3P7MA 1VMKA 3DM5A 4DCOA 2HV9A 5EIXA 1FQWA 2AJ8A 3BXEA 3DBHA 4FN4A 4NZ9A 5FBQB 2YWBA 1DKPA 3BWYA 1QRAA 2IT1A 3FTNA 4GR4A 1SN7A 4GOKA 4WEQA 5AM5A 3AFMA 4ZMRA 1NQAO 1SPXA 3E3AA 4TT8A 1HYHA 2P9FA 4A73A 4PFSA 4F4JA 2FDCA 4HAVA 1P19A 1K7EB 3TLYA 2WIDA 3P32A 2PQ2A 4R1SA 2XT6A 3T1YB 4BFZA 4NCAA 1HT2E 1MV8A 3A1EA 2Q8NA 2VAPA 5HNKA 2XPCA 4R83A 3JZDA 1VC2A 4LF6B 1UP6A 1Z18A 3O9ZA 4PHHA 4OKNA 3JVVA 2LKDA 2GMWA 4I4LA 4LRTB 3ZY6A 2APJA 1OFIA 2AI1A 3TX6A 3IAAA 1RLMA 3AKYA 3FCXA 4HDSA 3HR8A 5SY4A 4CMKA 2O2ZA 4F2GA 3U44A 1N2XA 1XTVA 2YJTD 3MCWA 5M34A 3LUJA 3MTGA 1ZUD1 4LXXA 4L0QA 4TGLA 1IQ0A 2Q8PA 4ZIRB 1YUMA 4TV8F 2GSWA 2VQFB 1PSWA 1DJOA 1EDBA 1DOAA 3G9XA 2I7XA 2OB1A 1G41A 4X93A 1XMXA 2ODAA 4H31A 5TGZA 2GM4A 3PPYA 1SB8A 1I6MA 4NZZA 4JDUA 2J31A 1F1JA 2OHIA 3EA4A 2WU0A 1ECPA 4KHZA 3KJXA 4LMPA 3WLFA 4DMHA 2ZJAA 4B3XA 1J22A 4EYGA 3CO0S 5FUYA 2A30A 2WHXA 3G8CA 1BVUA 3VAAA 4K03A 4HEQA 4PVDA 2ANCA 4I9NA 3GCWA 2Z8YA 3E9ZA 2Q5LA 3OOHA 3T1OA 1J23A 3H87A 3NJ8A 2X77A 1GPMA 2GT1A 4BVGA 2V7WA 1RI3A 1HTWA 2DQ4A 2H2GA 4DLZA 1XWFA 4OMCA 2J4FA 4AJ2A 3DM9B 4B3BA 3Q98A 2IYNA 4JROA 2BUCA 3LBHA 3VSEA 3PB3A 2V6MA 3V7NA 2L18A 2RCYA 5A3SA 3FFXA 1J8YF 3HU5A 3FGZA 3O5AA 4JJIA 4KO3S 1A8QA 3BZWA 3VR4H 2C98A 1MW8X 3GX1A 2PS9A 2A0WA 4LWZA 4WVLA 5JS6A 2FEXA 1TJ5A 2ORED 3F3YA 1P45A 3MCUA 1USIA 1WQ1R 1WCWA 3NRCA 1ZMTA 2F64A 4IKOA 3SC2A 3VBCA 2FZGA 2VHZA 3PDJA 1P5HA 2IC5A 4AZ3B 1V95A 1RLUA 2B8TA 2JEOA 4HWKA 4NBLA 1FFDA 2RJNA 5AMXA 3T9EA 4UQOA 2AIRA 3I2JA 4A2QA 1L8AA 4HT3B 2M6KA 3ZDDA 4G67A 3OZDA 3ELYA 1TT5B 3V7YA 3MAAC 3BS4A 3LDHA 4L4RA 1NSTA 4HDRA 3N0XA 1UPTA 1YRLA 3FPBA 1L1QA 2A78A 2GCNA 7REQA 1XZAA 4JP1A 2C0QA 2QL5A 4NBWA 1ZGCA 3JAMA 1TCAA 1XSEA 4F86A 2Z04A 1XZ8A 3EVZA 2GJ4A 1E1CA 4MAMA 2E9SA 4TTSA 4CG0A 2IYTA 1Q5PA 4AB1A 2JHCA 1O97D 1O9GA 1LDGA 3ANSA 1A76A 3JD3A 4JYMA 1PG2A 4US0R 3NZEA 5L7WA 2W6JA 4PXAA 7AT1A 3DWEX 1ZNWA 4ZU1X 2FEOA 1QKKA 2G63A 2V3VA 4D6YA 3B51X 2CLIB 3HKCB 3V4FA 4KN5A 1E77A 3GJSA 3O75A 1L4BA 1A7JA 2R7NA 2X8BA 2Z0MA 2W37A 1YWGO 3C43A 2WUEA 3GK3A 4KIWA 4REQA 5BSGA 5HR5A 1Q17A 4MB2A 1K9SA 1M7HA 4J3FA 5LYYA 1I4WA 1HNNA 4OGGA 1W48A 3E8MA 3L0IB 5B7NA 4MI3A 1E2MA 3KJEA 3MUNA 5EQFA 5BV1A 2OBFA 3MTEA 1E5QA 4ZQHA 1ND6A 2VPTA 2XNDD 4HGQA 3UMRA 4AZVA 1IONA 1PD1A 3ZUGA 4KOEC 2Y0DA 2O8VA 1PFWA 4RF2A 3V9AA 4X90A 4FMBB 3T7EA 1T5DX 2GM5A 2AXNA 1CJKC 4EHAA 3TNDA 1I4OA 2HU2A 3HN6A 2HCFA 3CONA 3DWIA 5F77A 1YDWA 1YMVA 3LNTA 3WK6A 5FFNA 4ACAA 3EARA 1VI6A 1CQXA 4JL5A 2BZ1A 4AKGA 1QK4A 3LO8A 1Q0QA 1M74A 3VYUB 1NQWA 1X1TA 3QX7A 4DJAA 1Q0PA 1MZVA 3VC2A 4MZXA 2QGFA 3TZLA 1PLKA 2ZRLA 1HORA 3IMCA 2NPFA 4NZPA 4C30A 4WTOA 2J7PD 4B7CA 1NW3A 2X23A 4X63A 3OAAD 3OZXA 4R8MA 1PR9A 4WOKA 5E6SA 2V6GA 3RRXA 3S8YA 2BEWA 3COWA 3MUEA 3L1VA 2D59A 1TYZA 1KS2A 3C14C 1JNYA 2ALJA 1I3OA 2W2KA 2A7XA 2W71A 3IXQA 3MXTA 3IBFA 3LMKA 3SG0A 2K6GA 2DTEA 1NR1A 5JXHA 1KP3A 4RULA 4CHTA 2QY9A 4M88A 1WXGA 1NDUA 3VA7A 1DIBA 3KD2A 3W6ZA 3KX2A 1OBCA 1N8SA 1X3SA 2BFCB 2OBBA 2OCKA 4ARCA 4OGFA 1BQ3A 4E2FA 3FZQA 3Q12A 5K0TA 3NV7A 2FFHA 2P9JA 2V4UA 4URUR 4JYCA 1WMFA 3DBHB 5H3HA 1E8NA 2RC6A 3BGVA 2I34A 4RJ2A 1B8NA 3R0JA 4H1UA 2XGSA 5J1TB 5GPBA 4MLCA 1L5SA 3FH0A 4P08A 1FFSA 1JXAA 3M1YA 1LPBB 2JS7A 5DNVA 1D2CA 1WNFA 1RACA 1ADCA 3ND8A 1KFEB 1MFPA 1LDYA 2HJGA 4YY3B 3WSWA 4FYWA 3ZIUA 4C3VA 4JYBA 3CVYA 1KWKA 4DV7B 4AY6A 2WD9A 4AXBA 4HDKA 5K0SA 3GJ6A 4OB7A 1S89A 3IR6A 4PLVA 1LPPA 1XAIA 3KOZA 3LCVB 4WLUA 4NONA 4TTVA 4BLUA 4BE9A 4XLZA 3F6BX 3P9XA 2GSDA 4K9LA 1NG9A 2JGIA 5E1OA 5CB6A 2IEIA 2QAGB 3OCXA 4YQFA 1ZBQA 3CEMA 3O73A 1M8PA 4YIKA 5FHQA 5T4BA 4WD3A 3G2LA 2IV2X 3IURA 1NFRA 1Z6XA 4H3HB 4K5QA 5B1EA 4F3YA 5ER9A 2GPWA 2YWEA 2YBEA 1KAGA 1USVA 2ZS8A 3NALA 4GE0A 4PU0A 4BP3A 3OU7A 5I7RA 3K9HA 4BBJA 3IT3A 4DE5A 4FEYA 2Q9UA 5T5QA 5CVJA 3JYHA 4BGIA 4E30A 2Q41A 1LQUA 2CJXA 2WIJA 3OC0A 5J5AA 2H08A 3OZAA 3IPXA 5TQ0A 1T2CA 4JJKA 2OD9A 4QUDA 1C3JA 2EFHB 3DOJA 3PVCA 2GO7A 5B2FA 4ZQIA 3O9VA 4CT4B 1JJBA 4IJ6A 1CR0A 1XLTA 4ZTBA 1T5LA 1TOAA 4MR8A 5AKYA 3PNPA 5BYBA 3DZDA 3ZQUA 2DHQA 1FP6A 3MNFA 4CI0B 2HO5A 4EHNA 5LBIA 3F5FA 1KMQA 4PBRA 4JSRA 4QVIA 4NABA 4J91A 4LOIA 5LDHA 2X8WA 1DAKA 3NFYA 3SQXA 5GY7A 3UZUA 5DEIA 3F90A 2VWPA 3A1FA 1V35A 2EJWA 1T8UA 2Q99A 3NTQA 4JD5A 1XNGA 4MV9A 1M8GA 5AK6A 4EZBA 2XXAA 3OZIA 3QV1A 3GLGA 3ANLA 3U62A 2VK8A 4G97A 3OUTA 3LC2O 4EHDA 1RYZA 2G77B 4K26A 5JTUA 1C30A 1KZ1A 1KMIY 1JE0A 2O0KA 1ORWA 3CURA 3LBAA 2OXTA 2XF2A 2AFIE 4KXQA 4QQFA 4YT2A 3SM9A 4R84A 1ZMXA 2E49A 3B89A 1WDMA 3KBOA 2W6MA 3GQBA 1P8AA 2E18A 2QR3A 3EIQA 2F1KA 3CG0A 4G65A 4DV1B 1J70A 1RQGA 4M7OA 3URMA 2A3NA 5LZ2A 2VPWA 5K8UA 1KO4A 2Y0PA 4QRDA 5AKEA 2VJOA 4YDRA 1DRJA 4AROA 1AB5A 4IXMA 5JSKA 4E5DA 3QU4A 4IG4A 2FMKA 4KQEA 3E7FA 4DW8A 5A3QA 5L3SA 2B1RA 4IXNA 4YT4A 2DBYA 2ZT6A 4XIFA 3TR5A 1FEZA 5ESXA 2J32A 5FNVB 3K5PA 3R75A 4ZEWA 4EJSC 3LL7A 3I09A 3LPNA 4QODA 1I9GA 3R41A 1BX1A 3E48A 3QGMA 2B83A 4XRGA 1JXQA 1RABA 1OBFO 4C6HA 4F4DA 4IDBA 4MYHA 1N9ZA 1EAMA 1SPBS 4G6ZA 1RWOA 4IO0A 4ZOCA 4IIEA 3VPXA 2OD7A 2C7BA 4HDOB 4LWPA 4MNTA 3T1QA 3U9TA 3Q7TA 1NT4A 5JPIA 1HXHA 3VH2A 2NQ2C 5KSZA 3LT1A 2QD5A 1B43A 1XNJA 4JI8B 3TTSA 1XL0A 3OZBA 3K6SA 4AICA 5K8LA 2NADA 1UQUA 4NMMA 3GD7A 3WA7A 1Q7EA 4AKIA 2ECOA 2EZ9A 1I94B 1JU4A 3U3RA 1ZD9A 9GPBA 1U2GA 3MINA 4RX1A 3PBKA 1UFVA 5LR6A 2ZT7A 4D02A 4BO0A 1XL1A 2ZBGA 4KZKA 4PHCA 3LT0A 1XP5A 3VNRA 1ENPA 3OLZA 2OCPA 4KACA 3FYTA 3BFPA 4ZI5A 2GPYA 1ZJ5A 4D44A 4D8TA 3BXPA 5EWMA 4DKXA 3TGLA 1B23P 1OJLA 4YECA 2OBNA 1QUEA 3X1ZA 1KYQA 3AFHA 4IQFA 2YJZA 1X70A 2CMGA 2FRXA 5DTEA 4UZEA 4XCXA 1X94A 2C07A 1BHSA 1DKNA 1Z9BA 3SE7A 3GF4A 1UC5B 3ZX5A 2P0EA 1V41E 1ZJJA 3QVXA 3TQOA 1QH0A 4DB4A 2PUHA 4M98A 5TNXA 1Z2OX 1OVGA 3R3WA 2C77A 2VEDA 2X19A 5C7OO 1XF9A 2DPYA 4ZO9A 4QAQA 2H4HA 2CLOB 5FLYA 4B4OA 4C6TB 4QT0A 3I1IA 1NR5A 4DKJA 2DFPA 1QOZA 1M10A 1ZJ4A 3ZXSA 4DRXA 1N0IA 5H81A 4P53A 5L8VA 1XMOB 2XITA 1QGOA 2Q1UA 1PUIA 1NFQA 1YOVB 4G81A 5K6AC 1P1KA 3D4BA 4GUAA 2Z3VA 5DWDA 5E4FA 1QLHA 4G5RA 1NXSA 1RYBA 2H1VA 1KI8A 3ETDA 5E6UA 1I2MA 1DRWA 5K8VA 3V1NA 3VKWA 1YS2X 1SQGA 1TLLA 2F1OA 1EI9A 1CQIB 3K9GA 1EWTA 3G02A 1I6WA 2ILVA 4GLOA 3QKRA 4CEJB 3ELUA 1Q6YA 2WE7A 1Z7GA 4F5WA 2ZYDA 3DAGA 5HSGA 2H07A 4JJ6A 4FR5A 1X1RA 1T3HA 1I6KA 3C45A 3LFTA 3BSSA 3VR2A 1IRXA 4ENPA 3PCTA 2YWXA 1KZGB 3Q9NA 4FINA 3VC7A 1L5FA 3UK2A 3CZPA 4XSVA 4PYKA 1ISRA 2AG5A 2JGFA 3E82A 1XCBA 3CBGA 1AUPA 1J2RA 1L9XA 1WUIS 3OJFA 4QDOA 3H9EO 4W7IA 4CDNA 1QQBA 2HZBA 5LMUB 3AR5A 2VJMA 1E1YA 1YFKA 2BC9A 1ZD2P 2YYYA 4UBKA 3T41A 3K9BA 5I4BA 3LXUX 2VH5R 1JQDA 3ROZA 2JFFA 2NP7A 4KO2S 3NATA 3DLPX 1KE1A 4Q6WA 2KSQA 4LVUA 4AJEA 2VQ6A 2P2DA 2QR2A 2QD1A 3LYLA 5DF1A 4F9GA 2Z4RA 1RCFA 1JLLA 3W06A 5FJIA 4JI7B 5CNIA 3ZZ1A 2AG6A 3EYAA 4M8KA 2EW2A 1FL9A 1MRZA 2EKLA 3BTUA 1ISJA 4FR2A 4PPFA 1IJBA 5A0VA 2G28A 3LPLA 3I2GA 3IRUA 1EGVB 1VB3A 4IVNA 2CNOA 3T7KA 4ROSA 1N1GA 2PK3A 4LA4A 5FBLB 8ADHA 3B9QA 3JWGA 4Q9IA 3SF8B 2IS1A 1W93A 4MS1B 3KPYA 1CNMA 4FN5A 2YBDA 4D98A 4N6GA 4XQCA 4RZHA 4IGAA 1RRPA 3W5CA 1ES9A 4EVQA 1BSVA 3PJFA 4A2PA 4KMSA 2CFCA 3PNSA 4YMWA 4HB2A 3WGTA 2C1ZA 3JYOA 3K2BA 4KFTA 1N8KA 3WAKA 1I9CA 4RV5A 2NIPA 5EPEA 2NNWB 1L4YA 1HV8A 3EG9B 1QKIA 5IVDA 1U11A 3QP9A 4U3JB 5HKKA 2YMQA 4TYPA 1AGPA 2EKZA 2V9PA 4P2GA 3SHOA 3DEFA 3SZOA 2FWPA 5EKTA 3HZZA 1W88B 2IPMA 4QKQA 2XLBA 1T9ZA 1UBOS 3I9OA 1A7KA 4KHPB 3AHJA 3COJA 4YP0A 3VR3A 5AVUA 4JBNA 4LRYA 4HYYA 2XUPA 2B20A 5K0EA 4E88A 2H18A 4ZOLA 4C2AA 4YRGA 4LCBA 2XB9A 2OHVA 4PLHA 3C5CA 4RQAA 5MGNA 5JDCA 3HXOA 1GV1A 3DVAA 1L4HA 3CWQA 4KQ2A 3RGGA 2P9GA 4PS0A 1B8VA 3DG9A 3AHIA 3DFFA 3OSZA 3T5MA 1LNQA 5HRCA 2J0SA 2IS4A 2ZYSA 1I1NA 4GMGA 4UBJA 3I3OA 3K0BA 1EBBA 4L3OA 3NIDB 3RVOA 3B2NA 4BAUA 3OC6A 4RAOA 5FTWA 3RFTA 1G0OA 1OXTA 3A14A 3ORHA 1VYHA 4C6RA 2ZJ7A 5DWQA 2R97A 2C8KA 5FPPA 1GZSA 3LBYA 1U2SA 4MQBA 3UK1A 4A2CA 3H11B 1K3TA 4EZEA 2GBLC 3MCZA 2JFZA 1N7JA 2UZ1B 4WK6A 4ND8A 4ECEA 5BSVA 3EW9A 1W76A 1ZAKA 2PMBA 2GPSA 1USUA 2NTEA 2FVYA 4BX3A 1RIIA 1ECJA 1WX1A 1YVPA 3FPAA 1GPJA 3LFHA 2C4TA 1W0JA 2ZBEA 4RKYA 3FGPA 2CL6X 2HCTA 4Z4EA 4MS3A 1U5BA 3DOOA 1JZQA 1QVVA 1MT0A 3GEIA 1L7RA 4Q3KA 4RK1A 1XQ1A 2XD4A 1KA9H 2GWHA 1R0CA 3T5DA 3T9CA 2DERA 3SNKA 2P1ZA 1Y1SA 1N2CA 2KJQA 3QG1A 4EHJA 3CEPB 1E2LA 1M1NB 3NHSA 4XCVA 3D3JA 3LECA 2HJ9A 4JC5A 4YEDA 3B53X 4DCMA 5I9NA 3NKFA 2BBOA 4RV4A 5DRTA 4AZTA 2B7LA 2QX9A 2OD2A 2WABA 3UOGA 3ZWOA 4FFMA 3JVIA 5TX7A 4DCGA 3T15A 4C03A 2QP9X 4UMDA 4L0DA 4A0GA 1KJWA 3VSAA 2IE0A 4HDNA 2R1ZA 4Y9RA 2HRZA 2I3GA 3PUWA 2VUIB 2I2CA 4B48A 3RT1A 3RJTA 1IJEA 3E2IA 3S0JA 3EY4A 2F90A 4AG5A 3F1KA 4GBMA 1EUYA 4IOLA 2PX3A 2JIPA 4CEJA 3R7NA 1YAJA 3A1CA 4PPNA 1VCIA 4AURA 1BA2A 1NUPA 1PZEA 3ENZA 3FAKA 2PYZA 2I8CA 3QNMA 2E1PA 3HXLA 2GEFA 2ODQA 5HILA 4BGVA 2YNMC 1ZYUA 3H7AA 4M4SA 5F73A 3IUSA 4LMRA 2CYBA 2J46A 4IJVA 4N0QA 3B6JA 3AJEA 1S3FA 3EH2A 3GT0A 4OO3A 3LL4A 1BE6A 4MJ7A 2XB8A 1ZD1A 5IUNC 3T1TA 5IKXA 1VE3A 4J9UE 2FEAA 2FWAA 1BWSA 1Z4MA 4C7OA 3O2SB 3PGXA 4E5VA 5DI9A 5E0KB 2ZBVA 3KVRA 1FFGA 5HE9A 4NQZA 1IG3A 3SXUA 3W5UA 5JJLA 1VECA 1XI2A 2CCKA 3MWEA 4GQIA 1CUGA 4FI3F 3EB9A 4CDMA 3EF3A 2A4MA 2X7XA 4RL4A 5IANA 3V8BA 1JG3A 3TKLA 3HVIA 1DBWA 3JARA 5PGMA 5JANA 2O20A 4DBLE 1E6CA 1GP2A 2E4WA 2B1QA 3O82A 3P52A 4HHEA 5TS2A 2Q3LA 3OE7A 3TL6A 5EUCA 2VK1A 4F6RB 5A4IS 4MB0A 2CLCX 1L5MA 1RADA 4N54A 1J97A 1ADYA 2FR8C 4ZQFA 5J4YA 3O4HA 4JT8A 4WJKB 4EB6B 4F4HA 1U2ZA 3C6QA 3NI2A 4D0LB 4YXFA 4F4FA 4LDAA 2PJUA 2XR1A 1IEXA 3IAUA 3NX4A 5B55A 4TOIA 4E7PA 5F1PA 1SB9A 1TZKA 1N7IA 3F5SA 4M87A 2Q0XA 1P39A 2GF2A 3WLSA 4B87A 4Z0NA 5LZ8A 3RT9A 3D1VA 4R41A 5JUWA 3S5UA 3I6BA 1WO8A 1KDTA 3A6PC 2IUEA 1CSEE 1YKSA 2P78A 3QKTA 4U9IS 2H5EA 2VKTA 4KQGA 4RMNA 1TEZA 1P8JA 4OHVA 5HKAA 4KO1S 3IVAA 2B8JA 2EX4A 2JI6A 4Q00A 2QV7A 2A59A 3GMTA 3RRZA 3VO8A 1I0IA 1EZ4A 4DCCA 1QTNA 4ISCA 3W78A 4L5YA 3A1WA 3I42A 2CFRA 2H1CA 2H5LA 1CY1A 1WHTA 3ZY3A 3UWMA 2HDNB 1JHUA 2IXGA 1FUIA 3B8HA 3GH1A 4RJKA 4DJTA 2AGVA 2IYQA 2C94A 3FZGA 1VBFA 3PZRA 1SZCA 3DEIA 3HRIA 1G8PA 2YYZA 3GPIA 3W6NA 4A36A 3BDVA 1YB6A 4GOJA 5YASA 2YZ2A 4MTLA 3HCDA 4Q9KA 2XDYA 3DQZA 3TGWA 3IVGA 3RC8A 4V02A 4D9JA 4TKZA 4E03A 2AZTA 1GPUA 3TBFA 5A1JA 4AMGA 2WZBA 4JZYA 3U3KA 1PDVA 3P2KA 3WTCA 1DGQA 1L5GB 1PV1A 3GVXA 1X92A 2D3WA 4FYYA 5MN6A 3S8EA 5FUWA 1L4LA 5JAIA 1BVRA 2I9KA 1NVXQ 1YR2A 2P2NA 1SXJC 2ZRIA 3AR9A 2WTMA 4OP3A 1Q7CA 4DV4B 1T4CA 3KPVA 2HLDA 2D1SA 1Q84A 4HCJA 4I9HA 1GUYA 1NVWQ 2ZB7A 1ORHA 1TCBA 3DOHA 4IJUA 4KVGA 4MGZR 4JB0A 1OFUA 3R09A 1US8A 4I50B 3RB8A 3CW8X 1BE8A 1JU3A 1G7TA 4BUCA 4KU4A 3HDJA 1HLFA 3RF6A 2ZJ6A 2D1QA 3QF4B 2G07A 2IELA 4B4VA 3L4EA 1V4VA 3IMEA 4IZIA 3RUIA 2X8JA 4PC1A 5HTKA 4EHLA 1RC8A 3PUKA 3EZLA 4R16A 4C76A 1UK9A 3KVYA 3H2YA 1ZUNB 1WDLA 4XSHA 3ZI0A 5BR4A 3VR6A 3ZEIA 3N0RA 4RZUA 5IXSA 5BORA 4RK5A 4XWAA 1AS3A 3C1AA 3CLUD 1CZKA 4H6PA 2AOWA 1AZLA 4NC9A 5C0OE 3T5TA 1KRXA 2ZI6A 3DO8A 1SIWA 2Z5GA 3EW7A 1A2KC 1N57A 3VYWA 4BU0A 1B4DA 3CBQA 2LBPA 2BF7A 2WYIA 2PSFA 1E2QA 4PSCA 4BFYA 4WN3A 5HOQA 1XRSB 2ZSBA 1YB4A 1T1SA 4BE7B 2WSSD 2HWKA 4K9RA 1M1XB 3AI3A 3ILYA 1NW6A 3RROA 5D6NA 1U28A 3MWYW 4C4YA 5AVJA 2C7VA 2VPYA 1FYDA 3I72A 3JVDA 3NHBA 3OLVA 1KGSA 2CDBA 2ISCA 2QMYA 1U4OA 3LHKA 4HGZA 4FB5A 3ROGA 4UNRA 4MKGA 4DT1B 2VXYA 3FFWA 4LBYA 2CE2X 2J59A 4JBGA 4HFJA 1V16A 2PLNA 3E7DA 5L45A 2R6JA 1YTLA 4LMAA 1MRNA 2MT9A 4LRWA 3U4AA 3KELA 3RRFA 3GDWA 4QLBA 1DKRA 2HM7A 2YZMA 4RPIA 2EEPA 5BPFA 3T34A 3TB6A 3F8SA 4D9BA 1REQA 3MMSA 3L4JA 4OMDA 4ZJPA 2Z30A 1COWD 1OOEA 4LKOA 5EY5B 3PI7A 4FFPA 4EI9A 5CVDA 1ST2A 4CR8A 4LHWA 5HE8A 2PH5A 4R40A 2J9GA 4UC0A 1TPZA 5HIJA 5C1OA 5LOVA 3O83A 4B4UA 1ML4A 1ZC3A 3P26A 2YJ3A 1ZBDA 2F1HA 3EGCA 3NHYA 2F3QA 1FRFS 4GDFA 3GQBB 1OWNA 2ZKIA 3JZIA 3F71A 4FXPA 3SQNA 5IM4F 1GPYA 2OO5C 1J0BA 5EYPB 3JASA 2KX7A 3H1PA 4PX3A 1FSFA 1KZ6A 5JECA 2V98A 2V7GA 5CDGA 2D2EA 2QD4A 1T5IA 2EX1A 2KBEA 2FSUA 2JC3A 4G1UC 1NVVR 4Y6RA 5CLQA 3HH8A 4JBIA 4RNDB 5F35A 3VRHA 3HFSA 4YUAA 1UAYA 2AYXA 2MYNA 2YS7A 3PU6A 5JXGA 4IIUA 2EKPA 3C70A 5TQ2A 2LNDA 5JASA 5FKJA 3JPYA 4L0MA 5LP6A 4JBHA 2FN4A 1ORIA 1OREA 1R5OA 2XUKA 3I2KA 2AHOA 3L9WA 3MGBA 2QF7A 1SUIA 2GB4A 4OG2A 3LXRA 3BKXA 2BR5A 4E3ZA 2SECE 2DFKB 2A57A 1NNUA 3FYUA 2WWYA 4IJ5A 5BWMA 5ERYA 1M6VB 2NVBA 4ZU3A 4CNQA 3FDXA 4R1LA 1GQRA 1AKEA 1H1LB 3AIOA 4LNAA 2TSYB 1KMHB 3C3CA 3FGNA 2HLPA 1MU0A 5CGZA 2QRLA 2JI4A 4FONA 4WZBB 5FOTA 4DAOA 2JANA 2FN7A 2A67A 2AFIB 5BNFA 1WLYA 4N7JA 4RTQA 2E4ZA 1GGVA 4J0CA 3OQNA 4M38A 2R7MA 4RVOA 3R3HA 4NOJA 8GPBA 3GBPA 4XUGB 2X22A 1L6IA 2VH2A 4G07A 4RSMA 3I23A 2HMTA 2RCNA 3O4JA 3D43A 5FHRA 1SCJA 1VRCA 1LZKA 1PNVA 1LXCA 2QE7A 2XYRA 4WKPA 3A1UA 4CN8A 4M21A 3FCSB 2VHJA 4TSRA 1U9IC 3HXTA 1N9GA 1PGQA 2R2AA 1GY8A 2V1XA 3EF0A 3ZZMA 1WABA 4JT2A 2R1VA 4RKFA 3UMFA 1NMQA 2F17A 2JVIA 3FPSA 3DZ8A 4FIDA 4OJYA 4TUYB 1Q11A 3DKVA 3HZRA 5CW1A 4J3NA 3UPTA 1XBTA 5KU7A 4LF7B 1NFFA 2WUGA 4RA6A 1NTRA 1PQWA 4G85A 3RSFA 4KREA 5G0WA 4DLYA 2FDRA 2C2OA 1GLVA 4Y9TA 4P3KA 1TU4A 1WMDA 2VDVE 4ZVNA 1A72A 5AOBA 3UUEA 3OKPA 4Q4HB 1YU6A 5HF9A 5LWHA 4LECA 1CRQA 2WP0A 3V4PB 5AVZA 2YOGA 4TV9F 4EW2A 4HRXA 3NT5A 4PHGA 5CDUA 1EXVA 2OC4A 4HGOA 5ALOA 1WTCA 3B20A 4BDSA 1QHXA 1UBHS 1J1ZA 3MUFA 2C7OA 3OBBA 4LYAA 2A1UB 3R7WB 3NRBA 4AVYA 5DYNA 3TOVA 4DLVA 1KSFX 2GEJA 2NO0A 4R2MA 3P9NA 5A7HA 4B5LA 4JOSA 4NULA 1GVNB 4KE9A 4TZ0A 1GUZA 3UAXA 3NCTA 4Q03A 4FHFA 3ZZUA 3IP8A 4RIEA 2NXJA 2HGSA 1NDQA 2VPPA 3KB8A 4GPEA 3H8JA 3CF0A 1SRQA 2Q2OA 3HABA 3KU1A 3OF5A 1B1CA 4KWTA 1X7YB 4NSNA 5ANRB 3G9TA 1L7OA 4I3FA 2YQZA 3NHLA 1V4BA 1QE5A 3JYQA 2AYZA 3GAFA 4OD0A 4Q48A 4NV0A 3TFOA 3F2IA 3IEMA 3IILA 3QUTA 1XMQB 2B36A 3RVSA 5GZ3A 3F2VA 1LBQA 3VPCA 1Z63A 3JQDA 4XA8A 2GRJA 4HAIA 3L6CA 1OX6A 4E4YA 6CHYA 1Z73A 1QZUA 2QVYX 3EJ6A 4I14A 4OH7A 3HCBA 2C92A 2D0PB 4HQNA 4E11A 1T9GS 1SQ0A 5J4VA 1HEIA 1E98A 2PGIA 3PFHA 3VAZA 5HVNA 4MP3A 3GRKA 5AI4A 1KS9A 3Q7SA 2BTOA 1X7XA 2Y3IA 2G5CA 2CUZA 3JQCA 3L5OA 5H0IA 4REOA 3UCEA 4D4JA 2QUIA 4TKLA 1EHIA 2CFOA 1WPRA 1NW8A 4FHEA 3RHSA 4G1EB 2NTVA 3AW8A 3OWOA 1TUEA 1CT9A 4LOHA 4G5HA 2UV8A 3N3BC 1BDHA 1BMFA 3BL8A 1XQ9A 1R18A 4UUAA 4ZK2A 1CEYA 5KWIA 1UEIA 2RHDA 2ZSUA 1H2RS 4L16A 4M36A 4TXLA 3TBKA 5AW1A 2PX5A 4ZT6A 3LE8A 3F98A 4I7EA 1M83A 4BWYA 4RVFA 3N28A 1LF0A 4YJGB 3RVDA 4YUYA 4TV9A 4EH1A 1KZ7B 4QBFA 2O6HA 3JASB 3VU3A 1KARA 4OFBA 4ZVOA 4GAEA 5ECYA 3BGSA 5E4JA 2JDIA 1RRFA 3IKMB 5DB4A 5GGXA 2BE9A 3BVPA 4LI3X 4EF6A 5A5EA 4DV3B 1PCXA 2SKCA 3R5KA 4AN4A 4CFZA 1RIFA 1UXOA 3DEHA 1UKCA 1EK2A 2ATEA 4FMDF 4YT8A 2W22A 2I67A 3CRRA 4BVEA 4Z3DA 1D4FA 5CFOA 2OESA 1ZH2A 4FS8A 3RAPR 1TVKA 1PI3A 2GVDC 2Z58A 1WEHA 5IJ0A 3V55A 3CNQS 5IVIA 2CCJA 3ZLVA 1SBCA 4QM7A 5F51A 1RM0A 3DLAA 1GG9A 1AO0A 1UZAA 1G2IA 2O2IA 3MG9A 3O94A 4LXYA 1JJIA 2GOYA 4M7RA 1JFSA 4FT2A 3T7DA 2X9VA 3A6GA 3I53A 3QEMB 4KYTA 5FBZA 2K2QB 2RGYA 2JD2A 1YZYA 2IYVA 2RGCA 3E4DA 4R69A 5B3JC 2KLBA 1Y98A 2A4KA 4KJXA 2RGXA 5NULA 3FOFC 1UJMA 2VPXA 2E2WA 3OTQA 2XV1A 1GT91 1LBHA 2PIDA 3A4IA 4OK5A 4ZYYA 3DL0A 1M8JA 3QXGA 4DIBA 2F6RA 3I92A 5J5CA 1E0AA 3L1UA 2FQXA 1VCMA 5GAJA 3ZWYA 5G1NA 3I45A 1DIAA 3A7EA 4C7KA 1B41A 2OVBA 1OH6A 1PZMA 3PFFA 3E58A 3SZUA 4NFSA 1CVRA 1QTIA 2Y6UA 3CX6A 1J42A 2OCXA 4OHRA 3S2GA 3EBLA 3MWDB 4EGQA 3STVA 1QYCA 3D5TA 1CUAA 4UPEA 1E6UA 4ER0A 1XNRB 3D1JA 3UWDA 3H11A 2KW5A 2WNHA 2Y67A 1PYDA 1FXWF 2FK7A 2GFQA 5BW8A 3ENNA 4N9QA