3AO0B

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with cn-cbl and (s)-2-amino-1-propanol
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
252
structure length
252
Chain Sequence
ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine ammonia-lyase heavy chain
publication title How coenzyme B12-dependent ethanolamine ammonia-lyase deals with both enantiomers of 2-amino-1-propanol as substrates: structure-based rationalization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 72
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2010-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3ao0B01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ao0B02
3ABOB 3ABQB 3ABRB 3ABSB 3AO0B 3ANYB
chains in the Genus database with same CATH superfamily
1EAYA 1KYZA 2ZANA 2PGAA 1CUAA 1CDOA 4PSAA 2IYWA 4CMEA 5AW9A 4BLPA 1CR6A 3AZPA 3RC2A 1KWGA 4DV7B 5E9QA 3W77A 1CQIA 2YCLA 2HRQA 1YB5A 3M4XA 4II7A 4YUZA 4KPYA 1V1MA 3T94A 4P7BA 1LSOA 4B8WA 4DY6A 3I61A 1E1CB 3CQ9A 4OHFA 1Y1SA 4FKBA 2FP4B 3RSHA 1E7JA 3ETDA 4DCPA 2XOXA 1Z2NX 2CTOA 3F5MA 3LXXA 2D0OB 2O1SA 3GELA 4C2UA 1PDWA 3A36A 1SZPA 2H3HA 3LLVA 3R0IA 4LWQA 1WXDA 3ND6A 2AOTB 4JVSB 3T4XA 5DLDA 5CRIA 1DLJA 1V26A 2R87A 4ID9A 4HY3A 4NJEA 1S0UA 5K51A 3S3TA 3SDSA 3BHMA 1W93A 4IDQA 4G1VA 3V8VA 1N9GB 3Q2OA 1C1HA 1WDWB 2FMXA 4GZMA 5ABPA 2WMDA 5BN1A 4EO4A 1E3MA 5A4FS 1NV8A 3PXEA 1LY1A 1G19A 3WA6A 2IZOA 4MJ7A 1ZMTA 4R0VA 2NU7A 1N3YA 2Y1OA 2X8JA 4WACA 1KDPA 3NDPA 4LI3X 4W6QA 2UYCA 5JI3E 2Z4RA 1LCIA 4Q1FA 2YICA 3RVKA 4A2WA 5LWHA 5JJKA 1CXZA 3AH8A 3K05A 1EG7A 4OHRA 1PK9A 1VFNA 1WABA 2ZJ7A 4GS5A 4M22A 4MUXA 3IO5A 1PTJA 1ECJA 3H1GA 3HMQA 5EVJA 4QYIA 3DO6A 4U5XA 1ECLA 2DQKA 3R3UA 2IOHA 5LL6P 4MVJI 3AIOA 5EPUA 1W1UA 4QXAA 2GM9A 3R3YA 3FN4A 4WCFB 1HEYA 3IRUA 1J2JA 4GSKA 4QICA 1J0BA 3CLTD 4G1EB 3V7NA 1ZBDA 1NP7A 1SKYB 1XQ1A 2H2HA 1NFFA 4HEJA 3PQ5A 5DM1A 1SD5A 5KKNB 5TR9A 3C48A 1XCPA 3UWKA 3W8FA 3ZDZB 5GM1A 3M4ZA 1RHMA 3RC3A 1MC5A 1XMXA 2ZDGA 1GPUA 1Z12A 2CE2X 3BMCB 1YJ8A 2J6BA 3REFA 5J58A 3JQ8B 4RDHA 3DYVA 4DCSA 3P94A 1U2QA 1BDBA 3KOZA 3H04A 2X76A 1D6NA 5AUOB 3W5DA 1ACLA 1B8PA 1ISFA 3O2JA 3TJMA 1CUVA 2JLBA 4DR3B 1V96A 1DQRA 1YQGA 2PZFA 2CXTA 2WWGA 2EFGA 3DZKA 3LFHA 4JL5A 1HE5A 4MUAA 4Y9DA 3OLYA 2BMFA 5K8VA 1RXVA 3QBTA 3OZWA 1YZUA 1Z7EA 1X2EA 4RMGA 3UT5A 4J0GA 4M46A 4BATA 1HI9A 1QWSA 1Z2PX 3OQPA 5ALPA 2AG5A 3G2PA 4KIJA 2CNWD 5EZYA 5KAPA 4U7TB 2NO5A 3B6IA 3RU9A 1YRBA 1MX5A 4RKFA 1L7BA 5ERGB 4HTFB 4Y2VA 4PQRA 3GAAA 5JDIC 3OOWA 1HG0A 2C0CA 2YMPA 1HTTA 1ZISA 2MSKA 1YWGO 4GGMX 3D31A 1AM4D 3OJWA 4MS3B 4XUGB 2I91A 3T0FA 4LHVA 13PKA 2FF7A 4GKVA 4LKOA 1JLSA 1Y1PA 3JYLA 5HMLA 1S9DA 2PH3A 4X3CA 5AKLA 2PZ8A 3CVXA 2Z2ZA 2WILA 1E9AA 2CL0X 3NT2A 4H3VA 4MDHA 3RVNA 2WD7B 5AOAA 4KWHA 4O08A 1R5BA 2JCGA 3NX4A 5FTWA 3ZUGA 1TYEB 4YT5A 3TSWA 1I01A 3WLIA 1ML4A 3QPUA 2C1XA 4JVNA 4QFBA 2ZTVA 3AEKB 1FYWA 5ILOA 4JB2A 4NLLA 3W5UA 2PAFA 1XNHA 5JWOA 2QJOA 3H75A 3E53A 2C2YA 1G2PA 4PX2A 4OFZA 3CYFA 4FB4A 2GZMA 5EWMA 1SQ6A 1D1QA 2R96A 3BPSA 1KI6A 3N9IA 4CCYA 2H3EA 4DZRA 2K87A 3DVSX 5BN4B 1WQ3A 1BW9B 1U8AA 4ZXFA 3FGOA 1P73A 2A58A 3BWBA 3EQ6A 1U8YA 1SOMA 2XF8A 4HO1X 3EISA 2PSFA 3IQFA 3PXXA 4GBGA 3GFQA 2FR1A 2AXNA 3T5GA 5C32A 1AXEA 1CVRA 4P7GA 2Q1XA 1GQFA 3DM9B 4YIKA 2X5JO 4BB0A 4S05A 1DPGA 3EHDA 3HADA 2VQEB 5EUCA 1UXJA 3TLMA 3H84A 3I2FA 3MJ4A 1ZUWA 1MHPA 5DH9A 3IERA 3ZHSA 4EKYA 4LQDA 3LTNC 1E2BA 2W90A 1WDKA 4R8MA 3QKIA 4UNRA 1HQYE 1P5RA 2E55A 1FNNA 3AFNA 5JG7A 3WGLA 5CD9A 1N2CA 3RFCA 1FFHA 2Z8ZA 2I4MA 1DAEA 3K4HA 1P3Y1 3AEYA 2GJSA 3ABZA 3CF0A 4C03A 3T12A 1AZLA 5JCOC 1YTUA 3D6TB 3E82A 5CPFA 5B7PA 4U2BA 1T43A 2J5BA 1V4VA 4G0QA 1D8AA 3ORSA 4V3BA 1OYYA 2R48A 1QRVA 1QH0A 4PIMA 2XY4A 5C2JB 1PEDA 1UDXA 1T8TA 3D3KA 3T7SA 1DS6A 2IXFA 3DNPA 5EZ6B 3O6VA 5C7IO 2G1AA 1BQEA 1TDJA 2IYLD 1D3AA 4OREX 4YI3A 5DGTA 4ZRNA 3D0QA 3S2EA 4D6XA 5J4YA 4IVRA 4R2HA 2COKA 4EUEA 3ZK8A 5BURA 1R16A 1T4DA 5CYPA 4NNUA 4IGEA 3UJPA 5KVCA 1RE0A 2JH9A 3GQBB 3E5RA 1T91A 1GFWA 1QK4A 4XWKA 1WOYA 3RIYA 4BLVA 4FZJA 3SEZA 4Q47A 3KQQA 4IUCS 5AW6A 1Y6ZA 1GEEA 2RHRA 5AKYA 5AM0A 1CY7A 4AC9A 2VP0A 1H2ZA 5E0KB 4DMGA 2XGJA 1IMOA 2OYRA 4DIBA 4PWZA 3U09A 4PV7A 2B1GA 1XQXA 2HUNA 4IHAA 4W9NA 3OZEA 5HUQA 3KQVA 4WUVA 4X24A 3ADCA 3EY4A 2E4YA 2FMUA 3MUEA 5DWQA 4ATNA 3NXKA 5HUJA 2I2FA 2ZB2A 3RU7A 1M34E 2H9YA 1U5AA 3OCXA 4IH9A 2X22A 4PYIA 2NV6A 4GRIA 5LLDA 3KRTA 1ZA1A 3HYLA 3BJEA 3VSBA 2P30A 4LY9A 4G4SO 4PZEA 1RQPA 3O47A 4KP7A 3HSYA 2C9OA 3MT8A 1HTWA 4L76A 4FEYA 4FJ0A 4CIXA 1KEEB 2FAXA 4RGVA 4DNOA 9LDBA 2GPAA 4GWGA 2QVGA 3LK6A 1UJ2A 2PEZA 3MB8A 3KUDA 3QYPA 1F0KA 3GVHA 4IJKA 4QVGA 3OC0A 4YROA 5FBZA 3RLFA 4S2QD 1Z4LA 2J3KA 1NQWA 3V8RA 4UU0A 4NPAA 3Q8XB 3MHTA 2PBRA 3ZZTA 4X84A 4ZMSA 4AKTA 4PRYA 1HKHA 2OV4A 1E0KA 1NZDA 3BXZA 4H3KB 4W5TA 1XRPA 1NF9A 2Q5EA 3DR5A 5GGYA 1ZHOA 3WWYA 1O5OA 3SHTA 1UT8A 1IPEA 2XKKA 3DV0B 5AJVB 1SU6A 1UJ6A 2CW5A 3DFUA 3JAKB 5CB4F 4OYYA 1N34B 3ZI0A 1Z88A 2P78A 2PL3A 3B8EA 1XFDA 3GJXC 3O1IC 4EB3A 4HT3B 3C7KA 3R3SA 3IC5A 3GMSA 3PIRA 4CTJA 3G5UA 1PN3A 3BICA 1I0ZA 2QTTA 3CF4A 1YJQA 3H7IA 5AXBA 1H8HA 1HF3A 2XA2A 4E21A 4LCJA 3KB2A 1SWWA 1QQ6A 5JZMA 3PFCA 1NN5A 4IMRA 2X0IA 1WCXA 3UW1A 4RZ2A 2VXYA 2PM8A 4R9NA 1OTYA 5A5GA 5TF4A 1VLJA 1H2YA 3KUUA 2CYCA 2D2EA 3CM0A 1QF6A 1I3LA 1XLTC 2AD5A 2V96A 3AR4A 1WWKA 4QNRA 1JFTA 1DQSA 2H2WA 1NN0A 2Q5OA 3AESA 4UJ5A 4O29A 4AZVA 3GLGA 4Q7EA 5AJYA 1LPNA 1K5DA 1V35A 1ZGJA 3G2MA 4E5VA 3WBBA 5H3CA 2JHFA 4O4IB 4XUEA 5C52B 4F12A 3COWA 5KBYA 3USCS 2DEUA 2QLFA 1RYYA 3F7NA 2QZPA 1PUIA 3B5IA 5BYAA 3CONA 3PCTA 3ENKA 2AF3C 3PLNA 1JHQA 5A6SA 1WDTA 4YJ3A 4U2DA 3SZGA 1Z6GA 4RDXA 3MSCA 1M7BA 5K4HA 1TCUA 2Q4DA 2GYWA 3HK2A 5AI4A 3TD9A 1ZXBA 4P3YA 3QPAA 5ALYA 3R09A 3LO5A 4RO0A 4Y6RA 3AOEA 5LQSA 1T10A 1IXSB 1MC8A 5DSZA 3KJHA 3ZG6A 5AKIA 1OHHA 4HLNA 2G1JA 5DM4A 3U3RA 4C3UA 2FN3A 3BE8A 2C4MA 4MCIA 3EARA 2Z5FA 5FPTA 2DPXA 3LVQE 1YCDA 2QQFA 2ECQA 5KOYA 5HZHA 3DF9A 5CXXA 5KIAA 2ACWA 3C4QA 1H3EA 2DKNA 4MVJP 5IP5A 3G0HA 3EUAA 4NATA 4A6DA 2VDUE 5L3RA 2OENG 2E21A 4LPSA 4MJLA 2J3IA 3I45A 3BB4A 4QBKA 1QGUA 2H51A 2FEAA 3PPYA 1A8PA 2IH5A 2CFTA 3LVFO 3RFUA 2AJLI 3ZX4A 3KJNA 1CIPA 1OD6A 2JVJA 2WIDA 4HNTA 5CEJA 4EEXA 3A6JA 4GMKA 2CBGA 4TSFD 2GLXA 2GZHA 3G2OA 3W9SA 5A7GA 5ETJA 4B6SA 3GRVA 1YAJA 1ONNA 3GO4A 2EYUA 4MR9B 2FK7A 5IYZF 4QHTA 3A37A 1HYBA 4UEKA 1CKTA 4P31A 4ESVA 1AUXA 1WPGA 4IS3A 3BTUA 3TSZA 5AW7A 2ZI5A 2QN2A 5JE8A 3VKHA 2J67A 4R2LA 3WWPA 1D8TA 3BFJA 2RC6A 3AERB 4UC0A 1U2SA 2AZDA 4DLKA 3TQTA 2JFWA 1U7OA 3RAGA 3QX8A 4O4JB 1EFPB 1A76A 1T24A 4L9RA 1FDIA 4HATA 1VECA 4AWXA 4QJ5A 4U2EA 2WIBA 4AJJA 2IS6A 1CF4A 1I7LA 4Q9IA 1BG6A 1Z7YA 4R6WA 5G0SA 1A8SA 2Q6IA 5DHFA 4J6FA 4H15A 4F3TA 1COWA 4WGGA 2ZUUA 3PE4A 4J3NA 1GEGA 5B1DA 4OJMX 5CHYA 4FOPA 1JEJA 1XQVA 1JQLB 2R6FA 2BOVA 2CLHB 1QIJA 1W1IA 3OTHA 3PVZA 4JX8A 4AS1A 3A6ZA 5FTMA 3SIWA 3VC3A 4AF7A 1P74A 3AW9A 3EGOA 1O6ZA 5FI1B 3TZHA 4B6JA 4ZYLA 2V4UA 4GL4A 2HYDA 1IZZA 1N2IA 2IY7A 3LCRA 4Q3AA 4ZQIA 5BSMA 3SQDA 3SWWA 1A1VA 2CKMA 4TGLA 1GPNA 3GG2A 1LRJA 4MVJG 4X1KB 3LXMA 4MW5A 1DI0A 1N6LA 1S4QA 2GUWA 2Q4EA 3QELB 4AURA 3W4IA 2OK8A 1GZDA 4N7BA 1S2GA 1NU8A 1XDZA 4HGPA 3VV3A 1DTEA 4HB2A 5CLQA 1X39A 1C1DA 4ND8B 1H2XA 2B35A 2X14A 3EIEA 3RLIA 5I8ZA 3HJCA 1POWA 1B0PA 2HAEA 1I30A 2PMBA 2QAGC 5KYXB 1TO1E 4AUMA 4ZJUA 2V7XA 1Z2CA 3O90A 4Z3DA 4F85A 3AUTA 5FPPA 3JSXA 4D99A 1Z3IX 5BN3B 2QI9F 1RWOA 4QZVA 2IZ7A 2JDID 3O4VA 5GM2A 4PZUA 2NV2B 1C3VA 2WWXA 4MNTA 1P72A 1S2NA 2P41A 1NUUA 2QTLA 3FFAA 1R1DA 4OQYA 4RSRA 5T8KC 4AN0A 2J85A 2PS1A 2X6TA 4KR9A 2G63A 3PTAA 3W2HA 4NHEA 4Y3UA 2YYSA 1G38A 2O2JA 3TQ6A 3A25A 1AUPA 1P31A 2M6SA 1DIAA 2VC2B 3LF2A 4RIGA 2FZKA 3V97A 4D97A 2IEAA 5ICGA 4DV6B 4B83A 1QRRA 1RI3A 3D4IA 2ZRJA 1IEQA 3NBAA 4X00A 1M2EA 3NBMA 2NUAB 3ZCVA 4C0XA 1P5JA 1O95C 3ACDA 7REQB 1BVUA 3GW8A 3W5VA 5HHTA 1SPXA 1O3YA 2KI5A 4WT7A 1A2QA 2G8LA 2UZ1A 2I6SA 2XUQA 1OBCA 5HSGA 2X1VA 4M9XA 3HYRA 4O4LB 1ZY2A 1TM2A 2IX3A 1QCDA 3VPDA 4PLPA 2ZQZA 4OJNA 2FJPA 2NQTA 1TL7C 3LTEA 4M89A 1AO3A 3PENA 5FBKA 3VNBA 5IAOA 2C4VA 4KQMA 1FNDA 1P2BA 421PA 4KK4A 3TS1A 2A6PA 1DBRA 3P9NA 1MAAA 2PL1A 2W2LA 4MQ4A 5TQVA 2E5LB 3P7MA 2BCJQ 2E89A 3FOAA 4NZMA 1HLGA 3KJGA 4WEOA 5HDQA 3RJ9A 3I1FA 4JIGA 4DEXA 2FZEA 2O2ZA 3IUQA 4XJTA 3TKYA 1DCFA 1CNEA 1J21A 1IOZA 1M1NB 1YSCA 2VHEA 4FFBA 1ZW6A 4TTTS 3ZOZA 5FL7D 5KWVA 2CLIB 4GAEA 1DV2A 4CMIB 3HO6A 3IB6A 4GYYA 1I4EB 4IEIA 3QFCA 5BVHA 3QM1A 5FEUA 4BKUA 4AKIA 4ZTZB 4P3PA 2HNBA 4Q48A 5K0BA 4V2IA 4BQQA 1WAMA 1YZYA 3IXMA 4R3WA 3I2KA 4L0DA 3H2ZA 1DMSA 2QLLA 4OJYA 2QTVB 3NVDA 1VKZA 3I4CA 4M0PA 1DKLA 3DPSA 4BASA 4OI0A 1VGQA 3INNA 1JN0A 3PQ6A 5JMWA 2FVYA 3PFHA 1ISHA 4L7QA 1IMJA 1NXVA 3PGMA 4PZ9A 5JNRA 4IIUA 3RWOA 5BVGA 3O8RA 2NZVG 4YT8A 3DCIA 2CK3A 4OUKX 4D02A 1BN6A 4PZAA 1JAYA 3QMMA 5ALHA 1DBPA 3EQ9A 2JHCA 4YMSA 4A8PA 2O8EA 4UASA 3GNSA 4CL3A 4O4HB 1A8QA 1A5SB 1DL5A 5L40A 3CVJA 3LK7A 4UBMA 3E5NA 1L4EA 3FLEA 3IJ5A 1B6GA 1IK6A 1NT2A 1USGA 4Q18A 1N8TA 3QV1A 2B0CA 5CLIA 1CZNA 2IZZA 2VA9A 2ZDHA 2Z4SA 4OHYA 4P4GA 3IVXA 1UL1X 1FPMA 4EYEA 5BMVA 2ZM5A 4TMZA 3MPUA 4FMPA 3SI7A 3WWDA 1FW8A 1GPKA 5HRUA 3UOGA 4HV4A 3THWA 2BSAA 2YW9A 5KTKA 3W7BA 1DG3A 4K8RB 4CU2A 3G7SA 3UB4A 4RPJA 1J97A 3M0EA 1ZIDA 2O0JA 3RVBA 5JANA 3IJPA 4H7JA 1VMEA 3RS7A 3RU3A 4Y2SA 5LYJF 3ICPA 1YL5A 3RRYA 1XP5A 5HK9A 5D6OA 1CB0A 5DIZA 4F5WA 1D9ZA 2CNKA 3S2GA 3A3OA 3K2QA 4WCVA 2BUCA 1K97A 1KJZA 2PGDA 3S2UA 1EAMA 2QVLA 1U1EA 4ZEXA 1V11A 4B4OA 3OHMA 3DOHA 1PIWA 1QGYA 2C96A 3WK8A 1M0SA 3PC3A 2DQZA 3VJRA 3F3MA 4MQMA 2WYVA 4NG4A 4YAWA 4G81A 4QUDA 3WV4A 4GM0A 1X6VA 4M76B 2GFHA 5C3UA 3F6CA 3MYYA 4B4DA 9LDTA 2ZR8A 1O58A 2OCAA 4U2CA 1MB2A 3F5FA 2I67A 3NASA 1TUGA 3FOBA 1NHMA 1U0OC 1GRRA 3KR0A 4PR0A 4L02A 4RELA 4E30A 1T1EA 5FJIA 5CVTA 1QO9A 4G63A 5DTMA 5BV1A 2F55A 5FI5A 1RZRD 1NU6A 2IXGA 4FZ5A 4BEJA 3B9PA 4MIYA 1XCOA 4E15A 1XJ5A 1YE3A 3WNDA 3D1VA 2RHCA 4CN8A 3R9XA 3BIWA 1M1ZA 1ZRSA 2BGKA 1IBMB 4BP8A 4ND5A 1QANA 4ZD6A 1WOMA 1E1RD 1BFDA 1W8DA 5IC4A 4I4LA 3THXA 3IBYA 1SXIA 4KO8A 4BMVA 5BVGB 2Y8EA 3EVDA 3ZCTA 1DJMA 2IJGX 5I9IA 2VWQA 4J03A 2BP7B 5F7JA 2VDVE 4UMEA 4RUKA 3L9XA 1SQGA 3HHPA 1N4DA 2JHPA 3HR8A 3JQ7A 1IPFA 2ZG6A 3CVWA 2QTHA 1CEXA 2GNAA 3IL2A 2IE0A 1BXRA 1RM3A 4PZYA 4RVFA 3ZCQA 1LK7A 2O2CA 2KLBA 2V55B 2O3TA 2V3WA 1DVRA 3JQBC 1SJ9A 3PE6A 5F12A 5C8YA 4ZAXA 3A6DA 1BRTA 4QOEA 1A95A 4L3OA 3BRQA 4P4TA 3J81A 1FNSA 2PN1A 3A06A 3ADOA 4UTPA 5CB4B 9ATCA 5KZMB 3L7OA 1RHUA 5ILQA 2XSZA 2VHTA 3AP1A 4DQLA 5IXSA 4YEDA 4GPZA 2OCXA 2RH8A 4UNNA 2A5LA 2FN9A 3B9BA 3QY0A 5GAJA 1EDDA 3U3ZA 1MEJA 2PUHA 3I09A 5HTKA 5IH3A 3UXMA 1LTQA 1XTRA 3OKAA 2BC9A 5HZMA 2QS9A 1T29A 2X6RA 3H4MA 5KNDD 1SBQA 4N6NA 3N0RA 1E3DA 4S35A 2CLSA 4YMVA 3I5YA 1UDRA 4GNKA 1VB3A 1Y6JA 2BMDA 3O9ZA 3QA9A 4Q4HB 3OM0A 2AS0A 4GBED 1J8QA 2WE7A 3T15A 5EHZA 4UEJA 3TZLA 3SOZA 2FG6C 2I7DA 3PF9A 3AUXA 3GRZA 3NWBA 3PA8A 2SHKA 3K71B 3MD9A 3E35A 2CNOA 3OY7A 3PC6A 4U5QA 4Z9FA 3RSGA 4EDFA 5KX5A 2QPLA 4AAYA 2XB8A 3MLEA 3LWDA 3OECA 3ZWWA 1WD7A 4ZTBA 3ABOB 3OFJA 4P35A 4WHMA 2ZIAA 5E2AA 5EJIA 3WJ2A 4Y1RA 1IOLA 4AS3A 1EUYA 3C7DB 3RO7A 4DE5A 3UMYA 1OH6A 1EUZA 4X5OA 2O20A 1FMCA 4CFSA 1VJGA 5EN4A 1QQ5A 2VP3A 4FYHA 3AEQA 3E7PA 3DE1X 2XMSA 4Y9RA 1SZCA 4URHA 3ZE0B 2MTBA 2JEYA 3G9TA 1TTQB 1MABB 2EBFX 3TE7A 3BT7A 1KNXA 1IYZA 4RVDA 3CPHA 4WJKB 4IJ5A 4A1OA 5DO9A 2GEKA 2HWUA 2DKOA 2VBCA 5JFGA 3SHOA 2Z98A 5JVDA 3UMMA 1NG1A 2CMFA 1C7IA 2JANA 3QOYA 3WWZA 2O54A 3ENNA 3OLXA 1WB4A 4LJ4A 4NBTA 4BNZA 3SC3A 1U1DA 2C03A 3ZX5A 6NULA 1IBCA 1KSHA 3NTQA 1K27A 4J0DA 4DIOA 2IOQA 3L79A 2C3PA 2XECA 4PZZA 1SC9A 3PC7A 1F4LA 4RQTA 5IAGA 1V48A 4QU5A 4RSMA 2DERA 4F92B 3ZCUA 3LCUA 3LCVB 4XSHA 3LX5A 3T1TA 5DSXA 3VC1A 4YMLA 4LE0A 1F51E 3H13A 5IEBA 4NL4H 3T9FA 4PLTA 2JG3A 4R51A 5KNBD 5FQOA 3ZU6A 1JVSA 3R9IA 4QO7A 3ESQA 4XH9B 3UG7A 2HSGA 1NRJB 3OX4A 3UGKA 2ATXA 2QU8A 1MJHA 3FZYA 4PX9A 3QHPA 3WIBA 2XTAA 4N4AA 3KKQA 4ZVLA 2RARA 3F0TA 1GPAA 1QSGA 1X15A 2X4GA 4J3JA 4KL8S 4UPDA 2JLXA 3NVKI 4W1RA 1QTQA 2ZJ4A 3VR2A 1NXQA 3TCXB 1ZC3A 5F1YA 1N7IA 3W8DA 5CK5A 5IXJA 4B7XA 5MN6A 1J1IA 3KR2A 2XVZA 4XVQA 2EJCA 4RL6A 4L4SA 2FPMA 2R6CA 3DPUA 3H9EO 5FJJA 1VYVA 1P5ZB 2WIFA 4XOIA 2PKWA 1YONA 2Q1SA 3OTQA 3UGQA 4YJFA 1JKMA 5F23A 4PRLA 5DXFA 4BLQA 2P9TA 2XBUA 2GZRA 4RV4A 3D5EA 4EQ6B 1TECE 4UTZA 5SY4A 3WL4A 1SXGA 5IZCA 1HR0B 4XKJA 2ZYHA 4RF4A 4PYOA 3HXQA 3GGPA 1OAOC 3RHTA 3UUGA 2XE4A 3QEAZ 2JBWA 1PNOA 4MPPA 5FBWB 3AG6A 3UN1A 3NHSA 2X8JB 3WLTA 4RADA 3HDJA 2PLFA 2SICE 3UC9A 3EAGA 4B4VA 4MV9A 4EH1A 1FDVA 1NW5A 2YZMA 1XIVA 1Q20A 2YFQA 1SIWA 3VX4A 2X3FA 4EP1A 2JLYA 5CLLA 2P6OA 4M9SA 3FNGA 4MLZA 3ZGXA 1GPH1 4PFJA 1BIFA 2H29A 4MR8A 4Y1EA 1E7QA 1ODTC 2BFNA 1EQAA 1TYCA 4R54A 3D43A 3GEMA 4G8JA 2WMNB 4X94A 1W4BA 4ENTA 4A9AA 5F7XA 4D3YA 1QAMA 2YCBA 5L3QB 1R0XA 1UFOA 4KMRA 4LRTB 4ZVUA 3C74A 4B6GA 3CEPB 1GN8A 4RU1A 3AXSA 5TJHA 5HILA 5TVGA 3L7DA 3AR7A 5HUHA 3RHFA 1B16A 1PKEA 2PRZA 2R6AA 2F4VB 2QYSA 3THRA 3N0WA 2R1VB 4HI0E 1KFCB 5HQJA 2RBEA 5B2ZA 5D3MA 5ESDA 4CLRA 3IXLA 3M82A 2Q41A 5JD5A 4PQFA 2PZEA 4MV0A 5CU7A 3FDJA 4NMWA 3SJCA 1PSZA 4BB9A 5AFSA 1WXHA 4XCVA 2NXCA 5KTRA 4EG5A 5CA0B 7MHTA 4R1TA 2GM3A 5HM6A 3CNEA 1WXEA 4IDBA 1ENPA 3RYTC 3WXMA 3IHLA 1A50B 1EM8A 1T13A 1U94A 1YASA 3RSLA 3TPZA 1PT5A 2X4LA 1CRZA 2GRJA 1MGPA 4GKKB 3UKJA 3AIKA 2J9YB 4H7IA 4DGSA 4DSNA 1DWOA 3LT4A 1GPLA 3RUCA 1XX6A 3VZRA 1AA6A 2G9QA 1EVZA 1WIWA 2C00A 3AHIA 3IUYA 1DX9A 1TE2A 3GVPA 3BA6A 2GB4A 1H85A 3RFFA 1RHRA 3GGOA 4J16A 3KSAC 3ASYA 3G3EA 2HDZA 3EIFA 4KYIB 1X92A 1U4NA 3GB9A 2Q2NA 5HKOA 3VR6D 4TQGA 3ROZA 1L1QA 1WX1A 4RULA 1E1KA 1Q0TA 3ED1A 3OPXA 4DSAA 3B53X 4XGQA 1ISIA 1JMKC 4TUYA 5AM4A 1SCUA 2CS1A 1LF5A 1OT5A 2IPMA 4X6LA 1PUJA 2AX4A 4CIVA 1Z73A 4JI2B 3T61A 1JBEA 1N2OA 1YNSA 3O4GA 3ZXXA 4YRGA 3NTUA 3I3OA 1C9MA 5F5LA 1W30A 1ORIA 1V45E 5BW5A 4DIEA 1PWYE 3PFBA 3H9GA 4FFRA 4ID3A 1PJCA 4ETMA 1SVUA 1VE3A 4YXWA 2PZKA 2QDKA 5FUWA 1S8AA 3IQHX 5HXAA 3QOFA 4F2HA 1F12A 2CNDA 2PQ6A 5BMVF 2EW8A 5FPSA 2ZBUA 3JWIA 1VE1A 2HU8A 5A9TA 5IJ9B 1RC1A 1E62A 1J2YA 1II9A 1W19A 1B1AA 1Q7TA 2EFJA 3LLUA 4RABA 3C3MA 4EEKA 5AW4A 3TNYA 3DJYA 1WXLA 1Y8QB 3G7NA 1EZ1A 1JRLA 1WB6A 1HRZA 2VJCA 4K0RA 4XWGA 1W4ZA 2FEXA 3CO0S 4HLCA 4KQ6A 1ENZA 4FD2A 4F4JA 2FUNB 2I2DA 1M6VA 1FRVA 2PWPA 2NU7B 3OT1B 1TJNA 3U7QB 4CL2A 3FMOB 4QOGA 1ZBQA 1YI8A 3ED5A 4NK4A 3WMRA 1U63A 1SFRA 1R9JA 2C88A 1YR2A 4U1RA 1JA1A 3JVUA 3BRWD 4MP8A 1QOQB 4FYYA 3TTSA 1VHDA 3MTAA 4I5EA 2BR4A 1A4RA 1YRWA 3EDQA 4NCKA 1G60A 4C0HA 5LYJB 5GONA 1J5EB 4J75A 2GHQA 2F2TA 4YUXA 1SOWA 4DLZA 4HD8A 1GKYA 2ZVPX 3TXYA 2CDCA 1JEYA 3TK1A 1DUVG 5C9ZA 2COUA 4RK0A 4L73A 1EM8B 5C53B 3C6BA 1BXGB 2GKOA 3VBEA 3RBZA 2GZKA 2Q3HA 3VMMA 4C3VA 5K0JA 3ZNOA 1MVLA 2W4MA 3FOWA 4BNFA 4WESA 3EDRA 4GXQA 3E23A 2Q6TA 3E4DA 2OV2A 4ZOAA 1JEAA 5WRFA 3V2GA 1NJ6A 4J1TC 3OQNA 4RY9A 1E8DA 3C4VA 3X2EA 1IWOA 1JHOA 1UJCA 4ZN6A 4QQ8A 4CQNA 3LDHA 5DU2A 3UBMA 3K4PA 5DPMA 4NEQA 4IJVA 3AQ4A 4ND4A 3RFVA 1W94A 5C8VA 3E22A 4J2TA 2R7AA 1PE0A 4K9KA 3GMIA 3AI7A 3IUJA 4FGSA 1JH8A 2Z1DA 1ADGA 2YQ4A 4GYJA 2JA1A 3BAZA 4P84A 4P98A 1F2DA 4LN1A 3ISVA 1YK1A 1F8XA 4LZZA 4D3XA 2A5JA 1ZLYA 1XMQB 1GT6A 4FDLA 1VHJA 4LMAA 3SXUB 2BH2A 1QHGA 4I46A 3TN7A 4F38A 4PFKA 2W2PA 2FSUA 1MJGA 1ECBA 2HPVA 3VMFA 4Z2AA 1E0AA 1TM7E 4P4UA 2PGLA 3T9CA 2EHJA 1TAUA 2P5SA 1MD9A 5BSKA 4B3TB 1GOTA 4K8OA 5F2EA 1Z4PX 4WD3A 1WBBA 1I0IA 2ZSJA 3HRHA 3PGVA 4F9GA 1G8PA 1GPYA 1RQ2A 2F8LA 2COEA 2VYFA 3EZLA 1QIMA 2RHOA 1XKXA 1IUOA 1JWAB 1RXYA 4Z53A 2Y2UA 3ORFA 1N9ZA 3SLRA 3GZ4A 2IT1A 4IDNA 3IVAA 3TAUA 3IEUA 3FMFA 5L51A 1XQYA 4H60A 4PQEA 4CWAA 1IJEA 2C9YA 2VUIB 1X13A 1YXMA 1RKQA 2F64A 3LM8A 1K8YB 3RI3A 6Q21A 1WCV1 1W9MA 2ZWVA 4X7RA 3T1QA 3VU8A 1W7AA 1Z47A 3PXAA 3DMGA 2QVXX 4I4CA 3H2GA 4RM3A 3OZTA 2IBTA 1J5XA 4YN3A 2Q3LA 3DHNA 4LSWA 2VH2A 3AYZB 4BV3A 2HFJA 5ESXA 4HWKA 1KWKA 1RM0A 1H42A 3I39X 3IMGA 5D01A 2P2NA 1L0BA 4CHGA 1AGYA 5FBLB 1FCJA 2VNHA 3KM0A 6ADHA 1KQGA 2FW9A 4Z54A 1CEEA 4J90A 3UK0A 4EECA 3EA0A 1Q2UA 2VZLA 5KSWB 2WV9A 1QVZA 4HH1A 2D06A 4EB0A 1ZGZA 2CMHA 2OGUA 4JP1A 2WDZA 1R50A 4R9RA 2RC5A 3DTTA 5DHPA 1Z6TA 2NZ8A 2Y9MB 2EX0A 3A1DA 4QUBA 2O7QA 4PFSA 3JTEA 1P7VA 2QORA 4KXYA 2QNRA 2VDMB 4GGOA 1RI4A 1FTQA 1L7PA 1XMPA 3TMYA 3L4JA 1PHRA 1BCSA 1T9ZA 4U2FA 4U7FA 2WJAA 3L40A 4WOPA 5J4VA 5LMNB 4QUIA 3VSCA 3V7UA 1RJ9A 1TZJA 1JLRA 1NOKA 1ODIA 3JQ9C 1JDBC 5YASA 5EMLA 5KHOC 1A5AB 2B3DA 4JZYA 4Y2TA 2Y1EA 4O4IA 1ETUA 4F3RA 1YCGA 3MS4A 1GKUB 3U62A 5MN5A 4L4ZA 2FR8C 1E2KA 3E3LA 4EW6A 4ZYZA 1YRLA 2CHGA 1VZ3A 3HVIA 4PHCA 2VNAA 3RUIA 3SXUA 4WBNF 1FX0A 4KQFA 1DFIA 1Q2XA 1SHTX 3IP3A 1W49A 2GAFA 2X0KA 3SE7A 4M83A 1B0UA 1ID8A 5BPFA 4GU5A 4Q9AA 3TGLA 3K7EA 3G0CA 3X2SA 3RGWS 1P0MA 1TD1A 4DUPA 1K2VN 5B3JA 3WGYA 2JI6A 2RHJA 5FOWA 1IBLB 2QZSA 3DEYX 2YN0A 3MCVA 1NM5C 4CLDA 1TKCA 4J7UA 1W0JA 1G2QA 3CINA 2ETXA 1YS2X 2CMGA 3ZD8A 1XJWA 2X1LA 3DZDA 2I22A 4R68A 3ZY5A 4JVMA 2Y6UA 1ZHFA 5KDDA 2Z5VA 3SJ7A 1I33A 1W5FA 3WO0A 2QRNA 1OI4A 2ODAA 3GEBA 4UBJA 1PEKE 2NYAA 4MS1B 5FIUA 2VQFB 2CV0A 3GUHA 1XBTA 3KFLA 5U4QA 1TK9A 1EM6A 1PJRA 4X1KA 2O59A 2GKSA 4O4LF 4E46A 3PK0A 3MBIA 4HXGA 2JEZA 5DASA 5IN4A 3CE9A 3KKPA 5JAHA 4MQLA 3GIWA 3PC4A 4OAQA 3ABQB 5HJ7A 2QX9A 1Y1KE 3DVAB 3SQLA 5A9SA 4GLJA 1T5TA 3ZHXA 5KJ6A 1N2JA 3L7AA 1Z0JA 1IH8A 1U7XA 2BKUA 4ZFNA 5KC8A 3IR6A 4AKGA 3BORA 2V4MA 3LHSA 1VDMA 1X7XA 1RZRA 2ZE8A 4WN9A 1KK0A 3GYGA 3L7YA 1GVNB 3Q3CA 1T9GS 1MLDA 2YFHA 3RT1A 3QK7A 3LBAA 5BRNA 1L1RA 2P69A 5JHGB 1TKBA 1J0XO 3ACBA 4KVGA 1U3CA 1VLHA 4WXYB 4LFBB 4HNAB 2H2GA 2PJZA 2CV1A 2XBMA 4RF5A 2J3MA 1JHRA 4X8MA 3CSUA 2P9CA 3HXLA 4F5DA 1NAHA 1D6JA 4OXRA 4L78A 2RE8A 1I13A 3AFHA 1PAUA 1YQEA 5B2EA 1GA6A 2BDEA 2REQB 3G0BA 1PL0A 4P54A 5JAZA 5JR3A 3LECA 3HXTA 5C37A 4IDHA 4DCOA 5B3LA 1JG7A 1U2EA 3VKFA 4LOIA 1QHIA 1RYZA 2P2GA 5E8JA 4BIMA 3SAJA 3AJDA 2F3SA 4I1VA 2W2QA 3FR8A 1NQ5A 1G4AE 2V5VA 1AQ6A 1U9YA 1NHNA 1YVEI 3OOHA 1Z5UA 1R8XA 2DHDA 1NJGA 4TL8A 2UUBB 4CQLB 1VE7A 2WG2A 3WLSA 5IU6A 3OLQA 2WRZA 4WEQA 4ZIRB 1L2TA 2OXRA 3KZKA 1KY5A 1GNLA 1RWMA 1H0SA 1ZG3A 5A0FA 3SDBA 3G13A 1F48A 2OCGA 2A67A 2R8RA 1RYBA 3CXRA 5KVQA 3T3HA 3IBCA 1IUKA 1T9BA 4LQLA 3FTQA 2RGUA 4Q1CA 4S3MA 3FGNA 3SGLA 2XB2A 1S2LA 4AP5A 4GRDA 1B8UA 4G41A 5EHXA 4GI1A 3VYTB 3G68A 1E92A 1QF9A 3NYWA 2VP6A 4C07A 4IMIB 3JD0A 4Z8XA 5GOTA 2RGNA 4FFWA 5I4IA 4CMIA 3B1KA 2OHGA 4GOXA 1OH7A 3IP9A 3ER6A 4UOEA 1PZFA 2ZBQA 3UENA 2ATIA 3CF6R 1I5RA 4D3SA 3ZXYA 4MA4A 3GF4A 4KPGA 1KOLA 1ZJWA 1Z6QA 1EQ2A 2B2NA 2GTPA 2VJAA 3A9SA 1XU9A 5ELLA 4AN1A 4AY5A 3ZIAD 5HCNA 4LDZA 3OO1A 2GVZC 3SE0A 3RU2A 4CKYA 5BNTA 2AI1A 1DADA 3MAJA 4IKPA 4U2KA 5A9SB 1CG6A 5K7SA 2WF9A 1V43A 5AM5A 3GLGE 3PU6A 3LCCA 2Q7XA 3TB6A 2MYUA 2UZ1B 4N7JA 4X93A 2R8YA 2RGAA 3ZD7A 3R40A 1KGSA 2B36A 4M1EA 4F91B 4ZCTA 4ZEWA 4YR7A 1QO7A 4HVLA 1NVEA 3T7RA 1HEIA 2OZEA 4KUGA 1JKJA 3O0DA 1SR8A 2V9ZA 1L5HB 4JB3A 3TEFA 4DDVA 1GDTA 1ACMA 2X1HA 5JMOA 3FB1A 1EXWA 1ZPDA 2BGJA 5A4MS 2VSQA 3A4YA 4QLOA 4DWJA 3FETA 2ZRLA 5T7BA 3TFOA 3QEJA 5FFNA 4K9SA 4JI0B 2ZTSA 1LC0A 1W1WA 4BO0A 5JT1A 3Q0TA 1YMQA 3ILVA 3G9UA 4Q1AA 3WADA 3VC2A 2XT0A 1JAHA 4MQEA 2DP4E 1YD7A 2EIXA 4WZBA 4YLYA 1O0CA 4KHPB 5JPCA 2P4HX 4ME6A 3AK4A 1OFUX 1G4UR 5F3RA 1JKXA 5DX8A 4QECA 5K1ZA 3EAQA 3P0HA 3MTIA 3FHTA 3FYUA 2J3HA 3ST7A 3ZGZA 4UFOA 2YKGA 3K32A 2YXBA 3PRHA 3N5KA 3BRWA 2DUMA 2DJIA 3OE5A 4JVOA 3RYFB 3ZWKA 4YXFA 4UDOA 5B7NA 1HYQA 5D2CA 1RC0A 2GYYA 2P0AA 2CV2A 1QORA 3V8NA 3RUFA 1J8YF 2A4MA 2QBYA 1N2SA 1QV7A 3GUZA 1K06A 3G1UA 4OK3A 1OX5A 1V41E 2PV0A 2V0CA 3VU9A 3ZVMA 3H97A 1CUDA 1ZXXA 4QG7A 1N57A 2QQEA 3HKDA 1B14A 2YY5A 3I32A 3L5OA 1NHWA 5B3JC 1EBBA 5IN5A 3T1NA 4UM5A 1NI3A 1OH5A 3N2LA 1ZR2A 4I9UA 5EEHA 9GPBA 1QE5A 2DUUA 3JVVA 4KUEA 3W5JA 3WDSA 4AI6A 3UFXB 4BZXA 3KLPX 2O23A 1WKCA 1E79D 4PPYA 1VSUA 2ZCVA 3G0OA 2R3SA 3TRHA 1L7QA 3FTNA 3VPGA 3DFKA 4UW9A 1GR0A 2ZJZA 1EJ0A 4B80A 1A1SA 4BFYA 3KZXA 5I7UA 4GF5A 3OZRA 1F6DA 1BZYA 4FXPA 4JLSA 1JF8A 4QOSA 4MYSA 1R0ZA 4AS2A 3AJEA 2ZSEA 2PT6A 4YAEA 3N7AA 4RV5A 5HKKA 4FFLA 1EUCB 2QTNA 4GWLA 4P92A 1GZSA 1ICEA 2FETA 5MDHA 4OU5A 4DJJA 2ZM6B 1Y3HA 3QOXA 1U3DA 1PFYA 1KI1A 1OLOA 4NU8X 3PB3A 3TZQA 2W98A 3IMCA 4EHLA 2IH4A 3SR3A 2OGTA 3NTLA 3WYFA 1ZVJA 1M8FA 2WU1A 2A9QA 4OFWA 4PZLA 1W2GA 4REOA 3CT6A 2AMFA 1GNQA 1CJBA 2BN4A 5TQ2A 4O0LA 4D80A 2YJ4A 1FMTA 4N65A 2O2DA 3L8FA 5I01A 1R4AA 1K8RA 2YXPX 3E58A 4QQFA 1ZOOA 4ZHQB 5EJ5A 4AULA 3D6NB 2Z2YA 3VQTA 5HRAA 4FHZA 4IBOA 3H1AA 3M81A 1JFLA 3GNQA 2HJVA 4KWCA 4IUBS 4OQEA 3M3DA 1RXWA 5C4IA 4B3BA 3TCNA 1EX9A 4MI1A 1CK4A 2CZCA 4BKQA 4TSFA 5ER9A 2IX9A 4II2A 4QT4A 3H5LA 2CLKB 2Y93A 2AYYA 2LUOA 3N75A 3BB1A 4JBLA 4AP6A 3E7FA 5JSHA 2UUAB 2RGBA 2R8XA 1PBNA 1XYYA 3LVRE 3RUHA 3NLLA 3RYFA 4F93B 1XYVA 2NVBA 4IWXA 2F48A 4I8IA 3U5TA 3T4PA 4EA7A 2QRGA 1VRVA 2WY2D 1NRXA 4HS4A 3DHVA 2HR1A 2EKLA 2B69A 2VQ3A 2H9IA 3S28A 2QPTA 3L5KA 2R6GA 1SVWA 1U2DA 1XI2A 3VTKA 1N25A 3G1TA 4MUKA 2Y0CA 3X44A 1F17A 4LECA 3OZVA 3S1SA 3ADBA 1U3WA 2I0FA 3WNBA 4LF7B 3G8YA 3DH0A 2CGEA 1Y9ZA 1AQYA 4YJHA 5CLFA 1E69A 3PA6A 3MJFA 4UNQA 3LX6A 4D0SA 1ZVMA 3OA2A 2YZ2A 3DEIA 5A3VA 1L5KA 2JZNA 4BMDA 1JTVA 4JJEA 1T4GA 2B4RO 4EFKA 1QC5B 5EERA 1Z36A 3DYBA 1Y82A 1NMZA 4HOYA 4OLBA 1YR9A 1HQCA 3I3SR 5LDDC 3VNVA 4MHSA 1GQOA 2OUIA 4TYPA 2O5VA 4M1YA 1K4KA 3HKBA 3KL2A 2OILA 3FLMA 1AJEA 1IFXA 3E15A 1QJCA 2RHLA 4MEBA 1VJDA 1NBIA 4WPGA 4UHHA 5EUMA 1HSNA 4DMFA 2O8BA 2CLEB 2ZITA 4HX2A 4PGAA 1X7YB 1VYHA 2LIPA 3EXHA 4KQCA 1C2YA 2F8SA 3DAPA 4J7AA 1OIVA 2AUNA 3HEAA 2L18A 4EVSA 1Y8RA 1TZKA 2QN6A 2H2FA 3HY6A 1CHDA 1WHTA 3CLVA 3F2VA 3H3FA 2VF4X 4TYQA 2PX2A 3PUXA 5F5NA 4F6CA 5JNUA 4J4BA 1CE8A 4BJ6A 4ZHQF 5IT0A 1JT2A 1UC4B 2VP2A 5B1YA 2GAJA 2UVDA 5D3QA 2LZ0A 2A5YB 1BDMA 4GNRA 1WMFA 5G0UA 2PUCA 3C3CA 2EZUA 5FH9A 5HR5A 3X0DA 1TXGA 1UEXC 1KU6A 1J00A 2WKWA 4QPZA 4V0OA 2WF7A 5E6UB 1I2MA 2KM1A 3BL5A 4WOBA 3V1UA 2QY9A 2Z1NA 1TLTA 2OQIA 2I2WA 4ALMA 1WSAA 1O6BA 1BQ4A 3E2PA 3EYWA 3Q9NA 4M9QA 4WK2B 3FBWA 2M9MA 4EABA 1Q3HA 2IUUA 3K9FC 4M1OA 1QP8A 1NF3A 2B2CA 4MLPA 2A92A 2MWMA 2BZSA 4FOSA 2IUSA 2WDPA 4QEKA 5CM2Z 4UXJA 1AKWA 1TC2A 3FAKA 3OQHA 1Z8NA 2JI8A 4KGVA 4UCQA 3ZLBA 1N5JA 4DW8A 1RAFA 2OXCA 2HDOA 2Z04A 2Z8YM 5FL3A 1NBEA 1PHPA 4AMGA 4H17A 4G1FA 4HEA1 5CFPA 1E4OA 1DCKA 1DX4A 3GJ3A 3L0YA 4UTRA 4FSXA 4A0QA 3EH2A 1TAGA 2JBHA 4LYHA 4RIFA 4JB8A 1IY2A 3LOUA 4A7PA 4MJ3A 4CKEB 4ZZ0A 5DN6D 2ENUA 4HVTA 2SNIE 4C0KA 1RPZA 1Y1LA 1TQHA 4CLXA 2NWQA 1AS0A 3VPAA 4Q9HA 3QVTA 2GK7A 4Q4JB 1QF7A 4RIEA 3QGMA 4COOA 5KYUA 1YS7A 1DBVO 1MB9A 4LYYA 1IC6A 2H85A 3O4HA 1V8DA 2HDNB 3V8QA 1XAGA 4KQXA 2F8TA 5HQ3A 1J9EA 2P91A 5FPHA 3GZTB 2E87A 1TQ6A 4YX9A 2A2ZA 3OAAD 5LOVB 1KJNA 3O21A 5EE5B 4ECAA 3AVWA 2DFDA 1PR6A 3W2GA 1H5NA 3K8ZA 1XXHB 1EVLA 1G3QA 2PCJA 2B8NA 1RPAA 2J31A 2ZP1A 1PFUA 4HN4B 2A4KA 1X7GA 2X3UA 3BSSA 4I4TA 3TLAA 3IFSA 1E63A 1SU8A 3FLBA 2Y3IA 4RX1A 3VUEA 1RXCA 4X44A 1O96B 2GEDA 3JQ7B 3ROPA 1H0RA 4HLDA 1SPBS 1EEXB 4V0QA 4GI3A 1D0VA 4PVDA 8ADHA 1ZNXA 1Q12A 4CV2A 4CM8B 5CNJA 2C7VA 3E9NA 4CR6A 3CS3A 1X1TA 3S2IA 4QXOA 3SLKA 1MZPA 4NFSA 1N5KA 1RKXA 3JAWB 2YYAA 1QIFA 1S89A 4IDOA 4GQBA 4RETA 3WAKA 3A6PC 1FUUA 1Y3DE 4K1XA 2R86A 4UMVA 2ZIEA 1LPAB 1V5EA 2Q50A 4HTAA 2WQZA 1XTKA 4HYQA 2B5OA 4FYWA 4D6YA 3TB4A 3WDKA 3FKQA 2G70A 4AU1A 2AQHA 1UMDB 1YOVB 5TARA 1R6TA 1KAOA 1RW4A 4UBOA 4B6QA 3I76A 2HEGA 4HX5A 3W2IA 1PDOA 1SO8A 1ZINA 1QRSA 1MR3F 3D4BA 2LCFA 1L5LA 3DZFA 2HQSA 3FSJX 4BN0A 4BO7A 3QWAA 1BE1A 1VCIA 4MSUA 2ZW9A 1FXUA 1KZHA 5DHTA 3F6SA 4IFEA 3P9RA 5EKXA 4BU0A 4E6EA 4IS2A 1EWVA 1ND6A 4EAQA 2PY6A 3Q11A 3B48A 4BKPA 1MTOA 4H9GA 5FTNA 2B94A 2ZR9A 4CM9D 4K2HA 3DWFA 4XD2A 3HGQA 3OKPA 3LL4A 2XGSA 4MS4A 1XHLA 1KP9A 3TZKA 8OHMA 4J2OA 1GG8A 3KLBA 1JR3D 3RSSA 3C14C 4FCVA 2IDZA 4HQOA 4AX4A 4I1SA 1IQ0A 1GDHA 3VR5H 3IEVA 1TIBA 2K4MA 1V5FA 4HDMB 3GWGA 5AVQA 3U3DA 4RD6A 4DLNA 2IRWA 1ZNQO 3LO8A 3U3OA 2ONYA 2W2KA 1DSSG 1NRWA 3IESA 4HUTA 1WHSA 3EXFB 2HJHA 2O3RA 3KXIA 4D9NA 4GXNA 4J43A 4UBNA 4D9JA 4Y6OA 1ULTA 2Y0EA 3PXUA 2WYOA 4ZVMA 5JFOA 3EIQA 4EPYA 4Q9NA 5KNBA 2HC9A 2IXTA 1CR0A 1DZ3A 1QB7A 4IWNA 4MV3A 1E5VA 1F2UB 2Z3WA 3ILSA 3QLVC 4RBNA 1GCGA 1HDIA 4BOYA 5IYZB 4RV9A 2Z3ZA 4Y9UA 2JDIA 1H4VB 5I8WA 2D6FA 1YV9A 3EG9A 1TIPA 1RFLA 2AMJA 5EKUA 2BV3A 3CX8A 3L0SA 4M36A 3P4XA 4QSMA 5I48A 5GGXA 1BJTA 3F8SA 3O1HB 2OV1A 5ALOA 1HFEL 3C1UA 2GJKA 3FDIA 3P2JA 2PZMA 3P9QA 4Q7MB 5TVKA 2IIPA 3ZPXA 4Q4DA 2O52A 1DQNA 4M4SA 4QGFA 2CXXA 3E70C 1NUPA 3ZGOA 4D9BA 721PA 2OCPA 1EXMA 2XWSA 3I2IA 3LOPA 1YQTA 2VWPA 4WUTA 4BE4A 1Y3FE 1Y4ZA 4JI3B 1LVUA 3P27A 4JZKA 4GPIB 3GFBA 4TXJA 4V0RA 3T3GA 3FSGD 1CS0A 3OEWA 1NHGA 4JQCA 3AIMA 3O0TA 4KXQA 4F6LA 4OHXA 1RAHA 4C4TA 4CV0A 2ZSBA 1P9NA 3GA7A 4MIOA 3JASA 1HXHA 4UXIA 1PCXA 5E6SA 5KNCD 3GT7A 2GJ8A 3BS4A 1BRMA 1X8XA 3O8BA 2XMZA 1TZMA 1KF0A 4YFYA 5E7QA 3AP2A 5CDHA 1Q74A 3GGSA 1HRKA 3WV5A 1KHHA 2NSHA 4RJTA 3BRCA 3C5CA 5IDQA 1FP1D 4EUNA 3GEIA 3BWMA 5LNK1 3JQGA 5AKGA 5JATA 3OT1A 1M72A 3MWDA 4O4JF 3DO8A 4Q37A 3S5JA 4Q7LA 5EFZA 5B53A 2D0IA 3GK3A 3WRXC 1OUMA 3K1AB 3TEMA 1QG4A 2QAJA 2YQIA 3UK1A 2QVCA 4UUMA 1I4DD 2CBXA 1M3SA 3TW8A 1KYIA 3BGWA 1B3BA 3BCHA 4S1OA 3R5JA 3A2KA 3CNHA 1DEXA 1TOAA 2DR3A 4C6TB 2EFEB 5LP1A 2IDKA 1OXTA 3TG2A 3A0UA 3R9KA 1WL8A 2GNOA 1UZLA 3S70A 3S1LA 1QIDA 2F9LA 3I9FA 3CEJA 3J7TA 1ZU4A 2FE4A 1OKKD 2VRBA 1NLMA 1QRDA 1JWLA 1OX4B 1RI5A 4PTZA 1R37A 1MW9X 2J1LA 4Q82A 5L3QA 4HR7A 2P6PA 4HYEA 2W6OA 3NJ8A 1MRNA 1P61B 1CJMA 4C05A 4GEKA 1FJ2A 2W37A 3NIGB 4LHXA 1EGMB 1G20A 4LBWA 4O0MA 3AJRA 4D56A 2JAWA 4OM8A 1PR1A 2BZ1A 3E7WA 5BV7A 5AICA 5GJCA 2BE9A 3AVYA 4RE6A 2R1VA 3QMWA 4N3NA 3FNFA 2G06A 4V3CA 2F90A 2AA3A 1U5BA 4YJGA 3UJAA 4ZVTA 3Q10A 2B7CA 2ZR0A 4PQYA 1PFKA 1H8ED 3RVRA 5T3YA 1CY8A 4US2R 1THGA 2HI0A 2GX6A 3VH3A 5JRDS 3N2GA 4I55B 3ZIDA 2F9FA 3BM5A 3EF0A 2RKWA 5KYNA 2IZ1A 4E3WA 1V71A 1M2JA 1H3FA 2J9GA 5DTJA 3HJNA 5F77A 1NNI1 3HR4A 3I9MA 3E9RA 2PQ0A 4L08A 4J2HA 4DMLA 2V65A 1M33A 1DEAA 1P33A 4OJKA 4UKDA 3I37X 1PS8A 2IIVA 1U11A 1Y9JA 4IQGA 1U6JA 4B45A 1G5TA 4DLYA 1XNRB 5ALDA 2C7RA 4N0PA 1SKAA 1W34A 3U60B 2JJYA 3PV0A 3K1ZA 4FJ1A 4Y1FA 1J9ZA 4B3SB 2RH9B 1E5XA 2Q5IA 3DXXA 5JNLA 1JQBA 2BVNA 3HUFA 5ECYA 2OTCA 2W0SA 5AR1A 1PR3A 3DZJA 4A82A 2F7SA 5I7RA 4XUCA 5FQNA 1WW2A 2FPIA 4Z7QB 1L4UA 4TZTA 4BE9A 2WHRA 1JT9A 3VC7A 4D46A 5A5DA 5KREA 5EQJB 4GDFA 1HA3A 3PNQA 4B6PA 4N76A 2P9GA 3QKRA 4N7MA 5DI3B 5G4KA 3FSGA 3KX2A 3OJOA 4BGUA 4EGFA 2V6GA 4MKRA 4CG0A 3A9RA 4URXR 2P1DA 3CUWA 1CWUA 2BGWA 3KT8A 2VDPB 2FUG1 5BSWA 3KQMA 3TTVA 2N1BA 3BGOS 4AQDA 5GTDA 4C6RA 1T25A 2NTEA 3FUCA 4IRXA 1A82A 1L7DA 4X1IB 5CBPA 3MOGA 1SA0A 2YN4A 2W5UA 2ZU6A 3HB0A 1YI0A 3ZHQA 4CT5A 1Z7BA 4A92A 4BNHA 4NMXB 2EIHA 4AX8A 3INGA 4QR9A 2QAGB 1DTSA 2VRWA 3WWEA 4EHJA 3I0MA 1ZLXA 4B75A 1WZEA 3KUCA 1MMFB 3IQXA 4H7PA 2XCSB 3PJDA 4X85A 3MA0A 1FVFA 3G0GA 4UU8A 1MPXA 1SCIA 1DQPA 4QQRA 3R2JA 2XQFA 3HSSA 2RKOA 2QROA 4UUOA 3K9GA 2P9ZA 4DC1A 4YCLA 2VOEA 4JDPA 3PUVA 4YTEA 3GR6A 4Q0MA 4BX2A 4XR4A 5DX1A 3WWCA 3HY3A 3CW8X 4HXEB 4DIUA 5K3OA 3ODGA 4U00A 4EBFA 2W6NA 4OSPA 2NVUA 3C8MA 4LNHA 1STOA 4DEYA 3PQ2A 3B1JA 4EHKA 3GHYA 2LHJA 4FOTA 3KZCA 1HSZA 3M4NA 4MGZR 4OXYA 3RVLA 5JH7B 1UJ4A 3ZHUA 1UXIA 3ZNNA 5KQMA 3L8GA 4TOIA 2Q49A 2CD9A 2JIZD 1N7JA 1PG2A 3MC1A 2GEFA 4NP6A 1V4NA 3LCJA 2YUKA 3RKUA 1X1AA 1H8EA 5C5CA 5C1DA 3C6QA 1D2AA 2YIJA 3K0CA 4AO6A 2PTGA 2PE5A 2VVTA 4HWOA 4KX5A 1LU9A 1Q16A 4QGGA 5F4ZA 3I64A 3M6VA 1GTRA 1AKQA 2J0UB 3HKEB 4MYCA 4W5RA 4EO9A 1UBMS 2Q0HA 3A26A 3LBYA 4ND1A 4NYJQ 1ZMXA 4EL5A 2XE8A 1CLUA 3I2YX 1YJ5A 2VJNA 2JW5A 2I1LA 3COPA 4F2WA 3HLKA 5CYFA 3CCFA 4FFPA 4LF5B 1QDUA 1BU8A 3QXJA 4INOA 2UZ0A 2XDQB 3KJXA 4N0EA 5K3AA 3SY8A 1C8VB 3T99A 2CNWA 2VK4A 1KIAA 3HUTA 4WASA 2P2CA 3FZNA 5A9RA 1WBJB 4JYCA 5DNCA 2AD1A 2ZE5A 4K5QA 4X97A 4YT2A 2RGWA 1KSJA 5IC6A 2XAAA 4RLHA 1SH7A 2RJ3A 1L8XA 1UKCA 4TLBA 1JFFB 5TGTA 2G67A 2PLWA 3DMNA 3ETEA 2P2LA 3OVMA 4AYTA 1UBFA 2QL5A 2V45A 4H3SA 3TX2A 3ZE6A 3D8TA 4NWIA 2EX1A 2GLTA 2GF9A 1I5OA 2ZYRA 1X7XB 1FBNA 1XELA 1J8FA 2GD1O 2O50A 2PVPA 2JFYA 1QGED 2Q5QA 4A36A 5AP9A 2AXQA 2PO7A 1N0IA 4Y2XA 1I14A 5MGNA 2G25A 2NV0A 2I03A 3ZI4A 3AINA 2VQ6A 1S3SA 5CVJA 3ZE1B 4ESEA 4TSRA 1GXSB 2PLAA 1WKVA 3DEFA 4OA5A 4FFSA 4YRPA 3ZQJA 2ZROA 1TGYA 3CF4G 3GJ6A 3O2SB 1MC4A 3S27A 3CLRC 4QDUA 3E3MA 5DT2A 1P3DA 1N0UA 2JFHA 2PT9A 5T4HA 4RIHA 1YQWA 3PT5A 1ID1A 2VT6A 3B6ZA 3CH6A 1EUDB 3EC2A 1PI3A 3NBKA 1B8OA 3RYIB 4Q7JB 3SFVA 4BO8A 1FYXA 2FMFA 1ZVVA 1U9ZA 4LXYA 4RK7A 2ZJ5A 1TMOA 1FX1A 1M83A 2QN1A 3AHGA 3X1XA 3DQPA 4MWEA 3UAVA 3BMOB 1V6SA 1WUJS 1O9BA 2WJJA 1GFIA 1SVIA 4JAVC 1ZJ4A 5GZ6A 3RQSA 3S29A 3T5DA 3URMA 4AO7A 3MT7A 3D6FA 4IKEA 4UHJA 1AN0A 5DBEX 5I7VA 1K2WA 1KOGA 3PQCA 2NYUA 5IC5A 3Q12A 5E3IA 4AMVA 4Q3CA 4JJAA 4URFA 3GWZA 3L7LA 1F3LA 3OC6A 3PGKA 2OO7A 3ZW8A 4YJ2A 4OJQA 1TLLA 3DZGA 1IHYA 4FLMA 4UFNA 1AGNA 2BBOA 2AG8A 1T1IA 3KFXA 3O8DA 4FQ8A 1J8DA 1J9GA 2ZSKA 2OBNA 2DF8A 2O3QA 2OV8A 2POQX 5DIFA 1G21E 3PFFA 3KXLA 4YQFA 1DXQA 4Q1VA 5EHQA 1CUEA 5DISB 2EQZA 4PN7A 1DCTA 2O6HA 1TADA 5DYGA 2ZYAA 2YJ6A 3H5RA 4G0VA 2RDMA 2DFKB 3IPRA 4ZALA 3ZJTA 3SJBA 2Q0XA 3Q5DA 5FA8A 2EQAA 1QM5A 2HRBA 1R0SA 1YQ9A 3B9QA 3JYPA 3K20A 1G7SA 3ZN2A 3D8RA 4TZ6A 2UZ3A 5H0IA 5F78A 5MGBA 2GJAA 1ULHA 3ONDA 3IAM6 2I6FA 3PYXA 2ZVDA 5D5HA 1KQNA 1GCAA 4AB1A 3I4FA 1RLIA 3DE7X 4KN6A 4NV0A 3W2EA 5I51A 1ENOA 1KETA 1MJFA 2FOIA 3I8SA 2ORVA 2W2VA 2C7BA 4FONA 4RXMA 3TQOA 3WQSB 4W1QA 2FPWA 3K9LA 3TM5A 3PQ8A 2WQ7A 2ECPA 5F64A 2C9ZA 3IIKA 2I99A 4FFBB 3CH4B 5B30A 1E7WA 3MS7A 2OFFA 3WMWA 3ORRA 4BCBA 3G8AA 4BDTA 5HWSA 1YRQA 1JGTA 2C83A 2CL6X 3MQFA 4OP2A 4JUDX 4OQXA 3U4CA 5L9AA 1JJAA 2V0GA 1QYVA 1UKYA 2Y71A 2FSIA 4RHCA 5AD1A 4UDXX 2VBGA 1JSCA 3NOVA 5FOXA 5DCUA 5IT9A 1Q44A 2XH8A 5KJEA 1IRXA 3DNMA 1GJRA 4UVIA 4XIYA 3T35A 2GCOA 2YV5A 3UWMA 5CIQA 4JBYA 4ETIA 3M6MD 1XD2B 5JBNA 4OD0A 2O7SA 3GRKA 2GCIA 3HUDA 2OM2A 4RY8A 1M0WA 3LS2A 3L7BA 4KXNA 3W2FA 1NV9A 4NBVA 7REQA 3Q3EA 4YWJA 1MOSA 3EC1A 3KG2A 4BNDB 2PUTA 2PUFA 5DNYB 1AUVA 6AT1A 2ID9A 1B42A 1J06A 3KZ1E 3LP6A 4NARA 5TDHA 4DUZB 3DOOA 1SKUA 4HWSA 1Q15A 2QR5A 3DXZA 2KMLA 3PDWA 2OL4A 2YC2C 4GVPA 3G0IA 4KLZA 4WECA 5I3CA 3CNNA 2EP8A 3R3JA 4KGDA 2QL6A 1RQLA 3RS9A 5LQJA 1USWA 3H2BA 3O8QB 1EWYA 1CQZA 4EI2A 1GCOA 1JSLA 1P9OA 2X2OA 1HH4A 2J32A 2RK3A 1ZM3A 4PC3A 1QE3A 3AM4A 2WHPB 1ECFA 1E7YA 3DEKA 2FW6A 3MGGA 3Q88A 4F4DA 1XTZA 2BGMA 1Y0BA 1A5TA 1HLDA 2VR1A 2YFKA 4G86A 3RJ5A 1J2TA 2CWWA 1MTZA 3H6KA 3O4FA 2CXHA 3C98A 1M75A 1J07A 2VDJA 3OOSA 3TVDA 1NA5A 2QBYB 1DIBA 3KKLA 4RZXA 4DLXA 1TQ8A 5HCUA 5A3SA 1Q1ZA 1OH8A 1BS2A 5BVHB 1ZYUA 1NLFA 4I5FA 4LJ9A 4BO2A 4LRSB 2X4IA 4JR2A 5JAOA 3O31A 4Q6BA 3LP8A 2IVZA 3PI7A 3SR4A 5JZ9A 3T3OA 4M98A 3TOZA 5KX5F 2CLOB 1LQTA 1AN9A 1YDMA 5HZGA 1IG0A 2DUNA 1OVGA 1O95D 2WNSA 3ND8A 3SSNA 4J4HA 2LP4Y 3AR6A 1CNFA 4OYLA 3AU8A 2QRJA 1SXJB 4B7UA 3DMDA 4P7KA 4TKVB 3RJMA 1WCIB 4CDNA 2O2GA 4R98A 4YMHA 4IKOA 4KVZA 4Q7KA 1IXZA 3QX7A 5I9TA 1IZ0A 2HMAA 4EHAA 4F2GA 1UZMA 3GFGA 2C31A 4MP3A 4WAUA 4P4SB 1VB5A 3K0SA 2X3YA 3DAHA 1Y89A 1YBHA 2V7QD 2BY4A 2OKGA 3DQZA 3MBKA 3EGWA 3NV9A 4TVBA 2VQSA 3V1YA 4YRKA 2J0SA 5FLXA 2WSLA 3O82A 1CY2A 4Z9XA 4OP1A 3JVDA 4ANFA 4DLWA 2LTAA 4LY6A 2I4RA 1JJBA 2XLCA 3LPCA 1M76A 4NENA 3V7YA 1T36B 1W36D 2WJIA 1WMAA 5AVWA 1WTCA 2R1UA 5B1EA 3PZBA 3QU2A 4HDCA 3VPHA 1T2VA 4MKXA 2C5GA 1GD1O 4LS3A 5JSKA 2XWPA 3OFND 5ICEA 2RG1A 4NZOA 4CMHA 1EXVA 2Z2JA 2I1WA 5JBIA 2Z3VA 4ZAWA 1KE2A 1DDOA 2CL5A 2KB0A 3IPXA 2XHZA 1OV4A 4XQEA 2YZKA 2IHTA 2EAUA 5KMGB 3FPFA 3FUVA 2EL7A 3BDIA 3HWSA 4A6PA 1E3JA 4YV7A 4B3MB 4OL9A 1OYWA 3NO4A 3QVXA 5K3FA 4C0QC 2PH7A 4Q66C 3WC4A 5FCDA 2DFLA 1K6EA 1XRNA 1BVRA 1DPFA 2JJ2A 3GA0A 3HM2A 1EK6A 2WSIA 3ZE2B 4KO2S 2B4AA 1I7PA 3RAFC 2B20A 1WEKA 1G3RA 4OO3A 4JXKA 3QY9A 1FUEA 5GIPE 1IDOA 4FTWA 4PEVA 2G7ZA 3G17A 3OZAA 4JASB 3ORYA 3I92A 1QV9A 4J76A 4C7XA 4R40A 2HH9A 1X8JA 3V7FA 4BVHA 3UA3A 4RKRA 4PG6A 3PX2A 2QL7A 4L74A 2WU0A 3VJKA 4U7HA 4E4RA 16PKA 1POXA 4FMBB 4BYMA 4TV9A 3HJAA 2R5FA 2XNDA 3FWKA 4DA0A 1E32A 5AK6A 1ACJA 1MA3A 3HPQA 3ANMA 1XCLA 2EFCB 4AQYB 2ZPUA 3O3CA 1U1FA 4MKGA 2VPPA 5U9CA 4Q1DA 5I9BA 5BYBA 3LZ6A 4DABA 2P2YA 1DOZA 1CLEA 4CFZA 1GGMA 4OK6A 3ZU2A 2OCKA 4O8ZA 1DC7A 2CCGA 1PVDA 4ND3A 3PNOA 3BDAA 4LYJA 1T8UA 2WA2A 3UMCA 4EX7A 4XWWA 2EJTA 2C42A 2OHIA 1WU8A 1XMVA 2BP7A 3DBRA 4PNZA 5EJFA 2OMKA 5DCWA 5IDXA 4L5JA 5LA6B 3RS3A 1SCNE 4PS1A 2CFRA 3DUWA 4IZHA 2EG9A 3HRIA 3FGPA 2VDLB 1MUUA 1R4MB 1RSZA 2C4UA 3M7IA 2H11A 2PUVA 3R41A 3ZGNA 4F45A 5IJWA 4O5AA 4XDHA 4CCAA 2P6RA 2TMGA 5TNXA 1GCUA 4TWZA 3OPYI 2Z5LA 3SF0A 1N5OX 4LG1A 4EF6A 3MBOA 3BIFA 4MKHA 1COZA 4FHFA 5LOVA 4EI9A 3AFIA 3TTUA 4KQ2A 2B9EA 3OM9A 5EP2A 2H1FA 4EKNB 2WAXA 1DX6A 1W87A 5K8CA 1E64A 4GQIA 4EG7A 2ZYDA 3AV0B 3KB1A 1I9CA 4D26A 1BOFA 1BC5A 2DBQA 4D9GA 1OGYA 5IMBA 3L07A 3IT2A 1FP6A 1GU7A 4NBLA 1L4MA 5ARBA 2CF6A 5EXXA 1AKUA 2NT3A 5E4JA 5H7XA 3FZEA 2WVHA 1NDHA 4YUYA 2H4FA 4PTLA 3G2JA 5GONF 4BMPB 3D5TA 4ZI5A 1LJ8A 4Y7CA 3U7RA 2VJOA 4BWGA 1OILA 2WJYA 4P36A 3AB8A 3OQBA 5BSUA 4QULA 4F97A 4OMUA 4OQMA 2R4UA 3JQ8A 1LV7A 2JIQA 2J5KA 1SB9A 1N32B 4JFRA 2G40A 2HREA 3NOXA 2XXJA 1LBHA 4ZVPA 4H7DA 4G89A 1HE8B 1RYHA 4JQSA 1GZ4A 2JI7A 3C45A 4I4NA 4MK4A 5CR9A 3UAOA 2CJPA 4YECA 3AL2A 3PPWA 2ZWMA 5CURA 4D4JA 2A0UA 3GVCA 3HO8A 3O2QB 4B33A 1RU3A 1PX2A 1U0JA 3ZZUA 2HDWA 2HRZA 1WZUA 2G0AA 2IP4A 5HQ3B 2XA9A 4LE1A 5AKEA 3AHEA 2QHXA 1G20E 3ISTA 5AIBA 1JS1X 5JDCC 1W5TA 2GZSA 5EJMA 2ZK7A 4CQMA 4Q5IA 3RFTA 2OBXA 1O77A 1T2CA 2IA5A 1EE2A 5C1PA 5FORA 1NIJA 1Y7IA 3FUXA 1BGVA 1R7RA 3VYSB 1N9KA 2J07A 4G4JA 2EF1A 3GN1A 1E0JA 3B52X 3GY0A 4QTYA 4JN6B 2FSSA 2HMSA 3RE1A 4BRUA 5H82A 5L6LB 2FQQA 3OPQA 5EA2A 1QIGA 4U7JA 3O3NB 3RTCA 3VO1A 4IIFA 5F5XA 3FHCB 4MKIA 1LLCA 2PS9A 2B82A 3GYBA 3ZOKA 5J2UA 1L5NA 3W6UA 3GH3A 4OLHA 4TRJA 3CSSA 1Q0RA 3ZE7A 4DTIA 1CRPA 2BJHA 2G80A 3IBSA 3IT3A 3RKSA 2A30A 5K3DA 1P0IA 3VDNB 3SS8A 1E61A 1RI2A 3RSFA 2PJDA 3ZKWB 1ZN9A 3CZ5A 4E5MA 1R4NB 1JLKA 1ZGAA 1K0UA 1LFAA 3EAFA 5CFMA 3QE9Y 4D79A 1IG3A 2OB2A 4E88A 1VE5A 2VPQA 2FJ0A 5FOTA 2FFAA 1C9DB 3RS4A 4GHWA 2ZIVB 2XUZA 3WZMA 3HKBB 2JBAB 3DB2A 3OIUA 3P0FA 2QMOA 3QI7A 3V4VB 4F8JA 1T0HB 5KHAA 2JLUA 4TTRA 2UYOA 2Y0DA 2B83A 1E3WB 2HN9A 3KELA 4H16A 1T0UA 1WO8A 1TU4A 2Q28A 2DWUA 4RTJA 2QRZA 1O6FA 3PFKA 3DDWA 3ZVKA 2FMHA 4EMBA 2EDCA 4HWTA 2ILVA 3EA5A 1MV5A 1RBZA 1XZNA 2O5RA 4W7HA 4JL6A 1RMYA 4OTZA 5FHRA 2DC1A 2DTEA 1ADCA 2DGDA 5TT0A 1L1FA 4REQA 5SV2A 5ICCA 1U90A 1PJLA 3U17A 3UO8B 1D7AA 2ONZA 3KOUA 3P9ZA 1LK0A 3BH6A 3PFNA 4YJ3F 3SN6A 1XRQA 2PKXA 3T9DA 3ZYZA 1XMOB 3OF2A 1CCWA 1ZH8A 3CCBA 3ZLTA 2W6ZA 4BX0A 1RRKA 4MUYA 4L8LA 2QD2A 1LKZA 4BBZA 1WPXA 4PXYA 4M3NA 4GW3A 1NMYA 1EYZA 5DN9A 3ITNA 1GTG1 5TXGA 3V1KA 4BFUA 4R7GA 5BMOA 3O8NA 5CDGA 3EXIA 1ODSA 4GMFA 3C8DA 1H05A 5HF8A 4C3OB 4CDMA 2XZPA 4PC1A 4ZI7F 1E1CA 1KORA 5LU8A 1DO8A 3DBVO 2UUCB 3ESBA 1PTJC 5ELXA 4UTXA 4DA9A 1FVHA 2QW8A 3ZTTA 1WSDA 4JQYA 4AVYA 2WD8A 1QCCA 5PNTA 3WMFA 4S12A 4ZGBA 4ENPA 1DO2A 4KH1A 1A9QA 1RZ3A 1BVHA 1JZSA 1YRHA 3WGKA 5I7HA 2IYZA 2WW8A 5J23A 3A27A 4FZVA 2IHUA 1HSOA 1TW2A 4ZXPA 1SCUB 3EBOA 5AIAA 1AO0A 1CUGA 2RGRA 5TS3A 2DQ4A 3C16C 3LF1A 4MUGA 2OGWA 3F49S 3H4IA 1FTSA 1P4GA 2XDYA 4TMXA 4BAUA 1XAJA 4Q6WA 5T64A 1C7EA 3MK31 3CX7A 1ZOSA 3N39C 3SHVA 3A11A 4R8VA 3RRMA 1ZSVA 1VL6A 3FYTA 4CG1A 4COKA 4HNVA 3PKZA 1J24A 4F9EA 5AHXA 1B0ZA 1TB4A 4AJPA 1U2GA 3DEJA 4JNKA 4R71A 3FF1A 1FTWA 4YPFA 1BX0A 1KZ1A 1N8KA 1EIWA 3U9TA 1MABA 3K8QA 3FD8A 4NOMA 3WAGA 4R16A 4U6QA 3UGTA 4N54A 2XB9A 2VH1A 4W8HA 3JD4A 2ZYIA 4U9IS 1AKNA 1X1CA 2WHYA 3HCBA 1HFJA 3SG0A 2ZR7A 3CGWA 2WINI 3EQ2A 4QPJC 2IL1A 3MLAA 4R1SA 5AXDA 3VHQA 1OBVA 4WCFA 2QT1A 3OMLA 3PXCX 3OLCX 2AZXA 3QU7A 1E96A 5MHTA 3SM9A 1ZIPA 3V46A 2NTVA 5A0VA 2QXTA 2PH5A 3RABA 1V1RA 1CBUA 2BFEA 1Q1NA 4CG2A 6CHYA 3IEMA 3AEUA 4KREA 2HGSA 4JBHA 1JEDA 1C9JA 2Q6LA 4TXHA 3ZV5A 4DQKA 4UPEA 4TTPA 1TA4A 4YP7A 2NSLA 3NWJA 4GD3Q 5JWHA 2YULA 2HADA 4UTNA 3NRCA 4ZVVA 3ZD6A 3AVTA 4LXXA 4IOMA 5ALIA 2J8ZA 5CDTA 2JIZA 1Q91A 4N7RA 1KJWA 3MPOA 3FOFC 1KTVA 2HPZA 5CT6A 2WKPA 1M54A 1SC4A 4MEJA 4QDTA 5KSYA 4YJ2F 4JXXA 5ALFA 5F35A 1JZQA 4F4FA 1QDLB 5H4HA 5EJ6A 3PDIB 4NI5A 2R85A 5C8YF 2IV2X 1JXAA 1M66A 2G04A 3HWWA 4Y98A 3GUYA 1LF0A 1JR3A 3UT5B 3FPHA 4AM8A 4EPXA 2JD2A 3K6SB 5DM0A 1HDYA 1R6VA 4BL5A 5A04A 4PCUA 4BRZA 1CUBA 1CF2O 3P19A 4OBXA 2NQ2C 2C2OA 4HYYA 4BC1A 1LLFA 3ZS8A 1TCBA 4B34A 1OQAA 4XI9A 2HCBA 1T4CB 1Y8AA 3P9IA 3EWSA 2GPBA 3MNFA 3TOCA 3P2EA 1D2HA 3TIFA 3OTOB 3EEBA 3KOMA 2AFHB 1BD4A 2WG1A 2GNPA 3LY8A 3ONFA 4C4OA 3C6MA 2C4KA 2LKCA 2ZJFA 4KR0A 3L0OA 3PNYA 4A03A 4DWVA 5C5IA 3MILA 4DKJA 1NKTA 1HWYA 1G3UA 1JHMA 4QYXA 5UKDA 1JPVA 3O74A 5DOVA 1SKMA 3IE2A 3UFBA 4I50F 1E2LA 2PPLA 1QKJA 1PJQA 1O6CA 3NAZA 3MJTA 4NV1A 1KFEB 2C1ZA 2EJBA 1N7HA 1Z16A 2ECFA 1QFSA 1WV1A 4OQLA 2VHJA 3CZCA 3GHHA 3TIGA 3TR0A 3V4ZA 3ZNQA 5I9NA 4X1IA 3AEKA 1H94A 4F4UA 4K40A 2I7CA 1HDZA 3CUYA 3KU4A 3SXPA 2WM3A 2BGGA 2SKDA 4CN9A 5I5GA 2OBMA 1HM5A 3PXDA 1WHSB 4WWHA 1T26A 3HB4X 5E1DA 3K92A 3QVGB 3OH8A 2IYYA 3KFVA 4BN4A 1VZ2A 1N1GA 2B8JA 3WLLA 2OA0A 2O2HA 3KV1A 4P80A 4HVAA 3GLIA 2ZUCA 2B1JA 1FSGA 3F27D 3OCJA 4J91A 4C20A 1FZTA 2ZJYA 3GQBA 3F1LA 1R6UA 2PFGA 4HGZA 1FDUA 3GGCA 5SY9A 4B71A 4L8YA 3SR0A 3PHIA 2D2IA 3DVLA 1F8UA 1PG0A 4KVFA 3P4UA 1JZTA 2NTYC 3SYMA 1H93A 4OX9Y 2C2HA 2G28A 1B23P 3VZBA 4IXWA 3EUFA 4DYHA 4LVCA 2E37A 3DBHB 1W4CA 2AC4A 3SOPA 3F74A 3VKVA 4E4TA 3MWGA 5BNZA 2XZLA 2XRFA 3W8RA 3SX0A 4ERXA 3GEEA 3DTYA 4YREA 1UZUA 2WVAA 3EFOB 4PHTA 4RFSA 4O3FA 1TMGE 1O97D 1CZLA 4MVCA 2G0TA 3Q6NA 4ESOA 2YNMD 4LWZA 1F9AA 3TGPA 1A4UA 1D04A 1X7ZA 4INPA 1UDAA 3BXPA 5HBGA 2ZETA 3GCWA 4GMXA 2B4TO 3ELBA 3H5AA 4PXSA 3L49A 1EFAA 1YFKA 4JA0A 1OAOA 1SA0B 3JWJA 3UWSA 3EUWA 2I4IA 4TQAA 4KFTA 2G5GX 5TJ9A 3ZQ4A 3UM9A 3H0CA 4YP0A 2PRJA 2WAYA 1EXDA 1UF9A 1XZMA 5I9MA 4YRNA 1ARZA 1XKLA 1ZONA 2XDWA 2B4YA 1YRAA 2PTHA 1PBTA 1RJDA 3B6JA 4MB6A 4W82A 5DBFA 4U8HA 3O03A 3S1AB 5KQRA 3QSYA 2GJ9A 1PFGA 2VTKA 2OZKA 1NR5A 2XDQA 3IQEA 2B1IA 1QYXA 1E9CA 1UK8A 2H0AA 2V7EA 4I99A 2F8MA 3EODA 2PXAA 3NUQA 3PQDA 1OF1A 4P32A 2AEEA 3A70A 4LC0A 3H5WA 1LLQA 4BIIA 1DEHA 3BSYA 1HC7A 3IKJA 4K9PA 2YJZA 3RFXA 3FDXA 4B17A 4ENVA 1KO4A 1S8FA 3BMNA 4Q34A 1PR4A 1SELA 2WVJA 4C6TA 2HBQA 4LRUA 1WP4A 1E79A 4MO2A 4OGKA 5AKKA 2V7UA 5FWXA 1Y3CE 1HSMA 1VJTA 2WF5A 1RCTE 4GGPA 4E2FA 2OWEA 2DQSA 4WCFC 4HAZA 4AZ3A 1ATIA 1CDEA 1ZW1A 1EFVB 1OX4A 3F5SA 1O5TA 3PRYA 4FYJA 4Q02A 2WWFA 3MJVA 3W1VA 4ZK6A 5IVPA 5JJLA 1XB2A 2ZB3A 3PL5A 3Q3IA 3O4JA 2IV3A 2XQVA 3Q98A 3A1WA 1VCMA 4G0PA 2X7XA 5AI9A 1NC1A 1RWWA 1SM4A 4D0LB 3KBBA 5BT8A 3HTXA 3G2LA 2X42A 2IH2A 1DIRA 2NUBA 1NJSA 1RT9A 2NXJA 4PC7A 1KEVA 2EZ4A 1QHSA 5I7OA 2GA9A 1PT7A 1IU9A 3ILYA 3RYIA 2PBZA 4G4IA 2FG5A 3EASA 1YZTA 4KV7A 3WTCA 5KJ1A 3EDYA 1XDSA 3K0AA 1XROA 5DNUA 1ODFA 1LSSA 2WHXA 5AM3A 1O87A 4GKBA 4H35A 4WZAB 2WIAA 1UBHS 1WVIA 2YWCA 1TUEA 3HGMA 1H66A 1V7QA 2C0PA 2C2BA 3AR2A 3PWTA 4LJ7A 2Z08A 2G1UA 2HY7A 3DLTA 3H2HA 3NTOA 4LUCA 3KSRA 1ZK4A 2QZZA 4GDMA 4M0DA 3TMAA 4XPIB 6GPBA 1HE2A 1NP6A 2AGVA 2K6GA 1IXYA 1GT0D 3STTA 2ICAA 1LXCA 2I5PO 4DMCA 1OZFA 4BRWA 1N33B 5A4JA 2OFXA 5ITSA 4YHHB 4HWPA 1E6LA 2PKYX 2EYQA 2PU5A 4UE2A 3TBHA 2O1XA 1AKMA 3T5TA 1PJ8A 2B6HA 3KD2A 4RNCA 4B8YA 2B61A 2UXBB 1VL1A 1XL0A 5ADUS 3TE6A 4A3SA 1JSZA 3KOYA 5BPHA 3BIOA 2W8BA 5FR2A 5HF6A 3ZGVA 1U9IC 2VK1A 3H87A 5BOSA 2FPOA 4E5DA 1QNFA 4ARVA 4LVUA 2GA8A 3CJQA 3MCZA 2BYTA 3PF8A 4TUYF 5IASA 4LWOA 3DTVA 4N5IX 3UKOA 5GZ3A 4CEIA 1OXUA 1K4YA 1IHUA 1KP3A 3FYHA 4YK7A 2G3YA 5LB2A 1MPTA 3GRUA 4CLOB 3ORQA 1JR6A 3H3XA 2QE7A 4PNHA 1OLUB 4ZCLA 5CIYA 4YJ3B 2ZSFA 3QIVA 1G66A 2WJ3A 2G5CA 2FSPA 3LQKA 1G1MA 1WEHA 4QA9A 5KAMA 2R9VA 1T8PA 2PZLA 4DDWA 5FWYB 5TIIA 4EG3A 2HA3A 1CZRA 1W52X 4PLVA 4R1QA 4CMEC 4FWIB 2NO4A 5DX0A 2JLCA 1NMSA 4K9MA 2ERXA 3D7RA 2NT4A 3OU2A 1T3SA 4DLAA 4PNPA 3R1IA 2OFWA 3AI3A 3D7MA 1MVOA 2O8DB 2WPNA 4I50A 5NULA 1UWLA 2NMVA 2X2FA 1KVUA 3JQAB 4HUQA 3QMVA 1EX1A 1G21A 2GCOB 4IL5A 2GBPA 4NJMB 1IUPA 4YGYA 2YWBA 2WP8J 1TYZA 2C9BA 1G5HA 3ZY6A 3IPCA 4G4SP 4HC4A 1E1QA 1MBZA 1TJYA 2A1TS 5BUQA 1X87A 1P7PA 1QKKA 1WXIA 2BM8A 2P9HA 4RIIA 3DL0A 3MJSA 2AR9A 1MC1A 1UBGA 2YNMA 3LWNA 4AMZA 5GMOA 2X0RA 1JHDA 3KAJA 4RTPA 3M49A 3DEHA 3VTAA 5ADHA 2J45A 3ZY4A 1W47A 3FMVA 3HVJA 1J1UA 1Y81A 2WU4A 4I8DA 4DXDA 5BN3A 2QWXA 1VIAA 4XPIA 3OE1A 1W88B 3UJNA 4FWTA 5COBA 1WE2A 2GF2A 3C6YA 3FOCA 1B93A 2KYRA 2XOEA 4D98A 2HJRA 2QUKA 4MW9A 2Y4OA 4RTQA 4CMJA 3EXG2 3WK4A 3L92A 1E2FA 4JUAA 3EGDA 3VHXB 3CZQA 5FX2A 1L5MA 2CVFA 2ODNA 2WKSA 1TTPB 3FVTA 1Z4NA 4EB6A 1P5HA 3W05A 1NE2A 3KU1A 4QJIA 3A04A 1HO3A 1JX6A 1L7XA 1JDSA 3H1PA 3D8UA 5LP6B 1K88A 1OHHD 2OBLA 2ZTMA 4ENUA 1A5BB 1YHNA 2NYVA 2PLNA 3IP1A 1QPZA 2VP9A 3QUQA 3PYLA 1M8PA 3WIUA 1AKVA 1TX4B 3UNXA 1MFPA 1Q6ZA 1QFZA 4FDMA 4XTRA 2XNKA 3WJ7A 5AOCA 1UBNA 2R8ZA 5TQ0B 4CEIB 1RXUA 4IIDA 5AVUA 3OTWA 1J4AA 2O0HA 1NSTA 4HQ0A 4NKRA 2DWQA 3NDJA 4O2RA 2R47A 4EEZA 3W4KA 2VEDA 2GAOA 3EC7A 5AW3A 5TB5A 8LDHA 4UQLA 3OLWA 4DT1B 4EJMA 1QGOA 3MWFA 3ZV7A 1PVVA 1KMNA 2MINB 3FCAA 4G97A 3P26A 1QO0A 4TT8A 3WS7A 3GN2A 4C4PA 1II8B 5I47A 1H2FA 1XZCA 3GX1A 4LRXA 2YTZA 5HK8A 2BTOA 4RKYA 1GADO 1O6GA 2LNDA 3ZBTA 5EFOA 1J8MF 1CD5A 2CXUA 2GWHA