3AP2A

Crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap,c4 peptide, and phosphate ion
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
303
structure length
300
Chain Sequence
ELVMVGVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-tyrosine sulfotransferase 2
publication title Crystal structure of human tyrosylprotein sulfotransferase-2: Insights into substrate-binding and catalysis of post-translational protein tyrosine sulfation
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 300
sequence length 303
chains with identical sequence B
ec nomenclature ec 2.8.2.20: Protein-tyrosine sulfotransferase.
pdb deposition date 2010-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ap2A01
2RHDA 5TB5A 5IT5A 1TQDA 4Q7MB 5FTMA 3SE0A 4RD0A 4MDEA 2IS4A 4Q21A 1KI6B 4DIDA 4NONA 1XU4A 3SDZA 5EP2A 4D26A 3AF0A 1AZSC 2AD1A 3BAFA 1Q3TA 4MYHA 3GFOA 1G8GA 2PLRA 4BFUA 5KTYA 1NVXQ 2VSXA 1XD2B 4Q4AB 4A1FA 5C2JB 4DLZA 4JYBA 4PHHA 1TL7C 1ONBA 3BD9A 4URXR 3EC1A 3RABA 4Q4LA 1IHUA 3U2QA 2NO7A 2JGNA 3CF6R 1F6BA 3FVQA 3LO5A 4US0R 3EPHA 2WAXA 2O52A 1VPLA 3EIEA 4TMVA 2F3TA 1X86B 1YZLA 2G3YA 4LX0A 3TVDA 3ZZ0A 2IBMA 4UQOA 3QE0A 2H92A 2WJHA 4O3MA 1F2UB 1P4SA 4NCNA 3CF0A 1XTIA 1Z22A 4IVPA 2O0KA 1ZJ6A 4ITRC 2PBRA 1XRJA 5B57C 2ZYUX 1NY5A 3D7MA 4Z1MD 2PX0A 3NC0C 1QG2A 2RAPA 4AG6A 3B78A 4OHYA 1R5NA 1TQ6A 3UG7A 4PPGA 4LOAA 3OESA 4ILEA 2VPPA 4B35A 2CNWD 4C2TA 3HR7A 4CEHB 2QAJA 4QBIA 1AS0A 2QORA 4EJSA 1XFAA 3DHWC 3NXSA 1EFCA 5EZ6B 1RJ9A 2F1HA 1Z0JA 4OBEA 2EQBA 4TLBA 1NIJA 4O0MA 3QXXA 4LV6A 3X2SA 1E9CA 1OF1A 4KBFA 3UXMA 4DC9A 2GVDC 3SQWA 3DZ8A 5KDLA 5JWHA 3BB4A 4HZUB 2ANBA 1E2LA 2XOKA 5K8UA 3TUZC 3S1AA 1JJVA 3H2YA 3KXKA 5EJEA 4RY2A 3U3JA 1OYYA 2QG6A 1JBKA 4OKSA 5CK5A 1EXMA 3AKCA 2CDNA 1W0KD 1YKSA 4E03A 2GAOA 4MYCA 1ZRHA 2HJGA 1KAGA 3TR5A 3NDBB 5J40A 1XNJA 5B2ZA 2A3RA 2J0QA 3R8CA 4HLUA 1TPZA 1ZM4A 2FSGA 1J2JA 3LBNA 4DUGA 2J9RA 3PENA 1KK2A 4X8OA 3LBHA 3SJCA 5JHGB 2ZJ8A 2ZETA 1Z6XA 2WWHA 1TAGA 4TYWA 1AQYA 1U90A 821PA 4PC7A 1BYIA 2QTVB 5FH9A 4V0NA 2A9KA 2HUPA 4KFTA 5SZIA 5HZKA 2XSZD 1LF5A 5H1YA 2VSOA 1YE8A 3RS4A 5EE1A 2ZU0C 1GRNA 1WE2A 1TTTA 1DPFA 5SZKB 3TRFA 4HYYA 1YR8A 2GHIA 1CU1A 1CLUA 1PUJA 2PZGA 2DY1A 4N3NA 2ZE5A 1QDEA 4G5SA 1YRAA 3LNCA 3DPUA 2HJVA 3LAWA 1W2GA 1BH2A 1F48A 4BLRA 3P27A 3PEUA 3DKVA 1EFTA 3CO5A 1U9IA 2WIBA 1I4LD 4O2RA 5CK4A 1DVRA 5JS7A 4MDFA 1G17A 1HEIA 2CJWA 2H17A 4BFVA 3I8SA 2F1IA 4W9MC 2CL6X 1S8FA 1FW6A 3ZQ6A 1CR2A 3DMDA 4TMXA 1NRJB 2Q9BA 3CKLA 5FI0B 4BWYA 2HT6A 1WB9A 5JS8A 4PQYA 1L4UA 2HV8A 3SU8A 1XZQA 2WKQA 5FUVA 5G3YA 1XTSA 1PUIA 1RRCA 1GL7A 2CHVA 4DCSA 4RD3A 3GLIE 1G8HA 5AUOB 4C0BA 1GFIA 2FMXA 5ELXA 1KI3A 3NH9A 1W0JA 1OJLA 2KBEA 2FGKA 4B3CA 4OQFA 3AQ4A 1W5SA 4URYR 4BLPA 1FMLA 2R6FA 4HUTA 4DLXA 3O8CA 4DLUA 3VX4A 1JQJC 2WWXA 3TSOA 1AGRA 2WMNB 1P9WA 1DAMA 1XJCA 2ASEA 3DOFA 1ESMA 2ZM5A 3PUWA 1SVMA 1NN0A 4Q4HA 3NC1C 1W4RA 4E22A 3AEZA 4XTCS 3K0SA 1OW3B 4M22A 3U3KA 1FUUA 2D06A 4URWR 1S1CA 2DBYA 3U7EB 4W5WA 1W36D 2AN9A 1RYHA 1VYVA 3GJ4A 3LY5A 1KYIA 3EA5A 4JL8A 2FDCA 3C15C 4CEHA 2VA8A 2RGXA 3CRRA 2G9NA 5TMPA 1YZTA 2PLFA 4A92A 3QY0A 2EU8A 5AJWA 1CEEA 3VR4A 4UNNA 4CEJB 3TH5A 4HB4A 4U00A 4XH9B 3W90A 1P2SA 1G6OA 1Z6YA 3UMFA 3GJ0A 3Q85A 1FNNA 1J70A 3BBPA 1D6JA 3TMKA 2C8VA 2CLCX 4QJ4A 2FOLA 2ZRKA 3PUZA 1DS6A 2OO7A 1E2JA 2IXFA 4MKFA 4Q4JA 1HQYE 5F9HA 2IYZA 3QOFA 4MH0R 5D3MA 4AYTA 1CJMA 1G5PA 3IKJA 3X1WA 4DB2A 5DYIA 2PJRA 4RD2A 4A0FA 3CNNA 4LHZA 2K5UA 1W5TA 3BRWD 3KJGA 3QXHA 2GJ9A 4NCIA 1UBGA 1ZVQA 1E2QA 1JB1A 2LKCA 4FCTA 4OI4A 4BLOA 2QY9A 2YWGA 3ZVRA 3GJ3A 2PCJA 3R9XA 4LBVA 1TX4B 3CR8A 1AQUA 4G5OA 4ESHA 1GKUB 3BH0A 2ZRIA 4Z54A 3GLFB 1PZNA 5TDHA 1LVGA 1TF7A 5CDFA 1JR3D 3KJEA 1ZD9A 4IJMA 4GOXA 5B58C 1W48A 1W4CA 1OFIA 1AS3A 4DCVA 1KNXA 1XCMA 2BKUA 3SNHA 1OXTA 4WW0A 4CT5A 1RRFA 3HU1A 2O8BA 3L0IB 3IGFA 4MGKR 2VHCA 2RGBA 1XMIA 3E5HA 3FMPB 3JZAA 4TQUS 3CPEA 4L15A 1O87A 3VX3A 1M2OB 1FP7A 2WJIA 4BRWA 3QEJA 1S3SA 2WPDD 4NP6A 2JLSA 2P5SA 3VR3A 1G9XA 4KYUA 4OJKA 5HCNA 3RYTC 1OFHA 1DAEA 3AUYA 3PUVA 4NYMR 3RWMB 3EZ6A 4OK3A 1IJFA 1E9EA 1P72A 3FB4A 3SC3A 4AC9A 3FE2A 4IFEA 2QGZA 2Q9AA 1MKYA 3MWYW 4L16A 4KSBA 3WXMA 4C3ZA 4Z51A 1E0AA 1ZC4A 1XEFA 2BCGY 2VRWA 4XWOA 3CH4B 4MRPA 4TTQA 1XTRA 4TYQA 2G0NA 4Q1DA 3GJ6A 1AN0A 2CLSA 4HB2A 3UWOA 2F9LA 2R62A 1EK0A 2ZSAA 2BKEA 3PV0A 5KPJA 2LWIA 3IHWA 1Z6AA 1F5NA 5CITA 1KK3A 1NMXA 2GA8A 4M1OA 5IDVA 2JEOA 2FSHA 2FPLA 2YWHA 4DLWA 3TNFA 4MRVA 1SKYB 2FG5A 4MKIA 4BFXA 3PG5A 4ZKEA 1G19A 1IN4A 1P9NA 4PC6A 1E94E 1EGAA 4RD4A 1CULC 3AVOA 3NEYA 1JQLB 3EPJA 1QHHB 3BORA 1VCNA 4M9XA 5FFMA 3RS3A 1KDTA 3AVQA 2QRNA 5JI3E 1RFLA 4OI1A 4PX9A 1X3SA 1QZXA 4KFUA 3KJIA 1CF4A 3JZMA 4PZZA 3C7KA 2QROA 4IEIA 1OIVA 3QF7A 1CJKC 2ZPTX 4JSYA 2QMEA 4LI0A 1GNQA 4DVGA 4WZAE 1JR6A 2JLQA 4TZ6A 3B7GA 3B1YA 4LBYA 2DYKA 4MITA 1G16A 1RYFA 1T4GA 4BFSA 4ZCMA 4UXJA 3Q9LA 1W0KA 2UZ3A 1RKBA 2YC4C 2IUUA 3MWKA 1S1MA 2G6BA 4WXPA 1G3QA 3KX2A 2O8CA 2IXGA 2ZS7A 4QL3A 1IJEA 4ARZB 3VMFA 3VFDA 4F4JA 5LDDC 1R8QA 1L7VC 4YMVA 1I4DD 4DXAA 2A5GA 2RB4A 3KKQA 4JLOA 1QHYA 4AYXA 5B64A 2OCPA 2BDTA 4KITB 5DI3B 1SULA 1LTQA 4JS0A 1KI1A 1JJ7A 1N6IA 4CEIB 1J99A 2QU8A 3RS2A 3B13B 5H70A 2NPFA 1VHLA 1UJ2A 1HV8A 1II9A 3AVUA 1D2MA 1AGPA 3CRW1 1BIFA 4FCWA 4AKGA 2FSFA 2HXYA 1JEDA 3K8YA 5CDFE 3Q3JB 1KY3A 4LJ4A 4TYPA 1N5LA 4A82A 1A1VA 1UAAA 1U98A 2RGNA 4B3FX 2IHBA 1E4YA 2YYZA 2VIIA 2VH5R 3GMTA 1Y3AA 1KMHB 2PX3A 3SYNA 1DG3A 4DUGD 1KI8A 2OCYC 3LLUA 1I2DA 2ORWA 1SZPA 5JZVA 1ZP6A 2B8TA 2H18A 4QKQA 2Z83A 3U7GA 4HAVA 3CBQA 2EVWX 3SYKA 5DHFA 3A1WA 4M8NE 1XTQA 4CT4B 4B2PA 1VG8A 2GF9A 1T3HA 2QTHA 4HDQB 4NTZA 3OIWA 5DHAA 4BZQA 1T5IA 5DSZA 2ZJBA 3ZVLA 1RJ9B 2YWFA 2ZRCA 4ON9A 4MUAA 2C04A 6Q21A 3RSOA 3RDPA 1NJGA 3TE6A 5FUYA 4E09A 4NPHA 4RD6A 3RS0A 3AF1A 1YRBA 2ERXA 4TLDA 1KO7A 3KQLA 1GZSA 2GK6A 3CWQA 4JVSB 3W3ZB 2XXAA 2QT1A 1B0UA 3G5UA 2ZRLA 721PA 1FQJA 2GZAA 3KXIA 4C0LA 5BN4A 3KDSE 1G41A 2E9SA 1S4QA 4NHOA 1VIAA 1UEJA 2I3BA 1SVOA 3B6EA 4P4SB 2I1QA 1DEKA 4RKFA 4A6PA 3GP8A 1SVWA 4LSGA 1MH1A 2WJGA 4WVFA 1ELOA 4R2HA 4DLYA 1ZIOA 3DVLA 5EP3A 1E2GA 1NN1A 2ZI5A 4PXAA 4CYMA 1NG9A 3TUJC 4Q1BA 5K8LA 4QNRA 4IDNA 4QGGA 3U60B 3B60A 3A1TA 3LDAA 2YVUA 2OAQ1 4Q9JA 3AVYA 1UKZA 2O8FB 1KDOA 5HZHA 3R8FA 1NF3A 1DAKA 1Z6TA 1VHTA 2O0HA 2BC9A 1WA5A 4C9BA 1N0WA 4MKGA 4FMCB 2V54A 4EQ6A 1FTSA 4JMPA 5EUQB 2OXRA 3U7FB 4JKYA 1QHHA 2ZRAA 2VHUA 4N0EA 2JIZA 5FBRB 1FP6A 1VTKA 2ZJZA 1G21E 4PPFA 4D4LA 3TJZA 3K70B 2BBOA 5AUPB 4ZDKA 3BFVA 2F7SA 3MLEA 4OK6A 2YKGA 2OAP1 4P4SA 3FTQA 3B1XA 3SHWA 1TADA 1YHNA 4TQAA 3CRVA 3K9HA 1Z08A 5DLQC 1ZNZA 2Q0HA 2RCNA 3ZZUA 2OEPA 2ECKA 3WMEA 2N46A 3QXSA 4US1R 1WBDA 3MCAA 2V1UA 1Q20A 1DAGA 3D6TB 4F7WA 4LBWA 4B3GA 3D31A 1SVIA 2QM7A 2ZANA 1E98A 4HLCA 1E2NA 1ZBDA 3UIEA 1DBSA 2RGAA 1TF2A 3VKWA 1I2MA 4ACAA 1XBTA 1X6VA 4IHQA 4A8JB 1E2HA 3CLVA 1WQ1R 1GWNA 2VEDA 3C41J 3MUFA 2GCOB 1NL3A 4HEJA 5AJZA 5IHPA 1AK2A 3L8YA 4JL5A 3TAUA 1G3IA 3ADCA 1GSIA 2ZUBA 1PVOA 3AB3A 4B3XA 3SQXA 4QGHA 5AUNB 2YJTD 2B92A 1FNMA 3SN6A 3ZJYA 3U3MA 2P3SA 4M1YA 2QQEA 3HWSA 4IDQA 4AWXA 2ZI3A 5JEDA 1GL6A 1P75A 1Q1QA 4XSGA 3QKSB 5DH9A 1NMYA 5DN6D 1IXSB 2QBYB 2R6DA 1ZUNB 1G4AE 2FFAA 3R9IA 1LB1B 3LLMA 2ZSFA 3A8TA 3QQ5A 4AKIA 2W6JA 1XMVA 1E9SA 2OV2A 3HPRA 4GI7A 4Q7LA 2IS2A 4IRUB 3VU9B 5BYKA 4XSHA 4MRRA 2IA5A 3BE4A 2DHRA 3BS4A 5G40A 3SS8A 1NLFA 2AWNA 1MO6A 2WTUA 4OQLA 3LBIA 2IEZA 3PUYA 4ZDJA 3WYAA 5KHOC 2GBLC 2C9OA 1T0HB 3U6BA 4LHYA 1XX6A 2JLZA 3THWB 4LCBA 4LJ6A 2WPDA 3MFYA 3OEHA 5DI9A 3TSWA 2E87A 3NG1A 5CB6A 2WMOB 2ONJA 3OIVA 2QAGB 4G5QA 2QMOA 3LV8A 4EQ6B 1G8FA 1S96A 2CEAA 3IILA 3T34A 1KO8A 2HT1A 4NYIQ 3KKPA 1VG1A 1G7CA 3ND8A 4X8LA 1W7AA 4DT1A 5FBWB 2GXSA 1DG1G 3WRYC 4QNMA 2CCGA 4NU0A 2A2ZA 4MA4A 1R8SA 3FWYA 5K8IA 3AKDA 4I99A 5IK2A 5L3SB 2WIAA 4HDCA 5EE3A 5JSZB 1G64A 3J81k 3DEFA 1JAHA 1YVDA 4D25A 4XVRA 4PHGA 4Z8YA 2WICA 3VHXA 1E2KA 2ONKA 1Q21A 4ABYA 2FH5B 2CK3D 5JEEA 2O8FA 2PZFA 4ZIRA 3PEVA 1OXSC 5A0FA 3W6OA 4RFSB 4DLVA 4F4IA 2X8AA 4BQSA 4GDFA 1YU9A 2PT7A 5CM9C 1W2HA 3GEHA 4ZPXA 2GKSA 4LHXA 3TKLA 4OYHA 1KIMA 1WCV1 2KI5A 2XSZA 4Q19A 3W8NA 4B34A 4IKEA 2QRZA 2WSSD 4EPTA 4Z1MA 2ZRDA 2MSDB 3ZLJA 1PLKA 4P32A 1E2FA 3H84A 4PHFA 4G0NA 4UNQA 3AVVA 3KB1A 1U81A 2ZI7A 3PIRA 2SHKA 3FDIA 3K0CA 4PSAA 2PH1A 3UMRA 4EKDA 4Q1EA 4DDTA 2V9PA 2W2XA 1OB5A 2P6UA 4TZ0A 2DWOA 3OIUA 4FMCF 3GLHA 1FX0B 2NIPA 2EFEB 2VP2A 4Q1CA 1SXJB 2C03A 3EG5A 4Q48A 4LRWA 1F2UA 4EFNA 2KSQA 2DWQA 4D0LB 2FNAA 3AVTA 3B1WA 1WF3A 1CJVC 3L0PA 2FEOA 2CXXA 4PQFA 4DSTA 2PMKA 3MWLA 1ZNWA 3K9GA 3NEJA 4QM6A 3UWKA 4LYFA 4AIIA 3GLIA 3SFVA 2P5TB 1P3JA 2DFKB 2DFNA 1OFTA 2PT5A 2ZVQX 3FGNA 4ERNA 3Q5EA 2PEZA 4RCZA 621PA 2AXPA 5E3HA 5KNDA 2NO9A 3UG6A 5L3QA 1GTVA 4XTRA 1F2TA 5AWFC 1OV4A 2ZS8A 1XEWY 3U44B 1EFRD 2J3EA 4F4CA 1OIXA 4LYHA 2IS1A 4C0KA 4Q66C 3RRZA 3ASYA 5E7MA 2JLWA 3FMIA 4Q4JB 2G1KA 4L5BA 1A5TA 1L8QA 1QRAA 4DLTA 2YOGA 4OHVA 3HDTA 5A4JA 3N70A 5FOUA 3MD0A 1OFUX 2JJ1A 3EXAA 8OHMA 2GCPA 3V00A 3VTKA 4M1KA 1MT0A 4FWIB 2AXNA 1SKYE 3GLHE 4AG5A 4DDWA 2H16A 1G8YA 3OIYA 2G0TA 3IQXA 5HKKD 5GJVC 5LD2C 1XD8A 5JCZA 4BASA 2QBYA 1J90A 4ZDIA 3GD7A 5KO2A 1T6NA 3QJYA 4QFMA 4TT3D 5H68A 2QZ4A 1E1RD 2CE7A 3LVRE 1XF9A 4M53A 4TMWA 1CBUA 4H1UA 3OEED 2JLVA 2GZDA 1P5ZB 3B2EA 2GJAA 1EESA 5DI3A 4DT1B 3NKVA 2ZSDA 2GETA 1Z0KA 4QHYA 3EX7C 3QBTA 1G291 1UKVY 2V4ZA 2YINC 1A2BA 4LHVA 3M1IA 3MGCA 1ZM9A 3C5CA 3KTAA 5FR1A 4YMUA 3SYLA 1XEXB 2QAGC 4KXFB 4P4UA 2QPOA 2EFCB 4QBGB 2ODWA 3WNCA 3HP1A 4V02A 1D2EA 4GSYA 3ICQB 4A6XA 4G1UC 3H0KA 4CRWB 1KAOA 1UM8A 1FPMA 3IPXA 4CIDA 3EPLA 4URUR 1GRRA 3OAAA 1JPNA 3UK6A 2GJ8A 3BERA 1QVRA 2XITA 1X1SA 3EW9A 1GITA 5FOTA 4B33A 4GT1A 4XWKA 2B21A 2BMFA 2A5FA 1YZUA 4BGDA 2ZR7A 4KJZA 1AZTA 4A8JC 2P2LA 4BLTA 2W0SA 1M7BA 2DWPA 4PZLA 4PAOA 5HPYB 2OHFA 4POAA 1XMJA 3FPAA 3TIFA 1P62B 2YOFA 2EWVA 1EWRA 3FMOB 3QXCA 3ZDQA 1XZPA 2IYLD 2V7QA 2VLIA 2J59A 4M1TA 1PJRA 3U4QB 1VMAA 3V9PA 4I4LA 5UKDA 4M9ZA 3T15A 3GFTA 1XJQA 4JBYA 1OSNA 3UMSA 2QSYA 2ODEA 2OSBA 3OE7D 3SBDA 2GILA 4MRNA 3LW7A 3QPUA 2BM1A 5LD2B 1CKEA 2AKYA 2XNDD 4G5GA 4FI3C 3EIQA 2ZXUA 4G5RA 3B85A 1NVWQ 4BPBA 4Q9KA 2FU5C 1G20E 4NH0A 5FTKA 5EXTA 2VHQA 3OFNA 2QNRA 5FPTA 2OBLA 2BBSA 1OH6A 4RJLA 3LX5A 4JL6A 2V1XA 2CBZA 4KV9A 1FL9A 1G3MA 3BH7A 2HXSA 2BBWA 4W7SA 3T1TA 3V4FA 1ZYUA 3BJIC 5CJ2A 4E07A 2ZEJA 2AL7A 4PSVA 1JEEA 1WXQA 4EFLA 2GCOA 4HATA 2OXCA 5FOXA 2UKDA 3EZ2A 5KYKA 5FUXA 5GVRA 4B76A 3CONA 1T9HA 1VECA 4I1OA 1G3UA 3GLGB 4KLNA 2P0EA 2ZRPA 1FFHA 4ZDWA 4FMDF 1KI2A 1OLOA 2WWFA 3PCRB 3SBEA 5JBQA 1RW4A 2HDNB 1D2NA 3AKYA 4PANA 2WJYA 2FA9A 1UEIA 4MRSA 4FMBB 4DRZA 2FFBA 2NMVA 2QE7A 2CCKA 1J8MF 2HLDD 4J0QA 1KKLA 1N6OA 1UPTA 2FJUA 2PJZA 2NPIA 2QL6A 3SHFA 1Z0AA 3L82B 2YC2C 221PA 2XJ9A 1DE0A 5G53C 5KSPA 121PA 1L4YA 2BBTA 4URZR 3ZIAD 4B71A 1N6PA 2V6IA 1IAQA 1W4AA 2GDJA 4C0SA 2ZSBA 5D3MB 1R6BX 3DO6A 1X1RA 2UZIR 4PAMA 2CVFA 2JDIA 4QC2A 3NHBA 3KTAB 2YV5A 2G1JA 4DSOA 2ZE7A 5HE8A 4A2PA 4XD7D 3PEYA 1CTQA 2IYVA 1XD9A 4S2EA 2MSCB 4Q01A 3A58B 1P2TA 3FMFA 1Z6GA 1UKYA 1W36C 2RGEA 2WSMA 1QVAA 4A36A 3U7HB 2VF8A 5AJVB 2ODBA 2VP4A 2W0MA 4OHZA 3ZS8A 1GIAA 3IHLA 1YJ5A 2QPAA 4Q03A 1Z83A 1DAHA 1QHSA 1SXJE 2IYSA 4LHWA 3IPYA 5LB2A 1MABA 2I1VB 3LQQA 4LJ7A 1HT1E 4HZIA 4JLJA 3RSLA 2X1VA 5BXQC 4IDHA 4TL7A 4JLVA 1WMSA 1JPJA 3T35A 3U4QA 4W5JA 2GXUA 1TQ4A 4PAQA 5F3WB 1COWD 5DE3A 3PJRA 1LFDB 4V0MA 2UVQA 3QI2A 2GJSA 2IYWA 4IVRA 2REBA 1R10A 2BV3A 1KMQA 2REOA 1E1QA 4R2IA 2IHYA 4C0JA 4LYAA 1H8HA 3EPKA 1QG4A 4FIDA 1KOFA 5FTNA 4AD8A 2CK3A 5C1BA 5FL7D 2QMHA 1R5BA 4K81B 1ZIPA 2W2VA 4TTRA 3MJRA 2D2EA 3VHLB 2FPMA 1VKJA 1NLYA 2A5JA 1KMHA 5BN5A 4B32A 1A2KC 3GEEA 5LB4A 3A37A 3RWOA 2ZRHA 1IBRA 1RVDA 3BFKA 4Q02A 2RH5A 2CHQA 2QPTA 2C9CA 1HTWA 4D4KA 2FGJA 1TMKA 2QN6A 4US2R 1LF0A 1SXJA 4O25A 4PC2A 4D6PA 2H7VA 4RFVA 5EP4A 3PITA 4DCNA 1XD2A 4Q4AA 3ICEA 2VBCA 2W6ID 4TN1A 1ZU4A 4KFSA 4JVNA 4DCUA 4BEBA 3KQUA 1CJUC 4DWJA 5KNBA 2D74A 2JDID 3M0EA 4KU4A 4PZYA 1QBKC 1N0VC 1HY3A 2ZTSA 4UXIA 1XTJA 5FPYA 1GNRA 2WKRA 2RMKA 4JT2A 4D0NA 4TMKA 2F3RA 2D7DA 5JWOA 4IDPA 1XEXA 1VG0B 2CNWA 1I4TD 1E2EA 2A30A 3NBXX 4ZCLA 4PR0A 5DISB 4UNSA 2Z4RA 3L0SA 4JBXA 3I61A 3CH5A 3GCGA 1Z29A 2BEKA 4A9AA 2D7CA 1D9XA 3C14C 3RAPR 2OLJA 3B82A 2IUSA 4IXNA 4JLNA 3WP0A 4JLDA 2IUTA 1S9DA 5SZJA 4BECA 3IBYA 1V5WA 1Z07A 2V6JA 4KI0A 4EPYA 4JBWA 4GNKA 4GZMA 2Q3FA 2ZQ5A 4RZ3A 1XPRA 2XB4A 2D3WA 3EZFA 1S3GA 3K09C 5TY0A 2F55A 3M6AA 3ETLA 4NL4H 2KJQA 1OT3A 2BM0A 2GCNA 2XZOA 1E9AA 3LW8A 3KKOA 5E7IA 3S1AB 2XGJA 4FD2A 1ZM3A 3AUXA 1X8LA 3CRQA 1AJEA 4IOJA 1NN5A 3PVSA 1YZGA 5CM8B 5DIFA 4M1SA 2VP9A 2W00A 1II8B 4LV5B 1Q3HA 4IVQA 4U02A 1NBMA 1YZNA 2QA5A 4PC3A 4B48A 4DEXA 3E2IA 2BCJQ 4MQBA 4B43A 2NG1A 3W3AA 4RKEA 3QNUA 2WHXA 3X1XA 1C4OA 1R7RA 4XIGS 3HJNA 3I5XA 1XB2A 4E5UA 1OB2A 3RRMA 5J47A 2FZLA 2Z4SA 5JLJA 3LX8A 1FX0A 1ZD8A 3F5FA 2J0VA 4P0TA 3QUSA 2ANCA 5AK0A 1MABB 1OXUA 3LWNA 5JJLA 1NBMD 3O8BA 3QIAA 4B2LA 1NVUQ 3U3RA 3KXLA 1SVLA 4A0GA 4DZZA 2O5VA 4JLBA 2FFQA 3I1FA 3OE7A 2QP4A 4BE7B 1ZNYA 4YXWD 1NSFA 2WWIA 5DNYB 3Q5DA 2O0JA 4MGIR 3AVWA 1KJWA 1KK0A 3KQKA 2W58A 1JXMA 3BK7A 3DM9B 2ZU6A 1Y63A 2WVJA 4CEIA 1JR3E 4N0DA 4OHWA 3EAQA 3TLXA 2JJ8A 2DFLA 4WA7A 3QG1A 4BRUA 1P2UA 2P67A 3ONWA 4OI2A 2BWJA 2DB3A 1RRGA 3E70C 2DFTA 3G0HA 2YWEA 1UF9A 2VF7A 3TSZA 4QJ3A 3W5IA 1H8EA 4HB0A 4LPKA 1RC8A 2CLDX 421PA 1F2TB 4BFTA 1TEVA 2JJ2A 3LA6A 1ODFA 1N6LA 1SHZA 1NLZA 2H1LA 4FN5A 4Q7KA 4B75A 2X77A 3EASA 2V3CC 3AVXA 2WKPA 4EJSB 4DHEA 4ZI3A 2C96A 2OBNA 4I1SA 4B44A 4LJ9A 3DL0A 3VU9A 3C8UA 5C46F 1NJFA 2J7KA 1PLJA 3GPLA 1KSGA 1GAJA 3KUDA 4WBSA 1KJYA 3I4LA 2KBFA 1H8ED 4B3BA 1OH7A 2NGRA 2P6RA 2IF0A 1Q1EA 2OESA 3PEWA 2ZROA 5E4FA 1E2DA 4BEJA 2PZEA 4HLQB 3TK1A 2LCFA 4Q4HB 1M6NA 4O2LA 3AM1A 2F1JA 2PL3A 4ZKDA 2Q9CA 4KO8A 2ZUDA 3LQRA 1G4UR 2EYUA 2FPKA 4L8GA 3OHMA 4TL8A 2R9VA 5BW8A 5LPNA 2FEMA 4C2UA 1ZM2A 2C5LA 4C4PA 5JECA 2FSIA 3EIHA 1OH8A 1E3MA 1LNZA 1W47A 3CF2A 5ANRB 4LJ5A 1N6NA 1XCGB 4P4TA 1XCPA 5E95A 3I32A 3GQBA 4IDOA 1EX7A 2IL1A 2DCUA 3KB2A 1TNDA 1ETUA 3QVVA 4F38A 1P60A 4XOIA 4JJZA 4XD7A 2FWRA 4II7A 3F3YA 2QI9C 3A1VA 2JLXA 1HA3A 1LW7A 2HCJB 5J4HA 3A1UA 3WBKA 4RZ2A 2OCAA 3NTUA 4JLAA 4KLZA 3FKSA 4NYJR 4UKDA 1NVVQ 2YOHA 4UNPA 4WXRA 4BZPA 4M21A 4PO1A 4DDUA 1S9HA 4DSNA 1G5TA 2IXEA 4RD1A 2FX3A 5AJXA 2CMKA 3AF4A 3JVUA 5FBLB 3ECCA 1H8HD 1QHNA 4A0RA 5KSYA 2BEJA 1W46A 3D8BA 4WZBE 4DKXA 4EPWA 3G82C 4PQRA 3FKQA 1M1YE 5J4LA 1US8A 2EFHB 2AK3A 1OHHA 4KFRA 4Z8XA 5JFGA 1AM4D 2R6AA 4GBMA 4A2WA 1A4RA 4TSFD 1COWA 4LJYA 2C78A 4BFZA 1XXHB 3NVAA 2GZHA 2P6NA 3CB4A 2IT1A 1W36B 5CB8A 1II0A 3NDPA 4HUQB 3WYGA 1C1YA 2J5XA 3SEAA 4OL0A 5FI1B 4R98A 2RKOA 3X1YA 4CDGA 4TLEA 5FBQB 1E79A 5FR2A 4HLDA 1CR4A 3C4JA 4FXPA 4W5HA 3GLFA 2KB0A 1IN8A 2MMGA 3MSXA 3QKTA 5CLQA 2VHJA 4JSTA 4TLAA 5P21A 3VR6A 2WWGA 4WIAA 3KKNA 3TW4A 1II8A 1MOZA 1FOEB 2ODNA 1BO6A 3IBGA 2BVNA 4L9WA 1G7SA 1R5OA 2GEVA 3O8RA 4PPQA 2HF8A 2NZJA 4QOSA 2YHSA 2XX3A 4CGZA 1GG2A 2RHMA 1TUEA 3OFND 4OK5A 4LZZA 1VDZA 1WRBA 2AFIE 2JLYA 3AP2A 3N2EA 1KGDA 4RFSA 3BIFA 3ZIAA 5TARA 2ORVA 1K5GA 2GEUA 4PSKA 3RHFA 3VR1A 1HYQA 3VKHA 3RC8A 1UFQA 1E9BA 4PHTA 2NO0A 1JECA 3IEUA 4GPTA 2XNSA 4PC1A 2F43B 5JWRA 4M4SA 4A4DA 4LUCA 3A6PC 2JLRA 1E79D 4D2IA 2OILA 2XTMA 4D4JA 2GBLA 4ZIRB 1H65A 2IYRA 3NBFA 2GXQA 1XXHE 4B6FA 2BMDA 4D80A 1HE8B 1BMFD 2ZRNA 1U94A 3DMNA 1UKEA 4FW9A 3WNDA 4C7OB 1SXJD 2GEDA 4XVQA 2LKDA 2JIZD 3W34A 1Z0IA 2N42A 2XAUA 3K9NA 4A15A 2V8OA 4YXWA 2F6RA 3H86A 5H8WA 4UNRA 1DAIA 1MR3F 3T5DA 5D3QA 3CIOA 2Z0MA 1DAFA 1RRPA 3C5HA 3KJHA 1SVKA 3M4YA 4DEYA 3REFA 1IY2A 3IDQA 1DADA 1MO5A 1U8ZA 1LS6A 2C77A 1HH4A 4F91B 1IM2A 4ARZA 5JRJA 3ADDA 1JALA 2IK8A 1T91A 2B8WA 2C9YA 3CX6A 1Z63A 4YMSA 2VHTA 3K1JA 2WSSA 3EZ7A 2IW3A 1KI9A 5L3QB 1UADA 1NKSA 2J41A 4V03A 1JR3A 3TGPA 1E1QD 2KE5A 4OJQA 1V43A 3GJ8A 3GLIB 2I4IA 3A4LA 1LS1A 1IOZA 1Z28A 1ZM7A 2AK2A 1IONA 2H57A 4Y0AA 2ZJYA 3GEIA 4Q5IA 1N6RA 1T0JB 1E6CA 1T3LA 1GKYA 1XXHA 2AD5A 2XEXA 3IIMA 4UXHA 1E2MA 3TR0A 5BYJA 5HR5A 1KO5A 1E0KA 3ZYCA 5KOYA 2WZQA 1BYUA 3K0CC 1XJ0A 5HTKA 2QMUA 1M8PA 1US8B 4HAUA 3QEOA 5JI2E 3MJHA 3UANA 1GILA 4BFWA 1XPUA 1E1RA 4DLRA 3E1SA 1WDTA 2WOJA 3QVUA 4QBFA 2FE4A 2NOAA 4HLUC 3TUIC 5KU1A 3CWZA 2A7QA 2Z5FA 5DYGA 1CXZA 1N6HA 1BKDR 4YLGA 2QP9X 4GZLA 3K0EA 1KO4A 1G5RA 4BFYA 4QRHA 3LFUA 4A2QA 2NO6A 2TMKA 4GL2A 4B47A 2GESA 4D0GA 2NQ2C 3AH8A 4NCKA 4EPXA 2ZITA 2VQSA 2J0UB 3AV0B 3P4YA 2F9MA 2R44A 5A5GA 3AP3A 1NI3A 3FFAA 1KSJA 4LGMA 1GOTA 4QXAA 2ZYTX 3MRSA 2YZ2A 5EXXA 3LH5A 1IY1A 4LY6A 1NIPA 2W6JD 3CX8A 3ZS9A 4GMDA 1AA9A 1ZUIA 2ZS9A 3DZDA 2ATXA 3L0OA 1IXZA 1NMZA 3T12A 1HE1C 1D5CA 2AR7A 3K53A 4HAZA 1KSHA 4B74A 1KI4A 1T5LA 5GJWC 3TVTA 3A36A 2D4HA 4Q9IA 4DJTA 3BH6A 2C99A 3EA0A 3I8XA 1KSFX 3WHLA 2V7QD 4KHZA 2GTPA 5M04A 1P9RA 2JASA 2R8RA 2CCJA 1GRQA 2ZE6A 5B30A 4KYIB 1AIPA 2RGDA 4EUNA 2CVHA 2GRJA 2J7PD 3GLHB 4TT3A 1IXRC 2ZJOA 2WJJA 3K0AA 4OQXA 2VL7A 4JLPA 2ZSEA 1P61B 3KFXA 5KDOA 1ZCAA 1OXVA 3NIBA 1XDBA 4QGAA 1EG7A 2JJ1D 3Q8XB 3OAAD 5SZHB 5GJBA 2HYDA 5EE0A 3TAHA 1XP8A 1OH5A 4H9GA 4C7OA 3HU3A 1EWQA 3LXXA 1CR1A 1N0UA 1OYWA 1NVVR 4HI0E 2J1LA 3ND9A 3BGWA 2IC5A 3K0FA 3AVPA 1EFRA 3T1OA 4B6EA 1ZU5A 4QBHA 1NNEA 4JZKA 1UBCA 4JJKA 1XMSA 3QENA 2IWRA 3ZVMA 1R0XA 1NSTA 1Q22A 2RGGA 3R20A 2XJ4A 3T61A 4M9QA 2IYXA 1R0ZA 3DOEA 4TMZA 1Q0UA 5BN3A 1IN6A 2QM8A 2Y8EA 1RZ3A 5EE9A 2JCSA 3MG9A 5CYOA 5AUQA 4GFDA 1VYTA 1JAIA 2OLKA 3QKRA 3IIKA 1P6XA 2GXAA 2OT3B 5LBIA 4AKHA 3H1TA 4XWAA 2VP0A 1QHIA 1KJZA 3DM5A 5KUTA 2Q3HA 1ESNA 1T3SA 5F98A 4QGFA 1ZCBA 2WOOA 3I5YA 2Z43A 3L2OB 1J8YF 5EZ5A 3WBJA 3HU2A 4CEJA 1Q1BA 2ZVPX 3QPWA 4DBLC 3HYTA 1FZQA 2Q21A 4PPNA 1Z5ZA 2BMEA 4LDJA 1WBBA 3I73A 1GUAA 3PUXA 2FFHA 4BUJA 2GNOA 1S2MA 4DB4A 3CNLA 2ZUCA 5CJPA 3FHCB 4HAWA 2FN4A 1GL9B 1R4AA 3C16C 2XZPA 3V4RA 1A82A 2ZI4A 3B5JA 3B1VA 3N5CA 4GP7A 3B9PA 1U0LA 1Z3IX 1TF5A 1IY0A 4L9SA 3NH6A 3WP1B 2ZE8A 5L8VA 1QHXA 1P73A 4LJAA 5G3ZA 1KZGB 1Z8FA 4D82A 2W6IA 4ESVA 5HCIA 4G01B 1R0WA 1ZUHA 4JKIA 5HE9A 2A78A 2CE2X 2W83A 3A1SA 4KCGA 1IQPA 2QSZA 5FTJA 3GLGA 1K5DA 1OKKA 1R0YA 2NZ8A 3K9LA 4TYNA 3THWA 2IYYA 5K8TA 3HYRA 1PV4A 4KVAA 2WBLC 2A5DA 2VSFA 4P33A 1CRPA 1E69A 2O8EA 3B8HA 5JMTA 2PEYA 3CZQA 2OFXA 1JI0A 3LVQE 5EXSA 4NMMA 3TQFA 3RS7A 1KO1A 4BLQA 4NYIR 2X2EA 3A4MA 2QUZA 1W49A 4JVLA 5J4KA 2QT0A 5GADl 2BOVA 1WP9A 2FV8A 4JIMA 5FUWA 1U0HC 1XWIA 1OKKD 1DOAA 2ZJ5A 4NCHA 4RZUA 1XTKA 2GJKA 1UBFA 3VQTA 1U8YA 3ZD7A 3CPJB 3IO3A 4XVUA 3CZPA 4ZI2A 1L2TA 1Q57A 1E2IA 4WAUA 2JAQA 3I62A 1QF9A 1JXOA 4R9UC 1O3YA 3KFVA 1W4BA 2ERYA 2QAGA 4Q00A 4AYWA 5IF9A 5FPKA 2OG2A 4Q9LA 4X8MA 3CPHA 3NBYC 4LK2A 1TUIA 1DO0A 2ZR0A 3OZXA 3UKDA 3CUEF 3ZGXA 2C2HA 3IQWA 4QM7A 4NKRA 4I1UA 5E7JA 3VNUA 3TBKA 2GWHA 3QBVA 2J46A 4L4UA 2WWYA 1CP2A 4OI0A 4K8OA 2GK7A 1FMJA 5EXPA 4MUBA 5J5CA 2WWWA 2ZR9A 2J0SA 4QJ5A 4TTPA 1Z47A 2KWIA 5TXGA 5GJCA 3W9YA 4YDHB 1UDXA 4A8JA 1U0JA 2G83A 3CX7A 1QHGA 1Z2CA 1DELA 1P7CA 2HEIA 3L43A 4LC1A 5G41A 3AGQA 4NBSA 4UJ5A 3T1VA 1M34E 3RLFA 3P20A 1HQCA 2XZLA 2MMCA 1SQ5A 4KAXA 4S35A 2HYIC 1FQKA 4OHXA 5AJYA 4LC0A 5CLLA 5EQTA 5TV2A 3SOPA 3GJ5A 2BJWA 2AKAB 2CHGA 4LV8B 3X1ZA 3FOZA 1YZQA 2OM2A 4I81A 3K70C 1B23P 2R2AA 2W2TA 3ZVNA 4CW7A 1CR0A 4GOJA 3W6PA 3F0TA 1CRQA 1E0SA 2ATVA 4HSEA 2EWWA 2OBMA 3P4XA 1U99A 2OFOA 1N3BA 4LYJA 4KSCA 2QTFA 3VR5A 1N2CE 4EPRA 3GJXC 4C0QC 1VCOA 3PXGA 3QKRB 1GKIA 2V55B 4IFBA 1IN5A 1N5KA 4CZ2A 1LY1A 4HDOB 1K6MA 3I3SR 4JYCA 2IYQA 2FZ4A 1NY6A 1DTSA 1OXXK 2ZI9A 4N1AA 4FCVA 1TEXA 2ZJAA 1UDWA 4IOLA 3W8RA 2QQ0A 2YNMA 4EJSC 1ZNXA 2J7PA 4IOMA 4NZYA 3L8ZA 1YR7A 1YQTA 1TQ2A 2R65A 4H1VA 4GRAA 4R7ZA 5EP1A 3K09A 4IOKA 4MYTA 1GVNB 1G8PA 3OEEA 4C0HA 1U8AA 3NHAA 1HT2E 1AS2A 4A0HA 3QKUA 4IW3B 4AI6A 3K70D 4YMWA 4RVCA 3KZ1E 4HZUA 3T1QA 3BC1A 5JSZA 3PFIA 5HKKA 4GP6A 1GM5A 4TSFA 2NTYC 3ASZA 3QSYA 3SJBA 1TU4A 4HUQA 1OHHD 1S0UA 2GVZC 3Q7PA 3ZZTA 1IN7A 3KQHA 1PLLA 2XXAB 4NYJQ 1M74A 3QF4B 4V0ME 5C4GB 3SFZA 1JNYA 1U2RA 4EFMA 2X2FA 5L3SA 3P1JA 5EE5B 3I92A 4Y0VA 4AY2A 3OF5A 1SHKA 1VG9B 1YZKA 3DDCA 4V0LA 2DR3A 1ANKA 5JHHB 4DCTA 2EW1A 1G6HA 3LRPA 5JJIA 4M1WA 2HLDA 3GLGE 1EFHA 1MV5A 4KBGA 2QE7D 3IUYA 4V0OA 4MKHA 1DO2A 1ZC3A 2AFHE 4F93B 4G3XA 3GFPA 1MRNA 2AWOA 3NWJA 4TMTA 4GOKA 4Q9HA 1G7RA 1UBEA 4P3YA 3P26A 2PCLA 3SI7A 2A5YB 2R6CA 3MMPA 3R9WA 2EYQA 1E2PA 3U5ZB 4P31A 1N5IA 2MSEB 3EWSA 2QGNA 2ZYWX 1E99A 3CNOA 3FHOA 2JA1A 2E1RA 2ZIAA 5J4YA 2JLUA 3THXB 2VP6A 3D3QA 1CS4C 4HAYA 3W5JA 4YONB 4EIWA 4CF7A 4ZV4A 2IX3A 5FTLA 2ZRFA 1R2QA 5J4VA 1VCIA 2J0UA 1KZ7B 2NO1A 2F43A 2OUKA 2VO1A 2CL0X 3HPQA 4OQNA 1NBME 4Q47A 3GLFE 2IS6A 3WMFA 3KUCA 2D62A 3BFXA 4FWTA 2PMDA 1FTNA 1FUKA 1A7JA 3B9QA 1KI6A 4MGYR 3GJ7A 5FPSA 2FF7A 3W6NA 5CIWA 1VIYA 2JJ2D 2WV9A 1Z0FA 1GP2A 1BOFA 3KL4A 4TLCA 3WY9A 1BS1A 4FINA 1E32A 3VR2A 1RIFA 2XNDA 3U61B 1G18A 3U44A 1ZD1A 2HF9A 1KHTA 4QG7A 3KKMA 2OFWA 4JT4A 5FOSA 4CVNA 5IK2D 1VCMA 1W44A 2JATA 3TQCA 4K46A 1SGWA 2ZAMA 3VAAA 1KTVA 2BIFA 4U5XA 2XB2A 1CJTC 3Q72A 4C30A 2DPXA 3CW2A 4MYUA 3SR0A 3I72A 3U6KA 3SZRA 2X19A 2L0XA 2J45A 5KSZA 3BOSA 5JRZA 2B6HA 2XTNA 1BMFA 4AURA 3EC2A 2ZRGA 1NKTA 1ZW6A 4DLSA 1TU3A 2P65A 5KDDA 3WRXC 4GMXA 1AKYA 2RGCA 3RS5A 4V0KA 5IRCD 5F9FA 3TW8B 3THYA 3JVVA 3IIJA 4NYMQ 2QENA 5AR1A 4LWZA 4B3DA 1OPXA 3FFBA 3DKPA 5F2EA 4TQ9A 1OIWA 2O8BB 4TYYA 4LBZA 3CR7A 2XOKD 3QXJA 2WJVA 4JVMA 4U7DA 4AKEA 1GNPA 5FOVA 3VNVA 2Q3MA 1T8TA 1XPOA 2ZJ2A 2IYTA 3AF2A 4BZXA 4DIEA 4FMDB 4EDHA 1KDPA 3QKSA 1KNQA 4TWZA 5KSOA 4F92B 5KPDA 4YC7A 4M0LA 2WAYA 4NDZA 3R7WB 1E9FA 3EARA 3RVBA 5JJKA 2EFGA 1EFUA 4ASUA 5FOWA 3QF4A 2C95A 4NCJA 4Q18A 3UPUA 3Q7QA 3BXZA 2F1RA 4PTLA 1E0JA 3K0AB 1P2VA 3ZQJA 3IEVA 3PQCA 1E4VA 2REXB 3THYB 1D9ZA 1Z0DA 2ZRMA 4MGZR 1KY2A 3MWJA 3WNBA 5FBVB 1MO3A 4YDSA 1F60A 1DARA 4ZO4A 2VTKA 4OQMA 5FPHA 3U3OA 2G88A 3O47A 4WZ6A 1F3OA 1Q1ZA 2R6GA 4ZCIA 5FL3A 1Z06A 1T8UA 3FYHA 1SXJC 3AGPA 1KKMA 4HB3A 1M7HA 1OE0A 3WMGA 1Z2AA 4JLMA 1AKEA 1RPZA 2ZRJA 3VKGA 1NN3A 2ZREA 3SJAA 2OZEA 3B1ZA 2C98A 4X8HA 1SVSA 1YR6A 3F8TA 1ZINA 2ZI6A 4LJ8A 4B73A 1J7KA 4YMTA 3R7WA 4EAQA 1K8RA 2XTZA 4QHTA 3FKSD 2H5EA 5BWMA 3X1DA 3EWAA 1X8JA 1EX6A 4RCYA 2WM9B 4XJXA 2CL7X 5C18A 5L3RA 5KNCA 2H8KA 3LD9A 4I1VA 4DDVA 2VYFA 4PFSA 3O8DA 4URVR 4M2LA 2ORIA 2G77B 3NBZC 4PO8A 3SJZA 1MRSA 2BHRA 3BB1A 3RC3A 2J87A 4AK9A 2GAAA 5BQ5A 4RZXA 3WYFA 3AF3A 4R71A 4C0AC 1E9DA 4D4MA 4B2IA 1W0JD 1M7GA 521PA 3RANA 4BLSA 4DSUA 2QP3A 2OE2A 4HAXA 1MO4A 2BMJA 1GDDA 5GVSA 2BJVA 3AKEA 1U9IC 1N5JA 2HCBA 1W1WA 3K0FB 3THOA 1D8TA 2Z6VA 2ZYVX 3QG5A 1VYUA 1YR9A 2OCBA 1KDRA 2GF0A 2Q6TA 4KODA 4LPSA 5FL7A 1NP6A 1Q44A 2AHOA 3P32A 4WOPA 1Q12A 3LXRA 1G1MA 4TL9A 4TL6A 1SKQA 2B7CA 2IYUA 1E9RA 3BWDD 2VP5A 4ASUD 3ZD6A 2O8CB 1KK1A 5DGXA 1C9KA 4M9SA 1G7TA 5L3VA 3CRMA 3ADKA 5DN6A 5JCPA 3ZH9B 3H4MA 1HUQA 3RRNA 4IXMA 5C4MA 4D81A 2B7BA 3N2IA 5TVKA 4JLKA 3IO5A 1N6KA 2IEYA 1RE0A 5DO9A 3MAAC 3T5GA 1NG1A 2O8DB 3T06B 3KQNA 4RSGA 1XEWX 3RNLA 3UATA 4Q7JB 4Q1FA 1ZAKA 5CYPA 4ACBA 3ADBA 2QEQA 2RGNC 4EPVA 2O8DA 1KI7A 3BB3A 3CM0A 4PO9A 1X8KA 1G3RA 3A4NA 4IEEA 5EUMA 3FHTA 3WHKA 4KVGA 3OEHD 1CIPA 3HR8A 3QPVA 3PR1A 3RRYA 1ZMXA 2ZRBA 4YQFA 2AX4A 1N25A 4Q1AA 4QHSA 2IWHA 2D2FA 3EZ9A 3THXA 1E96A 2CJWB 4UJ3A 2O8EB 4M1MA 1HURA 2IF2A 2N1BA 3REGA 5CIQA 2ZAOA 4NE2A 3AP1A 1LV7A 2EFDB
chains in the Genus database with same CATH superfamily
1PKXA 3IUBA 3WYEA 5TB5A 5KOJB 1CFZA 1JSRA 5BQXA 3GLTA 2AZMA 4O63O 1KRWA 1V8OA 1UT5A 3HA2A 5FOQA 4MDEA 3NHKA 3WRWA 1YRHA 3JD2A 2XMGA 4BMZA 1TYEB 2OHJA 4C2AA 1C1XB 2GAJA 4NBLA 4TV9A 1IOVA 2DPGA 1XU4A 3DFIA 4CMIB 2GPNA 2W6ZA 5AKXA 2Q6LA 1SJ9A 2GYWA 2QN8A 2AD1A 3PE4A 4KR0A 1I7PA 3UXHA 1HDEA 3EHDA 1Q3TA 5EPEA 2N75A 5KQPA 2B37A 4H1HA 4TRMA 1OTYA 1NVXQ 1UUFA 2QPLA 1ODTC 4IXWA 5EIWA 3D6VA 5HILA 3ND5A 4PYQA 5A7HA 1B0ZA 3UH0A 4Q4LA 3INRA 4CM4A 3U2QA 4EUKA 4P36A 3KHSA 1TTQB 5HOQA 1UWLA 1O77A 2WAXA 2O52A 1VPLA 1IWOA 4N9QA 3JQ6A 5JTUA 1DB3A 1YZLA 2XBLA 2IU4A 3AY6A 5D51S 1WMDA 2VT7A 2HM7A 1EWKA 3M6LA 3FBWA 3UN1A 2CW5A 3GEBA 5FFFA 2H92A 1AT1A 3C24A 5I9NA 3C97A 1FFYA 3DO8A 1XTIA 1O8BA 1OX4B 1EHCA 5J2UA 5IX8A 1NY5A 4P7BA 3PF9A 2W43A 1ECGA 3LSYA 3RCBA 1QFMA 1UPXA 1NZDA 2WJ6A 3OX2A 3P0EA 3DE3X 4G4SP 4W9RA 5LIRA 4AG6A 1Y3HA 2DUUA 1UJMA 4OHYA 5DHQA 1TQ6A 2ONZA 3LZ6A 2IEGA 4PPGA 4LOAA 2BTQA 3OESA 2VPPA 5E8JA 4F5EA 2CNWD 4EYGA 5AIBA 3REQA 4GQAA 1MPTA 4HBZA 1OPRA 2VTDA 2WU1A 1AS0A 4QBIA 4RX1A 3MJVA 4CEHB 4LRXA 3PQFA 5TVGA 4RGBA 4G0WA 1RJ9A 4L4XA 4AJLA 1Z0JA 3KKLA 3QEMB 1U5BB 1WULS 1U04A 3UAYA 3G2QA 1ENPA 1NIJA 3CEHA 1F7UA 4DC9A 3QXXA 1OF1A 4FYVA 4K88A 2Q7OE 1JT9A 3P9PA 4IKOA 1VL0A 2QRQA 4HZUB 1E2LA 5K8UA 4CM7A 1JJVA 1R4NB 2B4TO 2YN0A 2PFSA 3A9VA 3UJDA 3UGKA 1T0UA 2J4FA 4MVYA 1OYYA 3ODGA 1JBKA 2ZPUA 3NPMA 5D87A 2YYAA 2UVPA 4JSRA 2PZJA 2CDNA 4FLFA 1Z4NA 1P5FA 6ABPA 2BSAA 2FHSA 2XW6A 3GZJA 1O03A 3GT7A 1C3OB 2QWXA 4R68A 4X7BA 2OCXA 4OREX 5KEIA 4ZN6A 3TR5A 4X7RA 2O2DA 4JI0B 1RWKA 2OQRA 2A3RA 5E6RA 1GNTA 3MVEA 5IT4A 2J0QA 3R3YA 3LYHA 5DF1A 2GZSA 1T2FA 5JHGB 2FWBA 3P2MA 1HL7A 2ZJ8A 3KEMA 1JN0A 4MJ7A 2BFEA 5HUHA 2RIPA 1Z6XA 1AQYA 5EHXA 1BYIA 3USZA 2PZBA 1LQ2A 5HZKA 3A3OA 1E7MA 3CVXA 2Y76A 4ZK6A 5H1YA 2CSUA 4KR9A 4F9FA 1F1BA 2HIHA 3RS4A 1SCKA 2G25A 5BSFA 1ZFNA 1O94C 5HKBA 1MC5A 3RKUA 1IN1A 4RXMA 1TTTA 2D59A 4YRCA 2VK2A 1YASA 3QJGA 2IEDA 4K9NA 3A4TA 1M76A 3R24A 4IZHA 2HHCA 2WYOA 1ST3A 2OZKA 3C3JA 2E1PA 1TD9A 3HHEA 4BJ6A 3BL6A 3IPRA 1M2EA 3Q41A 4G5SA 4N82A 1YRAA 4BKUA 2A94A 4WECA 3LNCA 2HJVA 4GXQA 2WVAA 2Q1YA 1F48A 3GA7A 3JQDA 2AG5A 3CEMA 4Y2QA 4YJFB 1XZMA 4PG8A 4F21A 3P27A 3CLHA 4TV9B 3IAAA 3U48A 1U9IA 3OTHA 1I4LD 1VE7A 3DF9A 1DVRA 4MDFA 2EP5A 1HEIA 3JQFA 3CLUD 1U1GA 4BGEA 4BFVA 4I1PA 4GE3A 3V2HA 4NMLA 3ZJ5A 3GUYA 4RETA 2B2NA 1S8FA 4KXUA 5H4GA 1TO1E 1JKFA 1CR2A 1P1IA 3WLMA 4AZVA 4TMXA 3E7PA 3CKLA 2Q9BA 1NDQA 3BL8A 4FDLA 5BORA 1YRYE 4BMVA 3E8MA 3LPLA 3NGLA 4PQYA 4ZC8A 2HV8A 3E2MA 5BQPA 3EXHB 1DWUA 4UVDA 2NYRA 2YBDA 1A2QA 1PUIA 3B2QA 5C5IA 2FPGB 1GL7A 5DCWA 3ZHCA 4NULA 4RD3A 1S8NA 3HBNA 1XHEA 3LL4A 5AUOB 2UXDB 4ZI5A 2IDMA 1TGVA 4IIUA 1KI3A 5EZSA 5IYZA 3OMWA 2QX4A 3EXEB 2FGKA 4B3CA 4CLRB 5LU9A 2IW1A 1J25A 1HYGA 2QN1A 1D6NA 1AUQA 1B3BA 1G9SA 4BLPA 1A77A 3EXIB 1SU6A 5IUJC 5SYAA 2X8JB 4HN9A 4ZT3A 1JQJC 2BZSA 4CU2A 4V1CB 1GPYA 4QVIA 4TTAA 3VNBA 2WMNB 4ZJUA 5KNCD 1XJCA 2FLKA 3CUUA 4EO9A 4UUMA 2ETVA 2BLLA 5BR7A 2J5RA 2PLNA 3CKKA 3GDHA 4NBWA 4E22A 4DY4A 3K0SA 3U3KA 1FUUA 2W6QA 4URWR 3U7EB 4W5WA 2O5EA 4LC9A 3E5NA 1RYHA 3OIGA 3W4IA 3GJ4A 5DXFA 3FWZA 4ETWA 4JL8A 2BN4A 4XUCA 5I4BA 5KWIA 3UY4A 5TMPA 4LMPA 2JGMA 3LCUA 1DWOA 3RC1A 5ICCA 3HUFA 4TYMA 3QY0A 3TLMA 4RO0A 3X44A 4M1ZA 1VJRA 3ISTA 4B7UA 1T9GS 1Z4JA 1SCUA 3OC6A 4MCIA 3ZOZA 1YS6A 1GQQA 3ACBA 4RPCA 4GI1A 1DQYA 4HB4A 4U00A 1UMDB 1Z6YA 2HFJA 3R4VA 4NJMB 4XIYA 3GVIA 4F4DA 2BGUA 3T54A 1FNNA 4X20A 1M1YB 2RH9B 5M3BA 1OBCA 3GLSA 3NV9A 3ROPA 3S40A 3VPCA 5GIPE 4Z4EA 4QJ4A 2FOLA 3U4AA 1ZI6A 3ZJTA 2HEGA 3D7NA 1ZSNA 4MS4A 1HQYE 4K40A 1TZCA 2IYZA 2RH8A 4KACA 4UHFA 4ZCSA 1U4NA 4MH0R 3RJ9A 1KZYC 1PE0A 3C1OA 5DYIA 3BWBA 3BDIA 1YKFA 4KO1S 5DJ5A 3AUTA 1XVTA 1T5TA 1W5TA 4GMGA 3QXHA 1ORRA 2GJ9A 3KSZO 1E2QA 4YRFA 3BFPA 3I37X 4D44A 2YWGA 4MPJA 2PCJA 3M1LA 1TX4B 2JPDA 1AQUA 4G5OA 3EK2A 5CH5A 3V8EA 1JIUA 4Z54A 3BG5A 4ZREA 4ZV7A 4X62B 1JR3D 2W4QA 5FADA 4Y2PA 4IJMA 4GOXA 1PWEA 4IP0A 3KZNA 1W48A 3S68A 3X2EA 1C7RA 1AS3A 1CPYA 5CG1A 1KNXA 2QTVA 4ABTA 2BFCA 2BKUA 1B74A 3TOVA 3G6WA 1F0PA 2EATA 2FPPA 1UH5A 4JJAA 4PNEA 3L5KA 3L0IB 5BSKA 3CSSA 1E63A 3GJQA 3H9EO 4QYIA 1U8UA 1Z2EA 1ORVA 3LQKA 4L15A 4AKSA 1JUDA 4EA6A 2OHIA 1M2OB 1Q0PA 4L2IA 4BB9A 2BFCB 4WOJA 4BRWA 4GYYA 4PE5B 4PYIA 3GBPA 5HUQA 3WLSA 1BGXT 2VJMA 2WPDD 4XWYA 3BXPA 4GKAA 2QV7A 4CIWA 4DJTA 3T3GA 4KL8S 4KYUA 3PXDA 4X63A 2YZ7A 1M9NA 3CRNA 3PUVA 3RYTC 1O8CA 4B6QA 5HIJA 1JMYA 3LBFA 3VBEA 3FB4A 2NU8A 1P1HA 5BN4B 3SC3A 2C7GA 5HIMA 2WKSA 4Z51A 3GLKA 4M7RA 2J8ZA 5T4FA 2Y93A 4C4OA 3ORYA 4WASA 3G2PA 3K31A 1M2JA 4P7GA 4TTQA 1XTRA 4M83A 2VZ8A 2G0NA 4Q1DA 2R7LA 2EGUA 1EVZA 3D1LA 3DAGA 5AI4A 5IFLA 1YUMA 4CETA 2ZSAA 1MORA 1H22A 1W1UA 2LWIA 4OJNA 1F5NA 1UZNA 2EJUA 4P54A 2DQZA 5DLYA 5CITA 1NMXA 5E6UB 5IDVA 5FDFA 5J2TA 4I50B 1KU0A 2OHHA 1BE1A 3OLYA 4YJ3F 3K5IA 3AG5A 2YWHA 4H0FA 4DLWA 1WLSA 1UMCB 2SKEA 4CFSA 2OOSA 5DNVA 1SKYB 2FG5A 4R05A 4QARA 4C4YA 4OEHA 3GGJA 2O6LA 3N9IA 3OE4A 5E9WA 4RD4A 3RG8A 4Z1OA 3HE3A 1C1HA 3GUCA 3NEYA 3ADPA 2BUCA 2I5PO 2PVPA 3BORA 1GTSA 4PYJA 1XT6A 2C00A 3UAXA 3VYWA 3HG7A 3P0IA 4M9XA 4I19A 5EFZA 5A4MS 1X3SA 4MVJH 5KZMB 3LUDA 1CF4A 3EVZA 2W2KB 1QFXA 2ZB3A 2YVQA 3JZMA 3C7KA 3ZV6A 1YUNA 2DTEA 1U0OC 3EZXA 2ZPTX 2QMEA 4DVGA 2EQAA 1PJAA 5K9ZA 3H6KA 4TWBA 1JR6A 2HH9A 2JLQA 4K0RA 4YROA 5TJHA 2V3WA 3B1YA 4R9VA 2DYKA 3U3OA 4MITA 4BTEA 1U5AA 2ZB7A 4BFSA 2P9GA 3AR8A 4G0UA 2H9AA 3G8DA 3WTCA 1W0KA 3A6ZA 3KEGA 1XKTA 3O94A 3QFCA 2ZCVA 4NU5A 5AW1A 1Q1GA 2PXHA 2HWUA 3G68A 3HRIA 1JR4A 2O8CA 2VFAA 3NHLA 2VDLB 2ZS7A 4QDXA 4D9FA 4HDSA 4LE1A 1QQTA 4ARZB 4ZGBA 1JIKA 2Q8NA 3VMFA 1VQ1A 3P5SA 1SA0A 3UMJA 4DXAA 3M1AA 4EF4A 3OSZA 2MSWA 2BDTA 2Z1MA 4XUEA 2VK1A 5GTDA 3O8QB 5CT8A 5DI3B 1SULA 2ZT7A 4GQBA 4CJXA 3WWDA 1YMUA 1N6IA 2GKGA 1WDLA 1J99A 3OT4A 3B13B 3RS2A 1VA4A 1D2MA 1AGPA 1YR1A 5JAMA 1BIFA 4H0CA 3F49S 4AKGA 3AI2A 5CDFE 1WPRA 3TX2A 4TYPA 5TQ0B 2ZWIA 4I7EA 3P0FA 2RGNA 4B3FX 1TPYA 1BCRB 1GUFA 2IHBA 2H9YA 2YYZA 3QHPA 2DETA 5IWCA 4QODA 2FJPA 2HIGA 1DG3A 4PZ9A 2GASA 3ONFA 2X1MA 4R9NA 4AB1A 4BZZA 4ZHQF 1S2GA 4H6VA 4OHMA 1UK9A 3EQ9A 3UCEA 3WB1A 5JANA 4LF9B 3MHPA 1P18A 2RC6A 3I4CA 1AE1A 5BMVA 1PJSA 3WGGA 5IH7A 3GFVA 5AVRA 1CETA 1WKCA 1VJGA 1L5WA 1PNOA 1B43A 5AVOA 4M8KA 2R97A 2FUG1 2GN0A 1HTBA 1R8JA 1T3HA 4NTZA 4ZQEA 1H69A 3OIWA 2RDMA 5FHRA 4DSAA 5DSZA 3J7TA 4QYTA 4OXXA 4O2AF 1OY1A 1T5HX 2IXTA 5JSYA 2YWFA 2ZRCA 1FXSA 1K8YB 3CZMA 3FPJA 3QXGA 4ON9A 3G9ZA 1ZITA 5KYUB 1LBIA 3RSOA 4MA0A 3RDPA 3Q88A 5FUYA 4E09A 2CF6A 1RCTE 1HNXB 3AF1A 3B2NA 4EMTA 3WG9A 3L4KA 3RTBA 3KQLA 3V1YA 3V5NA 1DJLA 4CLXA 4AY4A 3W3ZB 4NOJA 2C4UA 1EVIA 2Y67A 4MVJM 1JFTA 1CWUA 1WXXA 4DMFA 721PA 4BAGA 3DS8A 4R1OA 4XARA 1Y37A 3KDSE 4UEOA 2E9SA 1EK6A 1S4QA 2I3BA 1UEJA 3IH5A 4A6PA 1DEKA 3H5AA 4KMSA 3LC1O 1YMVA 4UCFA 4LSGA 5C53B 2E2WA 3EUEA 1RAEA 1SXGA 1XLTA 3BM5A 1C30B 5INTA 1E2GA 1NN1A 2ZI5A 5C7OO 4D9GA 2CXRA 2AOUA 4YS6A 5DZSA 5K8LA 4QNRA 1W75A 3QWIA 3R4CA 4IGEA 1NWHA 1C9NA 1U0NA 4Q4DA 3HCCA 3ABIA 5LM3A 1T2EA 5IAGA 5KX5B 3AVYA 1E77A 3IT1A 5MGNA 3FPGA 5DWQA 3FPSA 4WV3A 1DAKA 4MARA 1VHTA 3JYPA 1VE5A 3HFGA 2V54A 5JSHA 1FTSA 1EFVA 1SBZA 1YFLA 1KFJB 1T6BY 1U2DA 2BUBA 2OXRA 2VDUE 3FRIA 4JKYA 2B4KA 5HS6A 4BC0A 1NVMB 1R0RE 2HA2A 3IKVA 4I08A 5FPPA 3ZNNA 1V8ZA 5LWQA 4TM8A 1AMNA 3FCOA 2PWAA 4GI2A 5D3KA 3AI1A 3BGIA 2BBOA 3OZAA 5KU7A 1DUSA 3GN1A 4RELA 4MX8A 1JXAA 3QMPA 2BD0A 2OKGA 1LNSA 1GFWA 1TADA 4II2A 3B3AA 3V2IA 1Z08A 2YHIB 1ZH4A 1ZNZA 2Q0HA 1FB5A 2KPOA 4RC9A 3VC2A 2ZQZA 4IJ5A 2ECKA 3JAMA 5GONA 4AQ7A 3QXSA 3HA3A 4US1R 3MPUA 3AYZB 3UH1A 5ARBA 1JQKA 1RXVA 1YL6A 3O73A 1DNPA 2BTQB 4X66B 1J7JA 4N18A 2Y0PA 3I9LA 3G23A 1WZ2A 1R15A 1C81A 1RZUA 1X19A 2QM7A 1H2RS 4GH5A 4D8YA 2B61A 1L8LA 2ZANA 4NCXA 4AW9A 5TGDA 4IX1A 4HLCA 5EJ5A 2RGAA 3EG9B 1LEHA 2HQSA 2DLCX 1I2MA 1TLFA 1FFWA 1XBTA 5IDXA 4OLJA 3CLVA 3O1JC 1GWNA 3MBKA 4MP3A 2VEDA 4DANA 4FILA 3BDAA 2GCOB 4HEJA 3PI6A 1RPNA 1TVMA 3DHNA 2RI1A 5PNTA 4CM8B 1IDN1 5BVHA 1CRWG 3RBXA 8ATCA 4B85A 1PVOA 4L7VA 4MWZA 3S2UA 3KYCA 2JAPA 2RHCA 2YJTD 2I80A 1THMA 2UV8A 4UHDA 4DBZA 2G6TA 1FNMA 2I6FA 4MWSA 5SY4A 1L4MA 3M83A 3TLCA 1C3OA 3PD7A 3OLVA 3WJAA 3INGA 4YBRA 2ZGVA 3VJKA 4IDQA 4BS9A 1NKVA 2WJPA 3IQFA 2VDWA 4LWOA 3EXG1 2QUBA 5JEDA 1Y6JA 2CVQA 1GL6A 5ES4B 3NYQA 4UNIA 1Q1QA 4XSGA 4X1OA 1MIHA 3B51X 2BGKA 3QKSB 3ZXIA 3FETA 3FXAA 1QIFA 1IXSB 2R6DA 3F3SA 1YDGA 1RMTA 3R9IA 3HDQA 3LLMA 3QQ5A 3SNKA 3LOQA 4GI7A 2OC9A 1ZIDA 1R88A 3PPXA 1T2UA 4R9RA 4OMCA 4NPCA 1ZK2A 4X1IA 5BYKA 5ED4A 4D42A 1G2IA 4WMLA 5LP6B 2ORYA 3DBVO 4KZKA 5DVZA 1DKRA 2I4NA 3DG9A 4HFJA 4OQLA 5M7EA 4IDFA 1BWRA 3RYHB 3UMVA 3O8OB 5KHOC 2GBLC 4OQEA 2DEUA 2O7RA 3LP6A 3PLAE 4OGKA 3P94A 4DGSA 4FX5A 2DQSA 3SJ7A 3THWB 3KALA 4LCBA 2D2XA 4LJ6A 1OROA 3GIDA 3U09A 1Z88A 1M83A 4ZAFA 1ZN8A 1QC5A 1BQ3A 3D2AA 4I8IA 1KQNA 1P7VA 4C3VA 3MCWA 1NJ8A 5IMSA 5ITZA 3GUZA 3L4JA 4CMBA 4QEZA 1S2NA 1OYVA 2B5WA 2WMOB 1YD7A 2BY4A 3OIVA 4ROSA 3TXYA 1NTOA 5A4AA 4DIFA 1UJBA 1E7YA 2POCA 1EIWA 3WLEA 3ZD9A 4FZ5A 4QOIA 4BO0A 4F46A 3ND8A 2HLHA 4X71A 4X8LA 3IAEA 1KYQA 4LZOA 4AZWA 4L1KA 5FBWB 3ROXA 4AUNA 2ECOA 5KX5A 2HZ7A 3IKMB 4MA4A 1R8SA 1ZZGA 2GFHA 3SICE 1H2AS 3AKDA 1NW4A 4HNSA 4J0KA 5JYCA 5A5DA 5JSZB 3DSRA 1XZIA 5L51A 2QRMA 4O4HF 1Z4PX 5TQ2B 1QFYA 1JAHA 3DTVB 3LSTA 1G63A 3OFSA 3MUOA 2XVMA 1SR8A 4H1TA 4OHUA 3VTZA 3WQQA 4ABYA 5KMGB 4JIGA 5KYWA 2QVYX 4KN5A 4BCBA 3UAOA 2LTAA 4HN4B 1OXSC 5A0FA 4OA8A 1PSDA 4KLRA 4RFSB 4CMIA 3S2EA 2X8AA 2FKNA 4BXOB 1XCLA 4D4HA 2WD8A 1JEAA 1T1GA 3GEHA 2GKSA 4OB7A 1VJ5A 3TKLA 5IKMA 1Y5NA 3C48A 3R7BA 1WCV1 2GBCA 1R8YA 3UW3A 3ZHYA 2P78A 2RHOA 3WIBA 4U7GA 4F85A 1QO7A 1UMCA 5FB3A 2VQEB 2MSDB 1L1QA 1PLKA 1ZOPA 3NAGA 3Q6NA 3DQQA 5CYFA 2ID7A 1XG5A 2WG2A 4G0NA 3KB1A 3AHJA 3FR7A 3SOZA 1VSTA 1AZLA 1FBTA 3GROA 3OZIA 4IEFB 3WZ2A 2PH1A 4ZO8A 4Q1EA 4DDTA 2IDKA 2XD9A 1DG9A 2JGFA 1OB5A 2P6UA 3S2GA 3DT8A 5GZ3A 4MDYA 4L78A 1NVAA 5JYDA 1W1IA 7YASA 1FX0B 2NIPA 3E3OA 4XJTA 5IARA 6PFKA 3UTDA 3V32A 1E3IA 3EVDA 4JT8A 2H59A 3ZHQA 4EFNA 2NAFA 4DN6A 3BICA 4D0LB 2FNAA 3T9FA 3AVTA 1T1JA 3B1WA 1M5TA 4RPJA 4JJFA 2CXXA 3COSA 2G09A 3JQ9C 1L4NA 3CTPA 1K63A 5JJ5A 5KMGA 4EMSA 3HMKA 3H8WA 2Q9UA 4QM6A 5REQA 4LYFA 4AIIA 1CY8A 2BT4A 5K3AA 4NESA 2F8MA 4YJ2A 2HRCA 3BAZA 1NXOA 2ZVQX 1JWAB 5EINA 2IPXA 3B8EA 4EKYA 2C5EA 1DL5A 3FGNA 4RCZA 1ZEJA 4KG7A 3EVAA 4HUJA 4WCFC 3UG6A 5L3QA 2IHJA 2JZNA 2XCQA 3AHHA 3L9WA 1BXGA 4R7GA 4Q3KA 3ZW9A 5AWFC 1QONA 4DTCA 1N3LA 3SE7A 2LDXA 1Q84A 2AZ4A 2YUIA 3HBFA 1LPMA 5FLXA 2VJQA 4F06A 4XVHA 3DUFA 3WR5A 3DEKA 4NR0A 1TA0A 3AFGA 3SXUB 3RRZA 4G0MA 3V80A 4GOND 1VZ3A 2TMDA 2FR1A 4KXXA 4Q4JB 3BTUA 5IW8A 3VDNB 4DNPA 2G1KA 4L5BA 1A5TA 1UWVA 4E12A 4JXXA 2A9FA 3BE6A 5CFMA 2GNAA 3I0ZA 5FOUA 5TNXA 1OFUX 2Q5HA 3VNSA 3H2IA 3ZEAA 3VA7A 3VTKA 3TIIA 4FWIB 1KBZA 2AXNA 4IMIB 1UFOA 4AG5A 5DGIA 4EFDA 1CZOA 3KDPA 3G7SA 4LGCA 1QO9A 1OAKA 4OMUA 5KAMA 4FXOA 1J2EA 3VH4A 1J90A 4R5MA 2YHUA 4MXDA 3GD7A 5EHQA 1T6NA 1O1YA 3QJYA 4ZK2A 1XF9A 3UQYS 1I7LA 3MXTA 3HK2A 2IU0A 2VH1A 3EDOA 5HQTA 5A4DA 1V4NA 2Q7XA 1FDVA 4FFMA 3HL4A 5E4JA 1Z0KA 2VNHA 1N3IA 3OCJA 1LZLA 1SRRA 2ZBUA 4QHYA 4RVFA 1LLUA 3WISA 4KVFA 5KTKA 3VDXA 4Y2YA 1UKVY 4BGIA 5BV8A 3ILHA 3FCEA 2FMTA 4QRIA 4DVJA 2SKCA 4EL0A 5JVDB 5JNWA 3UJPA 5KJCA 1U1IA 4ZEWA 2DPLA 3NZEA 4CMJA 4HEA1 4MVJE 4P4UA 4K5QA 4KXFB 2YQZA 2QPOA 3SYLA 3UK1A 3W0LB 3JTEA 4CODB 2X4LA 3I04M 1N2CA 2EFCB 4GMHA 4QBGB 1FUEA 3K16A 5AVWA 3HP1A 1F8YA 4GSYA 2I2AA 1L9KA 3WL7A 1KAQA 3ICQB 1M0WA 1NZJA 1O6ZA 3G9QA 4CRWB 3T3NA 5A71A 5CD1A 1FPMA 3EPLA 4LI3X 5IM5A 1QUEA 2VG8A 4URUR 4JOBA 3A9CA 5AI8A 4NBKA 2GJ8A 4UU1A 4WEOA 2J3JA 2HF7A 5ALGA 1D03A 1GITA 3E9QA 3HGQA 2FLVA 4UFOA 4B33A 5B2EA 3PDCA 1GSAA 2PUJA 4G1BA 4XWKA 2A5FA 1G2QA 1UXKA 1ZEMA 4PS0A 4DIMA 3WO1A 4MS3B 4BLTA 1U65A 1W35A 3DXFA 3GX1A 3LUGA 2ZBGA 2HMAA 2ZJ6A 1M7BA 4GYWA 1ULHA 1GPUA 4PNZA 1NRXA 1ZL0A 4ARSA 1NF2A 1NVBA 5KWJA 1P62B 2HPHA 1EWRA 1FBNA 5C81A 3ZDQA 4MJXA 3S1LA 2ADOA 2XBUA 2V7QA 1RHKA 1RLJA 2VOEA 1GUBA 5C80A 5KBYA 1YOVB 4FYPA 1L7RA 2JBHA 1VMAA 3PCXA 3V9PA 3LUCA 5UKDA 3SSMA 1A88A 2BE9A 3ANSA 2NN3C 3GFTA 3T15A 3TTVA 1ZG3A 3WLIA 1YHYA 4KUHA 2QSYA 3PYLA 1Q2UA 2VUUA 2ODEA 4DYHA 4N0PA 4BCDA 4BMOB 5FWNA 3L84A 1MXHA 4ED9A 4WJZA 4W63A 4GXTA 1XQVA 3CNEA 2HU5A 3E05A 3LW7A 4FD3A 4O2BA 2VR1A 4WL0A 5JSKA 5C8YB 1JBQA 3IBCA 2UYOA 1F4LA 1USUA 5FPQA 5TARA 1RLTA 1R3UA 3K5PA 2R25B 3IAUA 5DLPA 3EXHA 2EJTA 4CMHA 4ZEVA 2JNWA 1PFYA 2AEEA 2FWJA 3DMFA 1I33A 2XNDD 4FX2A 1MPXA 4G5GA 4I8DA 1QZUA 1PZGA 2B78A 2RK4A 4L50A 4MB6A 5NULA 3V4VB 3K96A 1NVWQ 4D9KA 4MKRA 4HHEA 1QKKA 1RZVA 3KOMA 4RMNA 4AS1A 5DBIA 5FXMA 3K9WA 4PXSA 2PDAA 1U1EA 4QECA 3WLQA 1X1EA 2NXNA 5C4IA 2QNRA 5FPTA 1QQ5A 3R7NA 1RPAA 2BBSA 5FTWA 2UUBB 2XCOA 2XE4A 2B9VA 4JL6A 5JXHA 5IKXA 2V1XA 2R00C 3SYTA 1KR2A 1DIAA 1OFUA 3BH7A 4YT8A 3JAKA 4PBSA 4POOA 3SYMA 3CUWA 1JLHA 1OX6A 3HCFA 1ZYUA 4UM9D 3VZCA 5I48A 3E5RA 2FXVA 4FQ5A 2HTEA 2ZT8A 1Z5NA 4UTVA 1PWXA 1T34A 4FQ7A 4PSVA 1Q7RA 1O0BA 1T8RA 1LRKA 1KJJA 2B82A 3MEQA 4PZPA 4Y8VA 2DLDA 4S24A 1B76A 5E9JA 4CM9A 4EFLA 2H11A 1CVRA 2ZSUA 3DE4X 5FOXA 3FZGA 1NV8A 2HWWA 3RUDA 5FUXA 1B6TA 2HNBA 2P9JA 2NSLA 1E18A 4QO7A 2CXSA 3CONA 4ZAVA 4BLVA 4G0YA 1SBCA 5DK6A 3EXFB 4EMBA 3IOYA 1PSZA 1KYTA 4OAOA 3RI3A 5KJ1A 3G6KA 2YZMA 1N7GA 2G9ZA 1OLOA 3AKYA 3R3ZA 2WJYA 4WCDA 2FA9A 4NOLA 1UEIA 4V39A 2YHAA 4FMBB 4NDAA 1KU6A 1BXKA 2MSLA 3L4BC 1Q11A 2CCKA 4ADSG 3KKKA 1YE5A 5E9AA 4BNDA 2VNAA 1KKLA 1UPTA 4GKJB 4OV6B 3QYFA 2DFVA 2FJUA 4O4IB 5AKHA 2NPIA 3ZGNA 4HNRA 4JEIA 1UK6A 4EMUA 5B5SA 1R9NA 1R18A 1OWNA 221PA 3SLRA 3EGDA 4DQDA 121PA 1U80A 2I1WA 4R1NA 4K2AA 2EIXA 1N6PA 2V6IA 5COBA 4KE6A 4KFCA 4O0LA 5KHAA 2ZSBA 2WFMA 1R6BX 1JG6A 1IAVA 4X1KB 1H0RA 4QG3A 4K9RA 4TXMA 3FNFA 2JDIA 4QC2A 1NUUA 3PHGA 4M0PA 3OU6A 5KNBD 1H2ZA 2XB6A 2BH2A 1R12A 4A2PA 2PGNA 2O3RA 2WU3A 1VL6A 4XD7D 3RV4A 4B40A 1Q14A 1XD9A 4GYJA 4S2EA 5JS6A 5BSEA 1K06A 2I3ZA 4YT2A 4G4JA 1KHHA 1LD3A 2VDVE 2E48A 3EPPA 4BQRA 4H7DA 5AK5A 2VF8A 5AJVB 2ODBA 2VCHA 2W0MA 4AMBA 2QPAA 2IOQA 3H18A 5ALXA 4M86A 1QHSA 3VH2A 1G5QA 2AI3A 4ZAYA 1THTA 4M0MA 4CGZA 1R0CA 4DF3A 3QELA 1DKMA 1QG0A 1A8IA 4QUAA 3SLGA 1VDMA 3TN7A 3WB9A 3GP5A 4XDGA 3S8MA 4CMKA 1OLSA 2ZYDA 1OR8A 3OM9A 4PIPA 4JLJA 4XGNA 3RSLA 3UJCA 3VSEA 3I2YX 4ZAWA 2VHXA 1XL1A 4TL7A 1KPHA 2YXDA 1ENOA 1WMSA 2WSYB 4N3GA 5F3WB 4H4CA 4LNUB 1TQ4A 4W5JA 4EB6A 2PTGA 1YOVA 4J16C 2ECPA 2I2CA 4V0MA 2ZOSA 4GUDA 1Q7BA 2VPQA 1RJEA 3ZNQA 5I9IA 2REBA 1JA0A 4YT4A 4M8IA 4G0VA 4R2IA 1RYBA 4N76A 4C7VA 4OM8A 4MHOA 5EFOA 1CY6A 1ADFA 4F71A 1VB3A 1H5QA 1H8HA 2XNJA 3TIGA 5ITVA 5KCZA 2W2LD 2ZWPA 3VR5D 3S7ZA 3PRYA 1TFUA 4AJKA 4RTPA 5FTNA 5C9ZA 1JAZA 2CK3A 3V46A 4AP9A 5C1BA 5HRCA 2QMHA 3WGJA 1K92A 3I39X 4LSWA 1JPUA 4I55A 1TECE 3WK5A 1EJ6A 2FPMA 1Y34E 1VKJA 1NLYA 1WPXA 2A5JA 1GZUA 2CBGA 3HFSA 3KOYA 3I05A 5LB4A 5K03A 2QL7A 1YQGA 1RVDA 1CC1S 1GEEA 1JPVA 1PV1A 3DOIA 1P2FA 2C9CA 4M1QA 2B1GA 4D4KA 2FGJA 3F7NA 4YB8A 2JCVA 5IYZF 2Y77A 5AP9A 5G1OA 1LF0A 4M6WA 1SXJA 4US2R 4KOAA 2L18A 2IJGX 4QFDA 4DCNA 4Y9SA 2C5AA 1XD2A 4Q4AA 5JW6A 2W6ID 2G8LA 1B1AA 3PK0A 4I1IA 1ZU4A 4QDZA 3G17A 5FKJA 5TGZA 2PMEA 1E0DA 3OJEA 4LSZA 3ANNA 4BEBA 1CJUC 4JITA 4DCUA 3KQUA 3DOHA 5KC9A 2D74A 4AMGA 3M0EA 4KU4A 4PZYA 3EF0A 4YV1A 4LNAA 1MN6A 1H42A 4RVUA 4A10A 5ICMA 4BNWA 1LX6A 2RHWA 1CUCA 1U7WA 5FPYA 4CV1A 1TAUA 4CPDA 3V8VA 3AEYA 4BAZA 3WMWA 5JWOA 4IDPA 3QYPA 1JE0A 1G21B 3KVYA 1E2EA 3AERB 4IJ6A 2AXEA 4ZCLA 2D0OB 4CIXA 3Q12A 3DD1A 4Q37A 3L0SA 3DE6X 5LUAA 4TUYF 3GAZA 4EYEA 1AKMA 5K2MA 1MB3A 2M6RA 1UOOA 3O4IA 4KB5A 3C14C 4X9XA 4JV5B 4BQOA 3B82A 1WVMA 3ABRB 3PKZA 3CIFA 4EKGA 3CX4A 2EL9A 1H23A 2DJ5A 4IGIA 1C5KA 4ZZ2A 1LLDA 4WK0B 5THXA 1S9DA 3QI7A 3L4BA 2FVXA 3IBYA 4WKPA 1AK9A 1OI3A 1Z07A 2F67A 2V6JA 3ASUA 1T43A 2GWRA 1A1SA 3O4FA 4M99A 3VH3A 4EPYA 4JBWA 4EKIA 1B2LA 1YBMA 3HJAA 3NCTA 2Q3FA 3MJSA 4XRRA 4DM4A 2ZQ5A 1I30A 3RUAA 3NWPA 4OD0A 3JVIA 4QOFA 2XB4A 3MIZA 2CY0A 3LK7A 5PGMA 1RYEA 5T64A 3AV3A 1NGSA 4OKIA 4NL4H 2KJQA 1O4VA 3OJCA 3PNOA 3QOWA 3LZDA 4QO8A 4EATA 5DFAA 4MQ6A 1WCIA 2H6EA 1BXGB 2O2IA 4O4JF 4UBKA 2CLLB 3KKOA 1YR2A 3SSNA 4ZGWA 3X1KA 5I7VA 2PUCA 3OQ1A 3KTFA 4D5GA 2OWDA 1AJEA 4IOJA 1NN5A 3QH4A 1YZGA 1GCGA 4NZNA 4OHFA 1V96A 3DDUA 3NETA 2X5OA 1VBKA 2MOKA 4MGHA 3RTAA 4O5AA 2XCRB 4LV5B 4L5AA 4IVQA 5IVKA 2V9ZA 6REQB 4PZCA 2WG1A 3KPYA 4B48A 3VJMA 4I36A 4KXLA 2Y71A 3E2IA 1NQOA 2WSBA 4UHJA 3LKDA 4MQBA 4GLJA 4BNHA 2NG1A 3KD2A 3W3AA 4ND3A 2GHQA 3PPVA 2KM1A 5EOVA 1C4OA 4XIGS 4WBXC 5HWSA 4OJTA 3MZ0A 3BL5A 3F5DA 5J1SB 2ZUSA 1I7DA 3SR4A 4KRFA 5KYWB 2D1RA 1FX0A 4IXDA 1H0SA 2F2TA 3OOEA 3W5VA 4EGAA 4F6RB 1DMSA 5JPCA 4QYSA 3TX6A 5JJLA 2BGWA 2V5VA 2I7DA 2H0QA 1JLLA 1LTHR 5IVPA 4RUKA 4XM1A 1PD0A 2P30A 4DCPA 4A0GA 4BXOA 4F2GA 1ZLYA 4XDHA 3ZDAA 4KNVA 1X2BA 1TM7E 2BP7A 5CXXA 2QP4A 1SUSA 4MYSA 3KPVA 2HD4A 2YW9A 3P8ZA 1NXSA 4YXWD 3UXEA 4KNYA 3L7DA 2DKFA 3Q5DA 2QD5A 3BWYA 4KH1A 4BNXA 4KR6A 4CCWA 1KK0A 3AKZA 4N03A 2W58A 1T3ZA 5DHTA 2EZ8A 1ZDMA 3DM9B 3CT4A 4HAIA 2AG1A 1UZAA 2C2WA 3AILA 4N0DA 3TLXA 3C5WP 5HDBB 4BWFB 1FJGB 3M5PA 4PRKA 4TTVA 3QG1A 5BV7A 2P3QA 2O23A 2BWJA 3LHDA 3N75A 5MDHA 4IGFA 5LMCA 3RREA 1L4FA 4OATA 1O97D 2XWBF 4NI5A 2YWEA 4RU1A 1UF9A 3W8FA 3HKEB 2ZXEA 3S7TA 3U40A 1VLQA 4HB0A 4RIIA 3P9SA 5DHUA 1EJ0A 421PA 1VFNA 4BFTA 2JJ2A 1N6LA 4FN5A 2JK0A 3FYDA 4YFYA 3PPYA 4LY0A 4B75A 3LBYA 1XQXA 3M3DA 2C96A 3Q7RA 1TCVA 2XDAA 3CZ9A 4D74A 4KPYA 2V6GA 3H75A 4GMKA 5A7FA 1NJFA 2J7KA 1OXBB 1PLJA 1A9XA 1RQPA 5DM1A 2NQTA 1RKXA 4NZOA 4Y0NA 2X0IA 4TVKA 2I2WA 4WBSA 5EJIA 1KJYA 1PS0A 1Q0LA 2CUTA 1AX9A 3A6EA 4MV5A 1B16A 3EVFA 4RTRA 3RARA 4F11A 3UTCA 1YDWA 2BFFA 1P19A 5E4FA 5K3DA 2DM6A 3VI3B 4UM5A 4NNOA 4PZ0A 3NYIA 4C4RA 2B25A 3AM1A 2R8BA 3EWIA 2P7HA 3AOEC 4WUTA 3UGTA 3UYLA 4L5JA 1UKBA 5LZ7A 4DARA 3M6VA 1I4EB 1YS9A 5LPNA 4DV4B 2EF0A 4RMIA 3ESZA 3Q1LA 3UUWA 5KVQA 3U0VA 3QA9A 4CBVA 2P91A 3NHZA 1VKHA 1S8OA 5HBGA 4JUDX 2PWZA 2C07A 4HDAA