The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
57
|
sequence length |
184
|
structure length |
163
|
Chain Sequence |
GDRFYDLISALHKSVRGSAPDAALYWYARILTAGGDPLYVARRLLAIASEDVGNADPRAMQVALAAWDCFTRVGAYEGERAIAQAIIYLSVAPKSNAVYTAFNTAKQQAKDLPDYDVPPHLRNAPTNLAGENYFPPELKDTQYYFPTNRGMEIQIKEKLERLR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Nucleotide binding protein
|
molecule keywords |
Predicted ATPase
|
publication title |
Crystal structure of the C-terminal fragment of AAA+ATPase from Haemophilus influenzae.
rcsb |
source organism |
Haemophilus influenzae
|
total genus |
57
|
structure length |
163
|
sequence length |
184
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2007-11-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF12002 | MgsA_C | MgsA AAA+ ATPase C terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | post-AAA+ oligomerization domain-like | DNA polymerase III clamp loader subunits, C-terminal domain | ||
Mainly Alpha | Up-down Bundle | Zinc Finger, Delta Prime; domain 3 | Zinc Finger, Delta Prime; domain 3 |
#chains in the Genus database with same CATH superfamily 3GLG B; 3CTD A; 1JR3 E; 3GLF B; 3GLI B; 3GLG A; 2R9G A; 3GLF A; 3GLI A; 2QW6 A; 1XXH B; 1A5T A; 1SXJ E; 1JR3 D; 1JR3 A; 1XXH A; 3U5Z B; 1IQP A; 3ZH9 B; 3GLH E; 1SXJ C; 1SXJ D; 1SXJ B; 3PVS A; 1SXJ A; 2CHV A; 3BGE A; 3GLH B; 3GLG E; 3GLH A; 3GLF E; 2CHQ A; 3GLI E; 3U60 B; 2GNO A; 3U61 B; 1JQJ C; 1XXH E; #chains in the Genus database with same CATH topology 3RC3 A; 3GLG B; 3CTD A; 1JR3 E; 3GLF B; 3GLI B; 3RC8 A; 3GLG A; 2R9G A; 3GLF A; 3GLI A; 2QW6 A; 4CHD A; 1XXH B; 1MW5 A; 1A5T A; 1SXJ E; 1JR3 D; 1JR3 A; 1XXH A; 3U5Z B; 1IQP A; 3ZH9 B; 3U5Z A; 3GLH E; 1SXJ C; 1SXJ D; 1SXJ B; 3PVS A; 1SXJ A; 3BGE A; 2CHV A; 3GLH B; 3GLG E; 3GLH A; 3ES5 A; 3GLF E; 2CHQ A; 3GLI E; 3U60 B; 2GNO A; 3U61 B; 3U60 A; 3U61 A; 1JQJ C; 1XXH E; #chains in the Genus database with same CATH homology 3RC3 A; 3GLG B; 3CTD A; 1JR3 E; 3GLF B; 3GLI B; 3RC8 A; 3GLG A; 2R9G A; 3GLF A; 3GLI A; 2QW6 A; 4CHD A; 1XXH B; 1MW5 A; 1A5T A; 1SXJ E; 1JR3 D; 1JR3 A; 1XXH A; 3U5Z B; 1IQP A; 3ZH9 B; 3U5Z A; 3GLH E; 1SXJ C; 1SXJ D; 1SXJ B; 3PVS A; 1SXJ A; 3BGE A; 2CHV A; 3GLH B; 3GLG E; 3GLH A; 3ES5 A; 3GLF E; 2CHQ A; 3GLI E; 3U60 B; 2GNO A; 3U61 B; 3U60 A; 3U61 A; 1JQJ C; 1XXH E;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...