3BYZA

2-amino-1,3-thiazol-4(5h)-ones as potent and selective 11-hydroxysteroid dehydrogenase type 1 inhibitors
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
258
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title 2-amino-1,3-thiazol-4(5H)-ones as potent and selective 11beta-hydroxysteroid dehydrogenase type 1 inhibitors: enzyme-ligand co-crystal structure and demonstration of pharmacodynamic effects in C57Bl/6 mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 87
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3byzA00
1GQYA 3JQGA 4MVJP 3X2EA 1KEVA 3WMXA 4AFNA 1R0SA 1RKXA 4JGBA 4B4UA 4BO5A 1ZBQA 5I9NA 4B8WA 2B5VA 1PX0A 3AU9A 3V1YA 1CF2O 1LXCA 3V8BA 4XDYA 4BO6A 1FDSA 3WBBA 5U4QA 3I9KA 2HK8A 2W98A 5JXWA 3UKOA 5L3ZA 2EW2A 3GNSA 1SB9A 2UUPA 3PDUA 1P74A 1GU7A 2C7VA 1T25A 1I3KA 3VZSA 3SC6A 1HDXA 2Q50A 1YRLA 1U7TA 3WNQA 2X0NA 1Y9EA 3ONDA 4IPTA 1Y1PA 1L1FA 3O38A 4BNTA 1WDLA 1UP6A 5KJFA 4J9UE 4E12A 4EEZA 1AXEA 3F9IA 3AY3A 1ZH8A 3DHNA 3PXXA 2O3SA 5JDIC 2PGLA 2EKQA 3CKYA 3K31A 1YBMA 1ULUA 2EP5A 4FDAA 3A1NA 1Y81A 2UDPA 4OGWA 3OJLA 1A5ZA 4C7KA 3PEFA 3NTRA 4YACA 5KCZA 5A9TA 3FTPA 1DEHA 2YFQA 4BO2A 5CEEA 3KEQA 2NSDA 2POQX 2VRCD 2NU9A 4K26A 5ITWA 2IXAA 1F14A 2C5AA 3AM5A 5KVCA 3RJ9A 2XF8A 5IDYA 3OJFA 1LDEA 2DAPA 3DQPA 3IQDB 3D64A 1I36A 5ER6A 2O7SA 4FJ0A 4Y67A 2WD7A 5B1YA 3BHJA 1KVTA 3ZDFA 3QE3A 4AG3A 1PSDA 3AUSA 3ADOA 3G1UA 2RAFA 2F00A 4ALMA 4XQCA 2FSSA 2DQ4A 1PS8A 3BIOA 1R66A 3GZNB 5A05A 3LC1O 1VC2A 1E7RA 3NGLA 3NT4A 4XGIA 3TRIA 3JQAB 1JVBA 1E92A 3LZ6A 4BQPA 1C0LA 1G0NA 1LDGA 1NFRA 2QYTA 3GUYA 3PIDA 2FRDA 3ONEA 4IMPA 3JQ9A 4DLAA 5ILOA 3NDRA 1EEHA 3FWNA 3KLPX 4AJPA 4JXKA 5C3MA 1P1JA 1H93A 4CM1A 1M2WA 1E7SA 3CPSA 3P2YA 1D7OA 3INGA 4GVLA 2OBNA 4II3A 5A4DA 3ZWBA 5GZ6A 4Q9NA 5DZSA 3CTMA 5JY6A 1ISJA 3DBLA 4OH1A 1MA0A 1O95A 3GHHA 2NVBA 4TRRA 1PTJA 1E1KA 3S8MA 1HSOA 1F12A 2YV3A 3ZWVA 4NH4A 2QRLA 2OO5A 1SBYA 3IP1A 4E2YA 1KBZA 4ID9A 3ADPA 1UAYA 3D7LA 4MVJI 3VC7A 3JYLA 1K3TA 2V6BA 1W6UA 4R3WA 4PLGA 1PJ3A 4N7RA 1TI7A 1UXKA 1QV7A 1NHWA 1T2DA 2DBVO 3C1AA 3I9LA 3VTZA 3ZNPA 1WZIA 4KQWA 3RIHA 1ADBA 3RKUA 3QLJA 1ZSYA 3L6DA 4WKGA 5BNIA 1JWBB 2OFPA 2X5KO 4A5OA 2V65A 1ADCA 3DOOA 4A73A 1B8PA 1P31A 2EGGA 4J2OA 1K6XA 1LSJA 1VKNA 3RUHA 4DL9A 4LGVA 2J3KA 3DDNA 1N1GA 3ZHYA 3O03A 3BMOA 4CMIB 1JAYA 4U6QA 2XXBA 2A35A 2J5QA 3FTNA 2X6TA 3CMCO 3VZQA 2FR8A 4RF4A 3KYCA 4FPXA 1HE5A 1Y8RA 3QJ5A 1ZK1A 4CQLB 1E3WA 3I5MA 3QVWA 1CWUA 4IINA 3PHLA 5KJEA 1T24A 4D45A 3JD3A 5CG2A 3F6YA 3I4FA 4FBGA 4PLYA 3TNLA 4C4OA 2PKQO 1RJWA 3DZHA 4I9HA 1PJLA 4ND1A 1YDWA 3VZPA 1H6BA 2D3TA 4QSMA 5FWNA 1GD1O 3GVHA 3RBZA 1ZFNA 2JL1A 3A14A 4HFRA 1H94A 1MC4A 1YB1A 3ZW9A 3GVXA 3RD5A 2NVWA 1NQAO 1QYWA 2VZ8A 4R51A 4TVBA 5A3VA 1D8AA 1I8TA 4GAEA 3L4SO 4YJFB 2PA3A 1NBOA 3LDHA 2EERA 2NQ8A 2D0IA 1ZO8A 5L95A 1KETA 3E03A 4G81A 3NV9A 1UJMA 1QLHA 2EJVA 1MC5A 3F1KA 1ZK2A 3E1KA 2PNFA 1E3JA 2DBQA 1BSVA 4PZCA 5BNTA 5K6AA 2DPHA 4GMFA 4E4YA 1XR3A 2NU8A 2ZB4A 4OSPA 4XDZA 4OIMA 2ZKLA 4R9RA 1KEPA 1FDWA 4R69A 2C54A 2D8AA 1E3WB 1Q1NA 1ZEJA 2P5UA 4GQAA 1YL6A 1GYPA 3U49A 4B4WA 1ADFA 1ARZA 3HHPA 4DQVA 5CAEA 2LDXA 5DN9A 3NX4A 1PL7A 3DZKA 4BMNA 5TLSA 4N18A 2P68A 3K73O 4EUEA 2B69A 3JQ8B 1H0KA 1L7DA 1MG0A 2Y05A 2GNAA 3I1JA 1HRDA 2Q4BA 1GTMA 1R15A 2WE8A 4RVHA 1J4AA 4YVFA 1IYZA 1NP3A 1QG6A 2UVDA 5IZCC 4CODB 2ZTUA 3HB4X 3V2UA 2DKNA 4MVJH 1ZXBA 3DWFA 4IDBA 5TNXA 1U2DA 1WPQA 5DF1A 4FC7A 4MP8A 1QSGA 1XKQA 3IP3A 1X7GA 4FR5A 3NJ4A 3H4VA 4UUNA 3F5SA 4IGFA 3QW2A 1B8VA 2Y1CA 4R01A 5T67A 5L9AA 1K6JA 1SEVA 4L73A 3GG2A 3JD0A 5IXSA 4UVEA 4XZ3A 3WFIA 2VCYA 3JCZA 5K9ZA 1U4OA 1MG5A 2PZKA 3D5QA 4DPMA 4J4HA 3MJTA 3GVIA 1PJCA 4FGWA 4XX0A 2VTEA 2C7GA 1DAOA 2AXQA 3Q0EA 3ZWOA 3L6EA 3H2SA 4CV3A 2QIOA 4GLOA 1NQTA 1UDAA 4YQZA 2VRBA 5DOZA 1I10A 2W90A 5IDXA 1MUUA 2Z5LA 4RPLA 2O48X 4P4GA 2RIRA 3RU7A 1PQWA 5IXYA 5JYDA 5TJHA 5KWEA 1JLLA 3DOCA 3WTCA 3S2IA 3ULKA 3V5NA 1G6KA 4N5LA 5BR7A 2GYYA 4E32A 1B7GO 2GO1A 1WMBA 3PZBA 1I33A 4TROA 5EERA 2GGSA 1H6DA 1IOLA 4L0QA 5G0VA 1FK8A 4CM3A 2BH9A 3D4NA 4PGFA 3GGGA 3WR5A 1NNUA 2O3TA 5CG1A 2RBEA 4MVJG 1YB5A 4BQRA 4JK3A 3DONA 1H5QA 1EUDA 1B8UA 2VTDA 4PFJA 1BXZA 5EESA 1X0XA 2VYVA 4NI5A 1VL8A 4FGSA 1P45A 3I6IA 3UFXA 3LQFA 4WNCA 1E6EA 4NU5A 3RVDA 4DBVO 1DSSG 1VI2A 3ROQA 3VVCA 1B15A 3O8QA 4BO8A 3ICCA 4MKZA 3EGOA 3BMNA 3Q2IA 1YJQA 1DHRA 4D46A 4D79A 5KKCA 3KSDO 4GMGA 4EITA 1ONNA 4LMPA 2OP0A 4DQXA 3BHIA 1Y7TA 1LJ8A 3RFVA 3WGTA 5DP2A 1P3DA 1OAAA 5IG2A 4CMJA 1NFFA 4BNWA 1CQIA 4J0EA 3V1TC 4RVDA 4NDNE 1GUZA 1PS9A 4CPDA 5K6AC 4YA6A 1K0UA 3OQ6A 2TMGA 4IDAA 3VHRA 4RZHA 3ROMA 1U3UA 2PKQP 3BHMA 3BAZA 4Y6SA 2Y1GA 3HQ4O 4GVXA 3QY9A 2V7PA 3V2HA 2W2LA 2J8ZA 2ZYDA 3GT0A 3U4HA 4J43A 4E6PA 2AEMA 4CQMB 2G5CA 5ILGA 1WP4A 3PFFA 1U3WA 3D5TA 4O1MA 1XQ1A 3HFGA 1Q0QA 3IAHA 4RQTA 4YDRA 3NTQA 4XYMA 1ZNQO 1JTVA 4H3VA 1KC3A 4EJ0A 3QVXA 1YONA 1ONOA 1XCBA 1Z7BA 4AJEA 3MJEA 4M49A 1PU2A 3UN1A 3TOXA 5I7SA 3C1TA 4DGSA 4DXHA 1GZ6A 3GEGA 1QMGA 2JFFA 3C7CB 2NM0A 3IKVA 2ET6A 4W99A 8ADHA 1DBVO 1V35A 1NFQA 2CSUA 5CDUA 2ZB8A 4Y6PA 1MV8A 1G1AA 1YBVA 2AE2A 3OA0A 1HYEA 4KTTE 4NMHA 5B4TA 3CSDA 4O0LA 3L4BA 4ITUA 3DO5A 1M76A 3MJCA 4BV9A 4WECA 3PHGA 4ND4A 1NQ5A 1N9GB 4MVJA 2RHCA 4OAQA 4JBIA 4B8ZA 4BOYA 4AJ1A 3JQEA 1IB6A 1UZLA 3HSKA 1M66A 3C1OA 4IDGA 4MVJE 4QO7A 1ZJZA 4ALKA 3IUPA 4DWVA 2FHSA 5BNFA 4NBRA 5K0ZA 4WLOA 2JCVA 1LRLA 5F1PA 4W6ZA 1EZ4A 4BNNA 4DYVA 1W4ZA 1DAPA 1EMDA 2YW9A 1F8FA 3GDFA 5KVVA 1BMDA 1EDZA 1VKOA 4FB5A 4GBJA 5I7VA 4E2XA 5C37A 3BTUA 1LLQA 4BHTA 4XRGA 3DBHA 3IJRA 3ANLA 4YR9A 4H16A 4J3FA 3M2TA 3RAJA 1EFKA 3EMKA 4XGNA 4GI2A 5JW6A 1NXQA 5AXCA 4RVFA 1X13A 4J0FA 5A03A 2X5JO 2CFCA 2HK9A 2IZ1A 3WIDA 4E0BA 3E82A 1HKUA 3JQAD 4BO9A 4Z0PA 1H6AA 4PZDA 4QX6A 4OO3A 2VWPA 1YQXA 1UAGA 2PR2A 4YT5A 1W0CA 1ZMTA 2B35A 5A9RA 2VNAA 4CR7A 3U4IA 3L6OO 3PZRA 1SEPA 2O23A 3L0DA 5C7LO 1X7DA 2Y1FA 4Y9DA 5HRUA 4BB6A 3SJUA 1TB4A 3KZVA 7MDHA 2W2KB 3FNFA 4NK5A 4X54A 4Y98A 5B37A 3BXXA 2J5KA 1JDJA 1IE3A 1LC0A 3B1KA 2VHXA 2AE1A 4WCFB 1R4MB 1X1TA 2BFPA 3PWZA 4BNLA 2HMUA 2CVZA 3M2PA 3T4XA 3VDRA 2J3IA 3E9NA 4TMFA 3OETA 2PLAA 3KSUA 1NVTA 1PWZA 1J5PA 1U1IA 1KC1A 1LLCA 4NQZA 5F3RA 5FF9A 2GN6A 3GDGA 2YQ4A 3OMLA 1E1NA 3PI7A 5AOVA 9LDTA 1AE1A 1PZGA 4BIIA 4YAIA 1Z82A 1UP7A 4GKVA 5I9LA 2YV2A 3JQAA 3H9GA 1DFHA 4HUJA 3RUAA 4B3IA 1E77A 4J90A 4UEJA 1SMKA 3JQGB 4DC0A 4MKXA 3L9XA 1WVGA 1E7QA 2O7QA 3BTSA 4HNHA 2B0JA 3H5AA 4YRAA 3SLGA 1QYVA 1XHLA 2I66A 1GQQA 3JQBA 1GPJA 4E2ZA 1YGYA 4E5MA 5H81A 2H5LA 3DAFA 2ZYGA 2IEDA 4WLEA 3WYBA 4B4VA 3JSAA 4D0RA 4MIOA 2Y93A 5KTKA 2I9PA 4QO8A 4WJZA 3NUGA 2YZ7A 3OQ1A 4ZQHA 1EE9A 1ISFA 3W1VA 1XIVA 3RC9A 3DAGA 2OP1A 4ZQFA 3TZHA 3ZHZA 1F8GA 1W8DA 2GN4A 3OQBA 5L53A 4N5MA 3EYWA 4CM8B 4HP8A 3E5MA 4YT8A 4DQUA 4TZTA 3H7AA 4J9VA 4BKOA 4OL9A 2G82A 1P33A 1ISIA 2VWGA 2PZLA 3ZWNA 3QWBA 2W2KA 3C8MA 1DC6A 3W4KA 1GDHA 2JFGA 4IJUA 4E2WA 2WD8A 3BMOB 1T1RA 3ETDA 2G0TA 5MGBA 4I9NA 3OM9A 2J3JA 4KDFA 1TT5B 2H9IA 4OMUA 1OC2A 3JD2A 4BNXA 4A7PA 3WIEA 5B4UA 9LDBA 3RUEA 1RYDA 1DLIA 1BVUA 3CUKA 2DPGA 4J6FA 1EDOA 2GZ2A 4KOAA 3WJ7A 2PK3A 5KJCA 3QP9A 4XD2A 4WNIA 3RUCA 3G49A 4WLFA 3GLQA 1DPGA 3ASUA 3KSZO 4XCVA 4B7XA 3SC4A 3NRCA 5EQDA 4S3MA 1PQUA 4HBGA 4R1NA 1GCUA 5ENVA 5LDHA 2B4TO 3OEYA 2D2IA 1NVMB 3JQ9C 5L7TA 2FPGA 4HV4A 3R3JA 4I5DA 1HSZA 5CDTA 5JNLA 2EJWA 4M54A 4KUHA 5IN5A 3B6ZA 1Z6ZA 4E21A 1IHXA 3UHAA 1UXIA 4EJ6A 1DIAA 3DMTA 1Y6JA 4W9NA 3QA9A 3JYPA 3WGOA 2VYNA 4DA9A 4CLRB 1QXSA 4EYEA 3H5NA 4PG4A 3T7CA 3D3WB 2Y66A 3I83A 3QSGA 3W6UA 1I5RA 4ZVVA 1XYGA 2D5AA 4LSWA 3EAGA 3ST7A 4E5PA 2V6FA 3JYOA 2BF7A 2DTEA 3DZFA 4I5FA 2I3AA 2Q1WA 1P1KA 3ZN2A 1YH3A 4DBZA 3I4CA 5JDIA 1HF3A 4R5HA 3WICA 3PK0A 2ZB7A 2QG4A 1DB3A 3DZGA 3D4PA 2G1UA 4R9SA 4RPJA 2Q2WA 4RQUA 1B14A 5KNLA 4OHUA 4OSOA 3GK3A 1MGOA 3ZV5A 4NFHA 4XQEA 1RM5A 4WK6A 2Z1NA 5F1OA 1E3EA 5TQVA 3PRJA 3WSVA 3NAQA 4WASA 4C7JA 4WLUA 3NT2A 2VUUA 4R16A 3PP8A 4IY1A 4O6VA 1PR3A 4TVOA 2CVQA 1PJ2A 4B79A 3L77A 2I6TA 1I2BA 1LI4A 1B16A 4JNKA 2X23A 4BO4A 1RPNA 3LC7O 1BGVA 4Q39A 3WX0A 1C0KA 4KZPA 3TFQA 5A04A 1SC6A 2QZ9A 3PWKA 4O63O 4S1VA 4YAEA 1P1FA 3ICPA 2QQ5A 3LLSA 4ZRMA 3IKTA 3VH3A 4L4RA 5DBGA 4RDHA 5I9MA 3DFUA 3QV1A 2VHVA 4YT4A 3CH6A 4EUFA 3PQDA 2HAEA 5DCUA 2EW8A 3ZWYA 4TRNA 1DO8A 3KTDA 1U9JA 2Q45A 2OOSA 4IQGA 1L7EA 4F46A 1FDTA 2O3RA 3WWYA 4AICA 4LVUA 4I5GA 1KVUA 4ZQEA 3A9WA 1D1SA 5G4KB 4XYGA 3F4BA 1ZXLA 3DTYA 2AHRA 4CLRA 1GEGA 3A4VA 5JAQA 1DIRA 1LA2A 2FZWA 4CMIA 1HZJA 5GZ3A 2WDZA 5L7WA 2NNLD 4ZGWA 3FCOA 4FQ8A 2NTJA 2BI8A 1CDOA 1IULA 2GRAA 3ROPA 3S2GA 3NTOA 2B4QA 1ONPA 4MIYA 4BNMA 4AJKA 3GN2A 1XU9A 1WAMA 4XIYA 4WEOA 4W82A 1IL0A 1Q7BA 3COSA 4CLOB 2VHYA 3SVTA 3FWZA 4JIGA 3HFSA 5THKA 3L4BC 4WE3A 4BNYA 4G65A 3ONFA 2R2GA 3KRTA 3GVCA 1R0KA 3AOGA 4J7UA 2X9NA 3UOGA 4ZJUA 4W9NC 1DJNA 2FPPA 1W73A 2JJYA 3CXRA 1DRWA 1QYCA 3ZWWA 3B20A 3DC2A 3OIFA 3U4CA 2ZQYA 4E5YA 5L45A 3ZWXA 4XKJA 4BNZA 1A4UA 1K5HA 3ANMA 4YJGA 1VJ1A 1YDEA 5LC1A 1HEUA 1PWXA 1KIFA 3L07A 2C5EA 3K92A 2R00C 4Q3AA 1P77A 4ZICA 2VHZA 1LLUA 3GNQA 1TT5A 2WYWA 4L75A 1ZIDA 1X15A 3AU8A 2X4GA 2JFHA 1JWAB 2X7HA 5CEJA 5CPBA 2E48A 1C0PA 1VL0A 2Y67A 4IJVA 2P4QA 5JPIA 2YDXA 4GLLA 2UAGA 2NU7A 1UH5A 5BSEA 4OXYA 2O3QA 3GFBA 5AVOA 3ZWMA 2ZCVA 3C85A 1QKIA 3NDIA 3PJGA 4TKMA 4WCFC 1GFSA 4QT0A 1P1RA 2Q4EA 3AI1A 4XJSA 1V0JA 4IDEA 1PJBA 3WB9A 3I9JA 1E3SA 3E48A 3H3FA 1SB8A 2IE0A 5C7OO 1BXKA 5GMOA 4NU6A 3D1LA 2O50A 2DLDA 1TXGA 2YQ5A 5IFLA 2G76A 2WD7B 4OOFA 4TKLA 1HETA 2IXBA 3TSCA 1O94A 2QRJA 3OFSA 4MINA 2NQTA 1PS0A 4KDEA 5JSFA 3WG9A 1H9BA 4XA8A 1NYTA 1RM0A 4JBGA 1E5LA 2RHRA 4ONEA 4N5NA 1QYXA 3JQ8A 1C1XB 2GR9A 5EL0A 3GEDA 5L4LA 1UZNA 4HKTA 4R1SA 2ZK7A 2GF2A 2HMWA 1R4MA 2CDBA 3P5SA 4XYLA 4CM9D 4MIEA 2NVUA 1AHHA 3E5RA 4WOJA 3HZZA 4EUHA 3ENNA 4KMSA 4FD3A 3IS3A 3WLEA 3KO8A 1KY5A 1LSSA 2C07A 5G4KA 3VPHA 3KETA 1I24A 4J1TA 3U4DA 4CMEA 3WFJA 4CM4B 4JLWA 3K2EA 5FFFA 1WLYA 4IDDA 1P0FA 3WQRA 1HE2A 3WXBA 5KOIA 2Q2VA 1VSVA 3UUWA 3EVNA 1BRMA 4NBUA 5H83A 1T26A 3H9JA 3KV3O 5EINA 4CR8A 1HDYA 4E13A 3BYZA 4BVAA 1GUYA 1PZFA 4YYZA 4GWKA 1UP4A 2I3GA 2BGLA 5DDIP 4ND3A 1ZSNA 2FR0A 3G17A 3KLMX 1A71A 4FS3A 2YHUA 3HWRA 3B70A 3K96A 5HBRA 1E1LA 4I08A 4YTEA 4BV8A 2BFMA 1GV1A 3RSHA 3LT4A 4FFOA 4RLSA 4YXFA 3GMSA 3DHYA 1AUPA 1XDWA 4UUPA 3PGJA 4AJLA 3OJOA 2WYVA 2Z95A 2C0CA 4ALNA 5F1KA 4EZBA 3R6DA 3Q2KA 4PG8A 1ZCJA 3IOYA 4O5OA 4KWHA 4BNJA 2ZYAA 5KVSA 2R00A 4E31A 1NVGA 3I6QA 2EF1A 4IXTA 4BMSA 2ZJ1A 4HWKA 1T1SA 2AG5A 1KEWA 2EEZA 2P5YA 2VOJA 3GG9A 1ZW1A 4DPKA 3GN1A 1P44A 3GGPA 3ORFA 1BXGB 4OKIA 2HKIA 5DP1A 4JBHA 1YL5A 1E3IA 4W4TA 2HUNA 5HS4A 4Z9FA 4PZEA 5MDHA 1NPDA 4RF3A 1OI7A 2AQIA 4LW8A 1DRUA 2DVMA 3RKRA 3N58A 3ZU4A 5I8WA 2HMTA 3RUDA 4DREA 4U6SA 2PH3A 4UREA 4PLHA 4K6CA 3KVOA 5A1TA 1SNYA 5ADHA 3DL2A 1PQPA 1OOEA 2YFHA 3S1LA 3WYEA 1LDBA 4IZIA 2VWHA 3HB5X 4FFRA 2DBRA 2D4AA 3OP4A 1NPTO 1OBFO 3BA1A 3KM0A 3WGIA 3GRPA 5C7IO 1KVQA 1IHYA 1DXYA 3GFGA 3M1AA 5A5EA 3LVFO 4FCCA 4J16A 5JCXA 4IZHA 4YAKA 5JC1A 2HMSA 1A72A 2JAHA 4QECA 1R4NA 3Q1LA 1V6AA 3EUWA 3PYXA 2NLOA 3KYCB 2Q49A 4J2HA 1BW9A 3HG7A 3CEAA 2PGDA 1JN0A 4U0JA 4F45A 2HSDA 2PD4A 4BNFA 4EI2A 2TMDA 4NG5A 1T2EA 5C5IA 5IZCA 1WNTA 1PJQA 3GUCA 4GKBA 1ZK4A 3K6JA 1S7CA 4JJFA 1U3VA 3NDJA 5CFZA 1P0CA 4DRYA 1AXGA 1UDCA 2OORA 1U2GA 1KOLA 5JAMA 3AFMA 3P7MA 1JU9A 2PZMA 2BKAA 3ROKA 1HLDA 4CL8A 3ZHXA 1LSOA 2PD6A 3JTMA 4D42A 3ENKA 4J49A 3TZCA 4CQMA 4E5KA 2YV1A 3OIDA 1A7KA 1XQ6A 3GY0A 2NTNA 1WWKA 4BGVA 3IL2A 3PQFA 4ALJA 4RVGA 3A28A 1U4SA 3RBVA 1HLPA 1ISMA 3WTBA 7ADHA 3H9EO 1LDNA 4GX1A 2FWMX 3CINA 2H1SA 2X8LA 1CEQA 1DHTA 2IYPA 2GD1O 1TLTA 2PWZA 4IDCA 1CETA 3EZLA 5KIAA 2DU8A 4MO2A 1IY8A 4CM9A 3R1IA 2QYSA 5TSDA 3E18A 3ZU3A 3MOIA 2RCYA 5T8KC 2EIHA 3TZ6A 1T2CA 2PY6A 4NZ9A 5JO0A 4B4OA 2IYOA 3INTA 3RCBA 2QW8A 1U7HA 1HL3A 4AJOA 4DTIA 5JYEA 1F17A 1U8XX 1KEUA 5TF4A 5I8ZA 4YJHA 3I23A 3P19A 2Y0CA 4JP3A 1DOHA 4DIBA 1A27A 2JHFA 3Q3CA 1PZHA 4LRTB 4K9DA 4NIMA 3PYLA 4P38A 3M6IA 4XYBA 3AI3A 1HWYA 1LQTA 2XPCA 4A10A 3GPIA 4HNGA 2ZB3A 4YWJA 4CJXA 1B3RA 3TWOA 2VZ0A 4UULA 3ASVA 3RI3A 1DFIA 5JBIA 1E5QA 1I3LA 4FC6A 3DB2A 3RC2A 1Q7GA 3QWHA 4CMBA 3QWAA 3AFNA 3AW9A 3FBGA 4PLZA 4GSKA 3CE6A 4PVCA 4ZRNA 2DBZA 2ZATA 1HDOA 3D4OA 5JCJD 1N5DA 2BD0A 1RYEA 3ZWCA 5FI5A 5JAZA 3L9WA 3DMYA 2Q3EA 3OEWA 4QQRA 4K6FA 4BNHA 1MB4A 2OMEA 4MP6A 3O8QB 4UAGA 3ZU5A 4Y6RA 4R5MA 3TL3A 1YXMA 2PTGA 5COAA 4YJGB 1EVIA 4GGPA 1I01A 4BO1A 2WWRA 3S55A 1OMOA 1IPFA 3OSUA 3GC6A 1Z7EA 1D3AA 5DCWA 2Z1MA 1KVSA 1DLJA 3VDQA 1D1TA 3LLVA 1DJQA 3MOGA 3V1UA 3WGHA 1HT0A 4R41A 5L4NA 3UCFA 1YWGO 1KYQA 2YUTA 4WUVA 1BVRA 3PDJA 4M86A 1E1MA 4YEDA 1BWSA 3VOSA 1XGKA 4UVHA 4IXWA 2NU6A 4WPGA 1X14A 3K9QO 3TOZA 2Y0DA 1H9AA 3IJPA 5JFOA 2HMVA 1IUKA 1Z45A 2D5CA 3UICA 5HWSA 5KKAA 3PLNA 1LC3A 1T4BA 2I76A 4B3JA 5I7FA 2JD0A 4AJJA 4I5EA 3E9MA 3AI2A 1CYDA 1I30A 1V8BA 3BMQB 3GAZA 4M87A 3ITDA 4M1QA 4RLHA 2DUUA 4AJIA 1O6ZA 1S6YA 2VWQA 5ENDA 4BO3A 1FF9A 2BLLA 4JROA 4PRLA 1B26A 5JMWA 1CJCA 1XG5A 3JQFA 4WLNA 1QRRA 4ROSA 2O4UX 4Q3EA 4D7AA 2PGJA 1LNQA 3GF4A 1SAYA 3EHEA 4MJLA 4MVJD 5CDSA 1YBAA 1B2LA 4MOWA 1U5AA 3PJFA 4FOSA 2Q46A 5KVQA 5BSGA 1E0DA 2QX7A 1K6IA 2XOXA 5CDYA 2EWMA 4F6LA 1H2HA 5HTOA 4P22A 4CV1A 2PH5A 4Y8VA 3ANNA 3UCEA 3F46A 1DC5A 4DLBA 4OQYA 3PHHA 1R6DA 3G1TA 3ZV4A 4QFDA 2AG8A 1D4FA 3FBTA 3PJDA 4UVIA 4YBZA 4CLOA 4L8VA 4PLCA 1OZAA 3BMCB 3W8DA 3JYNA 3HN2A 1FMCA 5BT9A 4W7HA 1V3TA 3F4LA 4YT2A 4II2A 1ZKMA 1UXJA 4CMKA 1C3VA 3ON5A 1SOVA 4MP3A 5EN4A 1GPDG 3W8FA 3TDKA 3GZ4A 5HS6A 4RCVA 1N8KA 1FXSA 2YHIB 5G0WA 4A0SA 4W7IA 1PGJA 2D59A 3TF5A 1ZMOA 2HQ1A 3GNTA 2GCGA 1H2BA 2VUSA 5DBFA 4J91A 4TRJA 3ZNOA 1EVYA 4CM4A 4G5HA 5IAAA 3UGKA 1EBFA 5IF3A 2HU2A 2NADA 3HNPA 3WJAA 1Q2XA 1TVEA 1LU9A 1NWHA 4PRKA 4YPOA 1GR0A 1K89A 4A27A 4B7CA 1FJHA 3FNHA 2BFAA 4IJKA 4MVJF 3I52A 1M75A 5JO9A 5ICSA 1EVJA 1MFZA 1V9LA 3EW7A 4WCDA 5KJ6A 2CUKA 2FMUA 3MTJA 1U3TA 1C1XA 4CL3A 1B3BA 1U5CA 5TT0A 1YKFA 4TSKA 5FYDA 1J49A 2WEKA 4Q3DA 5ICMA 4IBOA 1O5IA 4E30A 2VOEA 4J4BA 3WGGA 2XXJA 1DC3A 3AUTA 4OQZA 2DTXA 4DIOA 3EY4A 1KS9A 3KEOA 3PFWO 3ZNNA 2JKVA 3FD8A 4JCOA 3KYDA 4AVYA 2GZ3A 3HN7A 3WSWA 4IS3A 4D3SA 3IDSA 4PLVA 4OM8A 2X9GA 4BKPA 3FI9A 3GVPA 2PFGA 5AXAA 4EEXA 4BKRA 3W6ZA 1ADGA 2C59A 1HE4A 3PHIA 4G2NA 4EW6A 5JDCA 1ENZA 4ZA2A 4LRSB 2WJPA 1LSUA 1ZZEA 2Q1UA 2X0RA 4RPGA 1M6HA 1R4NB 2CDCA 2H63A 3ZNQA 4XRRA 1RM3A 4Z3KA 4RF5A 2I67A 1QP8A 3E8XA 3TPCA 3RU9A 1EFLA 2HCTA 2P4HX 4LSMA 3GEMA 1R0LA 4H15A 4GPD1 2PV7A 3QIVA 4BGUA 4Q3CA 1LDYA 4JQCA 1MXHA 3TQHA 3U0BA 1Y5MA 4OJNA 4QUKA 4RDIA 3NGXA 3GGOA 1E7YA 4D3DA 1A9YA 4B7UA 4PLWA 1DIBA 2I65A 3FNGA 4PLFA 3HDQA 4R54A 3VAZA 1WXDA 3I9MA 2WMDA 1XEAA 2ZIZA 3OJEA 3HDHA 1Y8QB 2JCYA 2VZ9A 1K2WA 2PZJA 3RFTA 1EUZA 3GAFA 4CUKA 2V6GA 4NHEA 2AQ8A 3I9OA 4XQ9A 4Z0HO 3KHUA 3LK7A 1LEHA 3QHAA 1LDMA 1P1HA 4CLEA 4OXKA 2AQKA 3VZRA 1YJ8A 4LK3A 3OBBA 4Q3BA 5EPOA 5U1PA 4DLLA 3SBOA 3WWZA 5KJ1A 4R68A 5J23A 1E7WA 1WZEA 8LDHA 1YQDA 2OBYA 4NNJA 1Y5RA 2VYND 3VKVA 4NBTA 2AEJA 4BGIA 4BGEA 3CZRA 1PJSA 5T8KA 1BG6A 3PHJA 2AW5A 3RC7A 5BQFA 1CQJA 5A3JA 1SO8A 4BNVA 2AQHA 3LU1A 3RQSA 4GX0A 1BDBA 1I2ZA 2BI7A 3TZQA 1ZJYA 4I9UA 4I1IA 3WLFA 2X0JA 2WYUA 4RZIA 4NJMA 1LX6A 1Y8RB 3DZIA 5G0TA 3MTGA 3PPIA 4GX5A 4XYEA 5G4LA 3IUSA 3FSRA 2H6EA 1LQUA 4AL4A 3FR8A 3S2EA 3I9NA 1JW9B 1C1DA 3ETGA 1HXHA 3PYMA 2X9VA 5H82A 3T4EA 2W8ZA 1WMAA 1HDGO 4AJ4A 1I2CA 2BGMA 3WYCA 1LBEA 3WGYA 1EBUA 2YHIA 1FDVA 5COBA 4M89A 1ZUD1 5A06A 4ZU3A 2NVUB 3ZGYA 2FP4A 3BZUA 3DR3A 3DBRA 3K5PA 4DC1A 5A5FA 1VE9A 2Y0EA 3BMCA 4UEKA 3AOEA 1GY8A 3FPLA 1XSEA 1R16A 4Z3DA 5B4VA 3CIFA 3FRJA 3NKLA 2WE7A 5DCYA 2GZ1A 4OYRA 4DUPA 2Q1SA 4HFNA 4N54A 5F21A 4WOKA 5TS3A 3FN4A 5THQA 1HYGA 3FPCA 4RVUA 1BXGA 3RUFA 1GV0A 1ENYA 4XWYA 4CLHA 1WW8A 4GSLA 1NQOA 1TEHA 4ZQBA 1UDBA 4L9RA 1GZ3A 1PEDA 2NV6A 2E6UX 2HJSA 5IDQA 4RPKA 4YB8A 4CMEC 5JY1A 3KB6A 1MX3A 2IZ0A 4UVDA 5GY7A 3MCVA 3OIGA 3AJRA 3HJAA 5T64A 2GN9A 3JQ7B 4CV2A 1Z74A 4RF2A 4ND5A 4FW8A 3X2FA 3RJ5A 1N2SA 1PR9A 4CMCA 1GAEO 3ZH2A 2RH8A 4ZQGA 5G0UA 2ZJ0A 3VH1A 1J6UA 4TWRA 1HTBA 1JQBA 3D0OA 3MEQA 3O26A 2HLPA 4DYDA 2ZQZA 2CZCA 6LDHA 4UUMA 2Y1DA 4LVCA 1DRVA 4XEHA 5DOVA 1VRWA 2E82A 1IPEA 4FFMA 4WLVA 1EUCA 2A94A 4Q3NA 5IN4A 1VSUA 4PN3A 5U9CA 1SZJG 1KY4A 1YOVA 5CPFA 3SXPA 5JAIA 1MP0A 5TIIA 2VHWA 1X7HA 3KYBA 3KYDB 3F3SA 3S2FA 3RROA 4HFMA 3DOJA 4GGOA 1YVEI 1E3LA 2CDAA 4HX5A 2E49A 4NBWA 4CUZA 1GADO 4FFNA 1F06A 4CQLA 1PJ4A 3TN7A 4RL6A 3OJ0A 2EXXA 1J0XO 3ABIA 3C3XA 2WTBA 3EK2A 4BUCA 1NR1A 1SPXA 4KUGA 3K8ZA 1JKJA 1V3VA 2X58A 2ZCUA 3EC7A 1CIVA 1JKFA 2FPIA 1QV6A 1DC4A 3PQEA 5L4SA 3MWDB 1TT7A 3A06A 1N7HA 4MPDA 2IEBA 3WS7A 1OC4A 2C20A 3U5TA 1JVSA 4ZD6A 4J1QA 4PLPA 4IM7A 2BHLA 5COQA 4L4XA 3N7UA 1PL6A 3F47A 4FN4A 4D41A 4AJHA 3ZWPA 2CNBA 3MWEB 4HXYA 4NK4A 2VN8A 2YY7A 4YJFA 4O59O 4NFSA 2R6JA 4RO0A 4FFPA 3DHEA 3G0OA 4JJIA 1RWBA 1BTOA 1HYHA 4IIUA 4ALLA 4BO7A 4FSHA 5ITVA 4LCEA 5L7YA 1ISGA 4J4TA 1M67A 3U3XA 3H9QA 2E4AA 1N92A 1EQ2A 5AYVA 4YQYA 4CMAA 4BS9A 1CERA 2BRUA 1HZZA 2X0IA 4E3ZA 4IQ0A 4YAJA 3OH8A 1EVZA 3IIEA 4FIZA 3RASA 2ILTA 2HRZA 4D43A 3PGXA 4YJHB 1I0ZA 4L74A 2P91A 3MJ4A 2EKLA 4DMMA 2SCUA 5T57A 3GRKA 4RVSA 3HUDA 4XIJA 3TFOA 5A02A 3VPFA 2GN8A 3LT2A 3WQQA 1Q0LA 3K2BA 1KERA 3UCXA 2X5OA 4RPHA 4XR9A 3SLKA 1LTHR 5TRTA 3WNVA 4CM8A 4A03A 3VPGA 4LN1A 5TJ9A 3OHSX 4IIVA 2CD9A 4CMHA 4IJWA 4EBFA 2B37A 1UUFA 1NASA 3UF0A 2OUIA 3PJEA 3GQVA 3TJRA 4U5QA 2P9CA 2Y99A 4MDHA 1VLLA 3GH3A 4D3FA 3IMFA 4HY3A 4P8RA 1LLDA 4J1NA 3RC1A 2G17A 3GPDG 2V6MA 2YYYA 4HFJA 4KTVE 4CLXA 2FSVA 2FN7A 4A26A 3PVZA 2DTDA 4Z9YA 4CLDA 4CM7A 1RM4A 1NM5A 3DZJA 4LMRA 1UZMA 1YL7A 3UH1A 2EHDA 1JAXA 2A92A 3ZI0A 3AWDA 5LDGA 2VQ3A 2HDHA 5AQ1A 4PIVA 2CY0A 5HM8A 3RBXA 1NHGA 3H6KA 3KUXA 1PGQA 1E6UA 1VPDA 1YE3A 3GHYA 5F5LA 2P9GA 5CHEA 4EJMA 2GLXA 3MJSA 1Z75A 3W8EA 1NPYA 1H6CA 3UW3A 1EK6A 3NYWA 4CR6A 4YCAA 1LRJA 3JQBC 4OOEA 4CM5A 1Q0HA 3HDYA 3H9UA 2O2YA 1TA4A 3SEFA 3G79A 4XGKA 5IDWA 1ULSA 3H65A 1KVRA 5JDCC 4NPCA 1NR7A 1PGOA 3DMTC 3GDOA 4WCFA 3Q9NA 2EKPA 3VKUA 1T4DA 1ML3A 2JHGA 4BKUA 1YS4A 4HADA 5HA5A 1HDRA 1VL6A 4ND2A 3ZHBA 2VT2A 2I99A 4BNGA 2C2XA 2JD1A 2NWQA 3ZW8A 5BSFA 1N9GA 4M8SA 3D3EA 2OGUA 3INRA 3LF1A 3Q6IA 2VT3A 3OECA 3Q11A 4IUYA 4PG5A 3BTOA 4URFA 4P4NA 2YDYA 3BMNB 3QVOA 3K30A 4IGEA 4KP7A 3TL2A 2IDZA 5JC8A 1EQUA 4J1SA 3QQPA 5A9SA 3HADA 2DFDA 5I7EA 3MJVA 1P9LA 2VYVD 3TZKA 5B12A 3LC2O 2BGKA 3B1JA 4LISA 5ER9A 4NJMB 3VPXA 2Y68A 1P1IA 1YQGA 4FOOA 3ZV6A 4AJ2A 3JD4A 4JX8A 4BNUA 1PL8A 2IODA 3DXFA 2EGHA 3DZBA 3ITKA 2FY8A 4U7WA 2P9EA 2ZTVA 1DIGA 4CMGA 1YO6A 3GOHA 2QRKA 2QHXA 4CV0A 1XA0A 3NEPX 5IJZA 3FF4A 3OA2A 5DT9A 2W4QA 2PKRA 3LF2A 4ALIA 2GSDA 2OZPA 3HE3A 4R1UA 3DTTA 1E7MA 2VUTA 3M1LA 1T2FA 2CVOA 3IC5A 2DUWA 4QTZA 2OL4A 4EGFA 3E6AA 2B4RO 2EP7A 4P4LA 4Z0TA 3T7EA 1O0SA 3P2OA 3QRWA 5FEUA 4ESOA 3BMQA 3DAPA 1JKIA 1VJ0A 2E37A 3WMWA 2FOIA 4DPLA 4QXMA 3HDJA 4IQ8A 3H3JA 3AOEC 1OFGA 5LCXA 2UUOA 1DIHA 5A9SB 3QWFA 2Y1EA 1X1EA 2O3UA 3Q9UA 4ILKA 2AA3A 2I5PO 1I32A 3O9ZA 3NT5A 4NR0A 1N1EA 3F1LA 3WOHA 4ZHSA 1ZEMA 1PGNA 2UYYA 4Z6KA 4INAA 1IZ9A 4R3NA 4B3HA 1WDMA 2VNSA 4I8XA 3ZU2A 1ENPA 1XELA 3O4RA 3EZYA 1I3MA 2BELA 3DBLB 4BNIA 2HRBA 4GWGA 3LSYA 1MFPA 3JV7A 5DBIA 1PIWA 2O3JA 2F1KA 4PG6A 4QEDA 1B0AA 2A4KA 2NACA 1Z73A 1C14A 3QVSA 4TZKA 2JAPA 2Y1OA 4FFLA 2GASA 4K1LA 4MKRA 3ZCXA 5L40A 4GX2A 3JQCA 4RJTA 2IZZA 2X22A 4IDFA 1ENOA 4U0KA 4K28A 1AN9A 1GEEA 3OICA 3QWIA 4DIFA 2O2SA 4GL4A 4OKNA 4MVJM 1G0OA 2GUGA 1XWFA 2P2SA 5CEFA 3RFXA 4YRBA 3ZZNA 4D0SA 3DEYX 5ES3A 1X0VA 4XQGA 1HE3A 4CUJA 3CZMA 2OHXA 4KQXA 3FNEA 3SJ7A 1ZK3A 1Q7CA 3BTVA 3GMDA 5FI3A 2Q99A 1E6WA 4WEQA 2J3HA 3ETEA 4NFYA 4PVDA 5JE8A 3E9QA 4RGBA 4U8GA 5EMHA 3EVTA 3DFZA 2DM6A 1SCUA 3N74A 1GZ4A 1U8FO 3AUUA 4XJTA 2GDZA 4UEOA 1BDMA 5TX7A 2HO5A 3DBRB 1O89A 1U28A 2W2LD 4WGGA 1YB4A 4BL5A 1PZEA 3JQFC 4PG7A 3GZNA 3VTFA 3PWSA 1DDOA 1HDCA 4QFCA 3LYLA 1GCOA 5T6BA 3AY6A 5AXBA 4GH5A 2O4CA 2CMDA 3H2ZA 2AMFA 3LT1A 1Y8QA 3U09A 3W4JA 1SOWA 3U62A 4BO0A 1UXGA 4XR4A 1GL3A 4IS2A 2PD3A 5EJ2A 5TT1A 2CF6A 1ISHA 3R3SA 3EDMA 1MXFA 1C1DB 4IMRA 3WGQA 2WM3A 1NWCA 1ZVMA 5CDGA 3UAGA 3C7DB 2B83A 3AM3A 3LT0A 2NUAA 4E33A 4XB2A 4DVJA 3AM4A 1O8CA 2UV8A 5DNAA 4F6CA 4XB1A 1QYDA 5L51A 4M55A 3PTZA 5EIOA 3GA0A 3KBOA 3AUAA 4PLTA 5IZ4A 4BKQA 5F5NA 2JD2A 3AK4A 2J5RA 5TGDA 4ZN6A 5BSHA 1QORA 1Y9AA 1NX6A 2EG9A 4KUEA 4L76A 1UR5A 4J7XA 3PIIA 2C29D 1YOVB 1PJTA 2J6IA 3VVBA 1ORRA 1GQ2A 2GERA 3JYQA 3DBVO 1R37A 5G0SA 3JD1A 1JA9A 3UVEA 4OXNA 2EV9A 5JCJA 5CP8A 1DFGA 5AXDA 2LDBA 1A7AA 4TRMA 4H7PA 4TQGA 1GUFA 4NBVA 3ZV3A 1R12A 2WSBA 4FJ2A 3V2GA 4BB5A 1EK5A 4A2CA 4DMLA 1IZ0A 5G2OA 2OXIA 4CQMD 3FR7A 4JP2A 4KWIA 3U9LA 1F0YA 2B36A 1HDZA 3DBHB 3STHA 5JLAA 1BW9B 2CF5A 4BMVA 1V3UA 2QZZA 3JQ7A 4RORA 4Z9XA 1M6WA 2C2YA 3AY7A 3JQDA 4PCVA 2A9FA 3I3OA 1A4IA 3C7AA 2D1YA 2B5WA 5EQFA 3SX2A 1MLDA 3VH4A 3R0IA 4EDFA 4YRDA 1NAIA 4UVGA 2HJRA 3ZWAA 4UUOA 1NAHA 2X86A 3VH2A 4AJNA 2X1HA 6ADHA 3GR6A 1ID1A 2C82A 1O9BA 3G3EA 3RWBA 4CM6A 1XLTA 3B1FA 1PGPA 1T2AA 4LCJA 3KXDA 4D44A 5GZ1A 2ZTLA 5JMPA 5JS6A 4BNKA 4E5NA 3WBFA 4YAGA 1ZSVA 1FDUA 2AEFA 3OF2A 3FHLA 3NJ8A 1XU7A 3MZ0A 1EE2A 3JQ6A 4J7CA 4YJDA 1AHIA 1LRKA 3UXYA 1UXHA 5DULA 1WDKA 1NTOA 3F5QA 4JJGA 1BHSA 1GYRA 4F3YA 1QR6A 2FR1A 4JN6B 2RH4A 5TC4A 2JCXA 1CRWG 1N7GA 4L4SA 3C24A 2FZEA 2BMAA 4FJ1A 3WGZA 4RV9A 1LUAA 3RUIA 3W4IA 3KOUA 2VRCA 2XAAA 2ZTMA 3WQSB 4NJOA 5T5QA 1AGNA 2Q1TA 1QLJA 2HK7A 3CMMA 3QVTA 1ZK0A 3VPSA 1VM6A 2GPTA 3H5RA 1VJTA 2DT5A 3PLRA 1I3NA 2IRWA 2NTVA 4R4JA 3H8VA 2YJZA 1C0IA 2DFVA 2Q2QA 4R1TA 1A9ZA 2BFOA 3D3WA 1GYQA 3WDSA 2DC1A
chains in the Genus database with same CATH superfamily
3JQGA 4B5KA 4PAOA 1YV9A 3NHAA 1RZRD 3U5ZB 1DDGA 2JGFA 4GL2A 2UZ1B 3WMXA 4AFNA 3CPHA 1DQRA 4EY6A 2VDOB 2EKZA 4OBBA 4NZZA 4E5DA 5ICGA 4MGZR 2H1LA 3AU9A 4D5GA 1LXCA 3OCUA 2HA0A 3V8BA 1FBTA 1NVFA 1R6BX 2MMGA 4XDYA 4YV2A 5BN4A 4D9BA 1GOTA 4G0VA 4Z54A 1SVSA 1SA0A 4Y9RA 3OIUA 1A5BB 4UHEA 2X15A 1QH8B 3UKOA 3KALA 1FTQA 4L5AA 2PMBA 4MR9A 5MFPA 2CJWA 2QD3A 1TX4B 4WMLA 1RFLA 3NJRA 1RZRA 1PHPA 2QVCA 1J8MF 3NB0A 1YRLA 1U7TA 4CF5A 5GADl 2VVTA 2XDQB 2ECFA 3ONDA 4N7JA 3ZCUA 2Q7DA 4JUIA 4IX9A 3O38A 1V3QE 2HSJA 2QNRA 4YRIA 5KJFA 2N75A 3EGDA 3AY3A 3F9IA 1ZH8A 2VF4X 1X39A 5AUNB 3MCTA 1KSHA 2AX3A 2O3SA 2PGLA 2V6JA 3CKYA 1JALA 1YBMA 4LHYA 4FDAA 4DBLE 4YLYA 1USKA 2QTVA 1OXXK 4YV1A 1JFVA 1S89A 3OOYA 4C7KA 1RWQA 3PEFA 4JKIA 5DTQA 4PZ0A 3FFTA 3GBPA 1GGJA 3ICVA 4FNOA 4MAAA 4YACA 3T7KA 4PIMA 1M6NA 2NSDA 4JBXA 4MGYR 1DQZA 4QUJA 5EJIA 3ESDA 3RJ9A 4LYAA 2WWYA 3Q5GA 4YP7A 1JA1A 5H68A 1LDEA 3M6WA 1FUKA 1KGDA 2Q9UA 3RS0A 1IZ8A 3T15A 3U0VA 4JY7A 5IK2D 5JQWA 2IXFA 3DV0A 4B3XA 1CR4A 3QK7A 2RJNA 4JA0A 5HUJA 5AFSA 3PUVA 1M2GA 5ER6A 5FPHA 4IEIA 4DLYA 1GNQA 1C9MA 2PAFA 2WM2A 4ZALA 3UW1A 5LU9A 1DTWB 2JEOA 5B1YA 1FRVA 2B4YA 2OBBA 1KVTA 3RTCA 3T95A 4WZBE 1SD2A 2IYQA 4LPSA 1U2RA 3IOMA 1PSDA 1RQ2A 2HL6A 1T4MA 2RAFA 4LDAA 2WYOA 5GJBA 2PGIA 4DWWA 1PS8A 2GEVA 4TTPA 1QYIA 2ZWPA 2FF5A 1SC4A 1M1NA 1OD6A 3FVRA 3P9YA 4GW3A 4R7ZA 4XGIA 3NPAA 3N2GA 3TLGA 3TRIA 2PKYX 4BQPA 1LDGA 3JWPA 1Q57A 4L3OA 1G1MA 1SKQA 4RE6A 5HE8A 1YQ9A 5LQDA 3WV5A 1VG0B 3MWEA 3QFTA 5ILOA 1DT5A 2DQSA 4AJPA 3S4YA 3KLPX 5C3MA 1D03A 1P1JA 1CXZA 4J7AA 5K8TA 3BBPA 3EF1A 3TQFA 3ADCA 2C8LA 4ZOLF 5A4DA 4GMDA 3HJCA 2QSUA 1I80A 3RFCA 3CTMA 1ISJA 1MHPA 1XF1A 3T4UA 4OH1A 1MA0A 1TYDE 2ONCA 5HIIA 1ICIA 5EMJA 2Q9CA 2YV3A 1BXRB 3V9PA 2WJYA 5AI4A 4QWWA 2W6PA 4RK5A 3OZUA 3VKHA 3ZXIA 1FOEB 3D7LA 3PXAA 4Q6BA 3C8UA 3BSSA 3F3YA 4G86A 2UUCB 1JEDA 2H2AA 1JNXX 1JEQA 3HV2A 3EQ9A 3IT2A 2XSZA 4N7RA 5ALGA 1EJ0A 1UXKA 1NHWA 2DBVO 2ZT8A 3MMNA 4EARA 2B9EA 3IEUA 5TEWA 3KPWA 3B5JA 4O4LA 1HOTA 5TMEA 5EUCA 2HQBA 4FGJA 4WBXC 5DTMA 1SZPA 2OFPA 2X5KO 2RHWA 4BZWA 4A5OA 5K0GA 4D0NA 1ZL2A 3MMPA 1QRAA 3DLAA 3EXFB 3GQBB 4MICA 2A5GA 4GE0A 3T94A 4EFMA 2QY6A 1A9QA 3FPGA 2WSSA 1N1GA 1HNNA 4L95C 4Q7KA 4TSRA 5J47A 4ZT5A 2WWWA 3BDAA 1SC1A 3HUFA 2RHMA 4WQMA 2GQ0A 3CEPB 1CK4A 1OFTA 1RYFA 4EVQA 3S6JA 2FR8A 4RF4A 5KQMA 3KYCA 4RA9B 4FM9A 4FPXA 1I6LA 4CQLB 2H29A 4W5HA 4FFDA 3TB6A 1VKHA 2H54A 4HAWA 1Z2PX 1RD4A 4EG4A 5BV7A 5JHGB 1DAMA 3KDAA 3T0FA 3O1IC 4MRPA 5C46F 1BROA 5KOJB 4V39A 5FOTA 1EDDA 3TNLA 3G02A 5GOTA 5IKPA 2QM0A 2WUDA 2GKGA 5DXFA 4BQFA 2BDTA 1LJUA 2JVKA 2NZ2A 4XWKA 1XPRA 1U6JA 4BLQA 4FX5A 1GGFA 1TTTA 3MSCA 2DR2A 1H6BA 1OBOA 5FWNA 2XGJA 3GP5A 3GVHA 1W87A 4LXQA 3RBZA 4AC9A 5BW4A 1YOBA 1FSZA 3VISA 1YB1A 3P20A 3DDSA 4KR2A 1NQAO 4C1BA 1AQ6A 1Y6ZA 1VI5A 2ZRGA 4C3VA 4YV7A 4G26A 1LD3A 4QDKA 4TVBA 5A3VA 5HJ7A 3H84A 1BQ3A 4GBED 5IU6A 3L4SO 3GJ0A 2PA3A 4YJFB 1PE0A 1Q11A 4HWPA 3B3QA 4F97A 1VHDA 4U2GA 1V11B 3E03A 1U8EA 3AFOA 1KDOA 4ZQCB 2VJBA 4YY3B 1L4BA 3BWVA 1EB9A 1QH9A 1J0CA 3MVEA 4MVWA 1JECA 1MC5A 1ZK2A 5CA1B 5K5EA 2UUAB 2C3PA 4XSGA 5FNVF 1XQWA 2Y77A 4GYYA 4P5DA 3SXUB 3WSTA 2XT0A 3N8HA 1ZXXA 4QYIB 4RA6A 4KMRA 3BB1A 3UV3A 1VIDA 4OSPA 2GEJA 2ORVA 5K8UA 3CLRC 2W6MA 2LXNA 4R69A 3CX6A 4D97A 1ULTA 5LBTA 3U81A 2I6QA 4BB0A 3U49A 2ZYWX 1ZJ6A 1V6SA 1ADFA 2NU6B 1ARZA 5HTKA 3HHPA 4DQVA 4ZWNA 1SHTX 1TZJA 2JG3A 4DEXA 3E9ZA 4RQAA 1GRCA 5TLSA 4EX6A 4DM4A 2NZVG 4ZO6A 2YJ5A 4JL5A 3Q15C 1G20E 3ZGVA 2DGDA 1L7DA 3S29A 3NHKA 5A2GA 4XOIA 2Q4BA 3H2YA 2PSJA 4HH0A 4BVEA 2Z08A 3RFFA 3U7RA 3A2KA 3EGIA 1L3BA 4DIKA 1C4KA 1J2RA 1GZDA 2X6QA 2ZPUA 4CODB 4D98A 3HB4X 2KX7A 2O0HA 3DEZA 4JCCA 1SHLA 3IVGA 1PKXA 2QXUA 1X7WA 3AR3A 5C0OE 4J07A 3VKWA 4HDKB 4W9MC 2WWHA 1R50A 1L7XA 2ZUCA 1QZ3A 1OWLA 3IPRA 3NJ4A 1THZA 4X41A 2Y1CA 4P54A 4PX9A 1NUHA 3HUUA 1P75A 3LLMA 4HXGA 5T67A 4C01A 4E6EA 1WETA 1H8ED 1SEVA 4L73A 3JD0A 4QTXA 4ENUA 4UHFA 3WFIA 5EIAA 3K15A 2FEMA 4NAHA 4FR2A 1MG5A 1YB2A 4X3PA 2H0RA 4KXXA 1KOGA 3K7EA 3RRYA 2PU7A 5JSUA 1I6KA 5AKKA 1W0JA 3IPYA 4JVMA 1A69A 3H5WA 4JFAA 2F3TA 4EYQA 3BFPA 4LXXA 4RUKA 4OREX 3FWYA 5DYGA 2RARA 1WF6A 1A5SB 2C7GA 1DAOA 2AXQA 4DMHA 8OHMA 1PNRA 2XUDA 3PVSA 5J1TB 3H1PA 3EMDA 3G5TA 1I94B 1HDEA 1VYHA 3L6EA 3QELA 3H2SA 4EYKA 1U98A 3HLYA 4GLOA 2J0VA 1TJYA 4CU2A 4YQZA 2VRBA 3LV8A 3H6GA 2NPOA 4X1KA 3T9EA 1FRQA 2W90A 2ZSBA 4FDMA 2AMJA 3NH9A 4V2UA 4W5JA 4PTLA 1ZIOA 5IDXA 2Z5LA 4OA8A 4GOKA 2IUUA 2A7QA 5TJHA 5IXYA 2AJ8A 2DWQA 2R1UA 4L15A 3ULKA 5EMLA 3DL7A 1GSOA 1DTSA 3DO6A 3IT0A 3H4IA 5AH0A 2KHZA 1HL7A 1RJGA 1SULA 1WMDA 2GYYA 3L8HA 4M0LA 4MTLA 4Q1VA 5J59A 2QRMA 1JJIA 4TROA 1S8AA 3B7WA 4V1CI 1CRZA 3C4QA 5EERA 3M3HA 4DQ0A 4G0XA 1H6DA 4TTIA 2ID4A 5G0VA 3FKQA 4TXLA 3D4NA 2ZTHA 5KMGB 1E2KA 1NNUA 2QROA 3G0GA 2GT1A 3HHEA 3OZXA 4MI9A 2Q5IA 4JK3A 1H5QA 2PUWA 2WKPA 5H5JA 1EUDA 1B8UA 2W2PA 3IXMA 1BXZA 4MRVA 5LPNA 3EVAA 1X0XA 2QRPA 4B2LA 2I3BA 5D51S 5F12A 4FGSA 3NC4A 1TVKB 3I6IA 4R84A 4X3OA 3BQ9A 1XZCA 2Z04A 1S2NA 3L7YA 3VVCA 1YU9A 2ZI3A 4PZPA 5HKAA 2G28A 5LN1A 1JDSA 5DFAA 2ZSDA 1XDUA 5E1BA 3TCNA 3MD9A 4FYWA 5KU1A 2FUG1 4QDUA 3AR5A 2CUZA 4M0EA 3X1MA 4D46A 4D79A 3O2QB 4JB0A 3IQEA 3K6KA 1XQ9A 3KSDO 3VV2A 2BGGA 4AF8A 1Z2OX 4P92A 4Y6GB 2JDID 4TQUS 4DQXA 4EITA 3IR5A 1BHO1 1PV1A 4HYQA 3K6SB 1UBFA 3K1ZA 1T5LA 5CT5A 4FZVA 2BMWA 2WF9A 2X6RA 2O5EA 3V1TC 2UZIR 1CNMA 3W1WA 4CN9A 5KYUB 1UC5B 4YA6A 1CUIA 5HBGA 3LX8A 1OXMA 4RL4A 5AUOB 4HNTA 4CHGA 4QBFA 3C4JA 3ISJA 3QELB 3D0RA 2WUVA 5LWQA 2E5LB 2VK8A 4FFBA 4MYTA 2P6MA 1Q0TA 4MQLA 4UUQA 4E7PA 1P2BA 2F8SA 3NHLA 1GWNA 1CUDA 1XXHB 4IHJF 1NT2A 2L42A 4PSDA 4DSUA 2HR1A 1ZS9A 4QLOA 2CLFB 3EOAI 3DT6A 4BECA 3NFYA 3UPDA 2XUPA 1YRAA 3VC3A 1TAHA 3DPSA 1BX0A 1E1QD 5SY9A 3ZTTA 4YUWA 1OY1A 1Q0QA 4RQTA 1W30A 4RWEA 421PA 1Y42X 1G42A 2B25A 1E1CB 1EAYA 1ZNQO 4XYMA 3OTGA 2OYRA 3FPSA 2VSYA 3OX2A 4JT9A 1FNDA 4LBYA 3N2LA 4KQ9A 4B2IA 2QUIA 2AN3A 4IHKA 1K4KA 3MJEA 4QBTA 4M49A 1AS0A 4QPDA 1AZSC 5I7SA 3C1TA 4DXHA 1GZ6A 3OQIA 3CG4A 4JR2A 5D6NA 1KQNA 2BFNA 1C30B 4O2AF 1ZNXA 4TXJA 3ZIAD 4EGQA 2FMKA 3C7CB 3EDCA 3Q5DA 5JZSA 1OJ7A 3CLUD 1TVCA 4O25A 2CNWA 2YWEA 5KYNA 1RDFA 2O54A 4HQFA 4RJ2A 2OPHA 4C6RA 2VTBB 1LFDB 3IIKA 1YR7A 1IC6A 3HEBA 4P5EA 1QIKA 2FETA 2DT8A 3N1UA 2I91A 4Y6PA 1J1UA 2IS4A 1YHZA 1YBVA 4D0LB 3OA0A 4FD2A 3L1KA 1HYEA 4M9CA 4QOIA 4KTTE 4M1WA 2GUWA 1XCOA 4BVGA 5B4TA 2O8FB 2XDWA 3CSDA 4O0LA 2V7BA 3RG8A 4NH0A 4OAOA 2WPNA 2IXTA 3PVCA 4YFVA 2XOKA 3F5MA 2XB6A 5DN6A 3V42A 4MVJA 2RHCA 3P4YA 2GEUA 4TT3D 4GE3A 3JQEA 1QIIA 1IB6A 3HSKA 3WKEA 1CP2A 1P2DA 2BTEA 3RTBA 3IUPA 1SM4A 4DWVA 4EVIA 3T5MA 4YS6A 1LRLA 3L0BA 4ZPJA 3OFNA 4HQKA 5KEIA 2XYVA 5C1BA 3HEMA 2XNSA 4LX0A 1DAPA 4F93B 4LI0A 5C5DA 2IUFA 1TJ4A 2YW9A 3GDFA 3W8NA 4CQJA 1EK0A 4XWTA 3W2TA 3KXPA 1EEXB 2QTGA 4BHTA 2B99A 4PWYA 4XRGA 3EBOA 3DBHA 4QOEA 4TV8A 4OCZA 4A92A 2ZEJA 3ID6C 3VUEA 3SC2A 2QT0A 4MUJA 4QDJA 4H16A 2GCOA 4MS1B 3E81A 1Y34E 3A6KA 3OU2A 3RYFB 3KZOA 3RAJA 5GOZA 1KSGA 3BD6A 3O9VA 4O4IF 4XGNA 5LYYA 5JW6A 5AXCA 4RVFA 3TTYA 5CVEA 1X13A 2GHQA 1M8FA 2PMCA 2ZR8A 4PS1A 4XDHA 2GN0A 4IIGA 2CT8A 5JSYA 3LKDA 4GS5A 2ZP1A 1EVQA 2AG0A 4CNBA 2ZIEA 3FVTA 4PZDA 4QOJA 3UKJA 3ZD7A 4L4ZA 2J4CA 1SIUA 1AKUA 1XD2A 3JWJA 1ZD9A 4HR7A 1M74A 5LQSA 1UC9A 1ZMTA 2OGSA 4QC2A 4RKQA 3VO2A 1KMIY 2RHHA 3U4IA 1AZTA 3CPEA 2FMHA 5HIMA 2P7IA 2WSSD 2DWCA 3BMXA 4RK6A 5B1EA 3ASZA 5C7LO 1UJ5A 3SP1A 3UBMA 1T6XA 4NCIA 3KJFA 4BB6A 3CZCA 1E5DA 1TB4A 3V7NA 4F1JA 7MDHA 1P5HA 3FNFA 1TC2A 5WRFA 3OZSA 5LQNA 3WB1A 1JR4A 3BXXA 3EGWA 1WW3A 4MEJA 4DDVA 1U9YA 3V8EA 1LB1B 4L28A 3WWDA 2VHXA 3EMVA 1WMSA 4ENQA 3AVXA 4S35A 1G5RA 1GHTA 5L3QB 4L08A 1TZCA 1JJFA 2QUAA 3MTEA 2OBFA 3PIRA 4JJKA 3M2PA 3VDRA 2F3RA 3DGEC 4RENA 5EIEA 2B7CA 5KQRA 1YS9A 1ZISA 3E0QA 3R6LA 3AINA 4HLUC 3THXB 1QIJA 1KC1A 1UPTA 4NQZA 1NU8A 1Z08A 1L9XA 1IWPB 3B9PA 2YWDA 4MW2A 3UJ6A 3GDGA 3LT5A 1RADA 5JBNA 5KREA 2D1FA 2YWBA 3OMLA 1E1NA 3N07A 3T8YA 4BQEA 2W6ZA 1NQUA 4IGIA 4LYYA 2R8PA 4INZA 5FOWA 1PZGA 2WT8A 4BIIA 1Z82A 2I7VA 2Q6IA 3DVAB 5I9LA 2RGGA 4FNAA 3HVKA 4KSBA 2YV2A 3JQAA 1FP4B 3FLAA 1MOPA 5IVHA 4O2LA 3RUAA 3PNMA 2R6ZA 3MWGA 2WABA 4FS8A 1CT9A 4Q19A 2WSLA 3VYTB 3O8RA 3LFTA 5BSKA 1V25A 3T3OA 3OEHA 2IY7A 3LS2A 4CFSA 3SXJA 2B7LA 4F60A 2HZ7A 1RAFA 2I33A 2O0MA 3H5AA 4YRAA 3T5GA 4XXHA 5JCPA 2XF2A 4GNRA 4LYHA 3E2PA 4S0XA 3TGPA 5T3YA 4I6JA 5DNUA 3NAMA 3ZE2B 4E2ZA 2GYVA 1N5OX 2X8AA 3SSMA 5DYNA 2J9FA 3KAPA 4B4VA 4BMPB 2Y93A 3DM5A 4G5GA 3UWMA 2IH4A 1IG3A 4X6UA 1EWQA 1KOJA 1T9BA 2JA1A 1J8VA 3DXZA 1ISFA 3CISA 2BDUA 1U3DA 2PBZA 1NW8A 1NYQA 1FSSA 3E0XA 1KZ7B 3PE3A 4ZQFA 2RK4A 3TZHA 3PPWA 3RRMA 1W8DA 5KNCH 3O8OB 4GXQA 4WBSA 1O96A 4QGBA 5GVRA 1OAKA 3QF4B 4C07A 3FMVA 5FBRB 2RMKA 1QAQA 1ZN8A 2KE5A 1FVXA 3E5MA 1XN4A 4A8TA 4YT8A 1TM5E 5DISB 1KJQA 2AXPA 3GRCA 3HPQA 4RDCA 1J1ZA 1IIBA 2VP5A 3DBIA 4WDQA 1QE0A 2FK8A 4BKOA 4DW8A 4V2IA 1ISIA 2L82A 1Q0SA 2VPWA 3DDHA 3R3HA 3S1AB 3L43A 5EWJA 2Z9BA 2VJDA 3GGJA 4FYIA 3C8HA 4NOMA 2CK3D 3NC0C 1SU6A 2H1VA 3LW7A 1H22A 3OO0A 3P2KA 3E61A 3JAWA 2NXWA 2J3JA 3GOQA 4L8LA 1TUBB 1SC3A 1HQCA 1L4YA 3MMZA 3AY0A 4OMUA 1ODTC 3ZDFA 2FZ4A 4A7PA 3E1SA 3WIEA 4XH9B 5T41A 9LDBA 4P98A 4E5SA 1OV4A 2HRCA 3CUKA 4J6FA 3PD0A 1UT8A 1GPBA 5FJIA 4YHBA 5FTLA 4NPAA 4HDNA 3USZA 4ZI3A 4AY3A 5DKFA 1LY1A 2APJA 2Y0PA 4WLFA 1DPGA 1I51A 1SURA 4GT1A 2A0XA 2ORIA 3C1UA 3KSZO 4BX0A 3NRCA 1BJKA 2ZE6A 4G0PA 4LWOA 1G5PA 1PQUA 5EQDA 4CG1A 3R9XB 4OMFG 2CW5A 5ENVA 1BX1A 3EGCA 4HZUB 5LLDA 3W1EA 1QCZA 1D04A 1R6UA 1PJAA 3R3JA 1QR2A 1RCUA 4I5DA 4P7KA 5BN3B 5J43A 1SFRA 1OLSB 4DM7A 5EP2A 5JNLA 5A4KA 2PIAA 3N2KA 1UPCA 2QTNA 1GGEA 3BXZA 3K0HA 3S7TA 3UJPA 4QREA 1DIAA 1Q14A 3EULA 4W9NA 4LY9A 1CKEA 1FDOA 3JTEA 4Y18A 1T2VA 4N0DA 1NE2A 2D2VA 2I55A 4ZO8A 1MZPA 1FVHA 1H2ZA 5FFNA 1RWPA 2JFPA 5AKZA 3T7CA 3ABOB 2B6NA 4TL9A 4X3CA 4LZJA 5DTIA 2JASA 9ATCA 1I5RA 4KDRA 3AB7A 4QHYA 4YRTA 1AZWA 4ZVVA 3SR3A 2D5AA 4HDOB 2JB9A 3NIDB 4LSWA 4RTLA 1QRSA 2EX4A 3O3MB 3FCSB 3PL5A 1TUGA 4RMIA 5ESDA 2C5GA 5HFAA 3RK4A 4BLUA 3U60B 2IU4A 3MJDA 4I5FA 1HKHA 5E0KB 2Q1WA 1A9TA 3ZN2A 3L6CA 3OZDA 1HF3A 3U7QB 4MZDA 3WICA 3GRAA 3PK0A 3ZE1B 1QBKC 3BQNB 3R7NA 1P7ZA 2OZEA 1JIQA 4JJ4A 4LS3A 4TWBA 1DB3A 1PJZA 3D4PA 1E64A 3E7DA 4RPJA 3ZTWA 4C0QC 3K0KA 1WF3A 3DKIA 3OKFA 4RNDB 4US1R 3SJAA 4FNGA 2C7PA 1U0NA 2H17A 4KFCA 2DQKA 4YJ2B 3BGWA 2ZGVA 5LA6B 4CQNA 4RVNA 1RRVA 4TV9B 5HOQA 5JFGA 5JWOA 4A3SA 1BD3A 1RM5A 4O3FA 3UFXB 3LTNC 2Z1NA 3RJMA 1Y82A 1UBRS 3M70A 4RTNA 5EXDA 2I2WA 3NT2A 4R16A 2NSHA 1J0DA 1U28C 3PP8A 1FFGA 1NXVA 3OPYB 4HNAA 4M9SA 1JG1A 4QJIA 4TM8A 3C45A 3DKPA 4IY1A 1CQZA 2YCBA 4HCJA 4QUAA 2Z2YA 4O6VA 3FOFC 4MS3B 4A8HA 3EH1A 5JH7F 3GUHA 3WKDA 2IITA 4JP8A 1T3SA 1AG9A 4TQAA 3T7TA 3L40A 1FQKA 1XXHE 1Y7IA 5EQJB 4TZ6A 4N03A 5FBVB 3BWEA 1EVLA 3TFQA 2FWBA 1JYFA 2QZ9A 3IQGX 4HGYA 2PUTA 2J6HA 5BWCA 1J25A 5IKXA 3LY9A 3ADKA 3ICPA 4D25A 1C7IA 2QQ5A 5REQB 4BLPA 1J7KA 1KRHA 3EGVA 2WOJA 3JATB 1D2CA 1ISPA 2LP4Y 5I9MA 4U9UA 4UQLA 2VSQA 3N3BC 3DFUA 2QN7A 5K0TA 3QV1A 1KI6A 1XJ5A 4DAEA 2NN3C 3W6PA 2P6NA 4KR0A 1AGPA 4MKFA 4X6YA 3ECAA 3K1JA 3CUSA 4MLDA 1G9SA 2VATA 1CX9B 2LCFA 1L7EA 4L5CA 4R2JA 3WWYA 2O2DA 2OBXA 3H1FA 1UBSB 2A1UB 3QY0A 3FNIA 1VHJA 8GPBA 2QZ4A 1C3JA 2JBWA 4UDNA 4XUGB 4ZDWA 3UZUA 3F4BA 1TPZA 1GEGA 2J45A 1EXVA 1DIRA 2W48A 5E1OA 3MRXA 1YZUA 3RS7A 4AZ0A 4C78A 1HZJA 2AJCA 4ESEA 1T3HA 3VPDA 1O97C 5FA6A 3MINB 1DCKA 2Z8YA 3P9ZA 3FCOA 4I9FA 1UT6A 3I2YX 1ZUNB 3S2GA 4ZODA 5EQTA 3OTQA 1UK7A 2B4QA 5I4BA 3TLEA 2HPHA 1ONPA 2IP1A 4AJKA 1YNSA 4CTOA 5CXUA 1WAMA 1NJGA 4HDNB 1RU3A 5LP6B 2EBUA 5IT4A 1KAGA 1B1CA 4WEOA 3TSWA 1OH7A 2NYUA 2ZVJA 3RSFA 4K2AA 1WRBA 1SCNE 3C16C 4K6HA 4CLOB 1NXSA 2GMWA 4ZC8A 2I4IA 2PT5A 1KH2A 3K20A 3O95A 3SVTA 3RO7A 5KTMA 2ETVA 2GAIA 2IEYA 2D8MA 3PDIB 3QFHA 4ZTBA 2G67A 2OUKA 2XDQA 3ONFA 4QUBA 3GLFE 5A2QA 3KU1A 3GVCA 1XHFA 3L7CA 4REOA 4HEHA 4X20A 3AOGA 3H19A 3D8TA 3I12A 4TTVA 1OBVA 1THMA 1Q17A 2FPPA 3CXRA 3ROZA 1PQ4A 4MQEB 4ENWA 4O29A 4TPKA 5L45A 3WNCA 4WZAE 1A4UA 1MX1A 1D2HA 3IKJA 3V4LA 1K5HA 2HFJA 1EFVB 1KZ1A 1GDDA 4K6MA 5CA1F 7ABPA 1TGYA 3THYA 4YJGA 1VJ1A 5FHQA 4AUKA 1JEYA 4ZXPA 5LC1A 3ZGZA 1PWXA 4MUGA 4DY6A 2QE6A 3EGXB 1R74A 4UJ5A 4IH9A 1ZLYA 4KGZA 3R7WB 4PC6A 5D1HA 2IIBA 3NEJA 5DBHX 2D06A 1N3YA 4DDWA 1S3SA 2BHNA 4MULA 2NT3A 3GNQA 4L75A 3AW8A 2QB5A 5E4TA 1W4LA 2XUFA 3SVLA 4L8WB 5JWRA 1JWAB 4HYYA 4JJZA 2X7HA 1GZSA 1TZMA 1ZNZA 3D9QX 3ILYA 2COKA 2V9ZA 1C0PA 2ACEA 3ZYCA 1C4OA 2A1TR 2P4QA 4OGGA 1PNOA 4QRIA 5C5CA 1TU0A 2ZI9A 2R48A 3UGTA 4L0CA 5BSEA 3UOAB 3I62A 3GFBA 4OY3A 5AVOA 2Z43A 1RNLA 4NAVA 3C85A 1O9HA 1PT6A 3NDIA 2NXCA 4WW0A 3TQIA 3D3QA 3AF4A 1GFSA 4B3BA 2Q4EA 3AETB 1XNHA 5JSZA 4PONA 1SVNA 4MUIA 1E3SA 1M33A 3EIUA 2VT7A 4HZGA 3Q10A 2IE0A 3RG2A 1Z4PX 3LWDA 3R7DA 5C7OO 4C2UA 2GLTA 4OGKA 2FMFA 4YRLA 3ZI7A 3NDBB 1T4CA 2PQ6A 3D1LA 4HH4A 3CRRA 2NXEA 2OAP1 5KAPA 3ED1A 5IF9A 4RKRA 1Y98A 2WD7B 4OOFA 2QGZA 1ZL0A 4TKLA 1HETA 5DRTA 4LJ9A 4RK1A 4YMGA 5JLJA 2ORWA 2O52A 1L6RA 1PS0A 1TCBA 1H2YA 5JSFA 4CKXA 2GRJA 3LKVA 4Z1OA 4XA8A 1MEOA 2I4MA 3GARA 1RM0A 1K88A 2GCPA 2VHCA 4CIAA 4WY5A 4AF7A 2GR9A 1GM5A 2C7BA 3HUTA 1S9HA 4S2UA 3OT5A 2BMJA 4TV9A 5EUMA 4POOA 3B89A 2R6CA 3ZS8A 1C3OB 2BZ0A 2G4LA 1VLQA 2CHQA 4CM9D 4YAUA 4CG2A 3B7GA 4IRUB 4MIEA 2NVUA 1AHHA 3E5RA 1NBEA 3Q3HA 4XLTA 4EUHA 4FYHA 5KWJA 2E5WA 2VKQA 3O47A 3B5IA 4RHTA 3IS3A 5EVCA 3N76A 3VJKA 3CWQA 5I7HA 3I0NA 1J21A 4BBZA 4C08A 2C03A 3OTWA 2FSIA 3IQXA 3VPHA 1W7AA 2W6JA 4JJAA 1UBGA 3C6BA 2JJ2D 4IFIA 1E6MA 3N3AC 5JSQA 1WLYA 4IDDA 1P0FA 1PI3A 1RAHA 3WQRA 1PR6A 1RLTA 1VG1A 4KE7A 3FYSA 5K4HA 3IUYA 2YNMA 1CIPA 4NYMR 1TKBA 2OV6A 3AF6A 4Q0MA 5H83A 1T26A 3H9JA 4BX2A 5J2TA 2QMHA 3IMEA 1HEYA 1V71A 2QTHA 5LP1A 2RH5A 4MW0A 1PZFA 1HC7A 2G9VA 1NN1A 4YYZA 2ZJ3A 4GWKA 1NDUA 2KLHA 2R2AA 3D6HA 5CNKA 1MO2A 3QYPA 1D2MA 4MS4A 1Q3TA 3O4FA 3RWMB 4N3AA 3ZE0B 2QL5A 1YUBA 3ERCA 4I08A 4ZOAA 1YZVA 3O9MA 4WBNF 1IEWA 3RSHA 2C4UA 3WKBA 5BV8A 2A1TS 1YS1X 3IQIX 3LT4A 4JEHA 4RLSA 4G1BA 3R9WA 1AUPA 1XDWA 4M7WA 4NZYA 2CZGA 2B94A 1O6CA 3PGJA 4BFSA 3RT7A 1QYRA 3EPLA 1Z0IA 2C0CA 4ALNA 1KP2A 2H2HA 3Q2KA 4PG8A 3IOYA 3M4ZA 2ODEA 4BNJA 1RRGA 1E5VA 4H6PA 2ZYAA 1ZDMA 1QK5A 3FPAA 4AY5A 3I6QA 3OUUA 4BEBA 4IXTA 8AT1A 3VM6A 5BORA 4ZI7B 4I14A 1LCIA 1XRMA 3VSBA 2V8OA 9MHTA 3GGPA 1KQPA 4DC9A 3ORFA 2PGXA 3FHCB 1N33B 1QHYA 2BR3A 2XUQA 1ZD3A 5L3QA 1E3IA 4IVQA 4L9SA 3HBLA 4PQFA 4W4TA 4PZEA 5MDHA 3AL0C 1N78A 5DHPA 3N2ZB 1NPDA 3DYIA 4C4XA 3S8EA 1NW5A 4A8JA 2IHJA 3MLAA 2D5IA 1EXWA 1DRUA 1RCFA 1YQUA 5B30A 2OLJA 3RKRA 5SZJA 2JCBA 3N58A 4V03A 1FVOA 2GEFA 1H4QA 2HMTA 3RUDA 5AKHA 4QUEA 3OQHA 3F9RA 4U6SA 1G63A 1PF7E 2O8DB 4YJ3B 2DWUA 4MQMA 3KVOA 3LL7A 1ZWKA 5ADHA 1I7QB 3RODA 5KU7A 1OOEA 4U2DA 1LLFA 5JQGF 1G21A 1BRTA 4K8RB 4E14A 1IN5A 1LDBA 3KOYA 4G4JA 2LUOA 3IRVA 3DMRA 3S70A 3PGKA 3BA1A 5C1OA 3OZCA 5ED4A 5JJIA 4G5SA 2NV2B 4G56A 4UMEA 1KVQA 1RE1A 3M1AA 2IPLA 4FCCA 4J16A 4YAKA 3FKSA 3QKUA 2JAHA 3VC2A 2F90A 1JLMA 4QECA 4URUR 5F51A 3EF3A 3EUWA 4ERXA 1NKSA 4M60A 1J20A 3JZIA 4KFSA 4UTVA 5EUBA 3FYUC 3KT3A 5KYXB 3SHWA 1BS9A 1P7YA 1XP5A 4G5YA 1JN0A 2ERCA 1VLVA 1NLYA 3QVVA 5B7GA 2HSDA 1TCCA 2C83A 3GD7A 4BNFA 4DWOA 4EI2A 3VZBA 4PX3A 4NG5A 3DMNA 4DABA 4GKBA 3UAOA 1ZK4A 3TEMA 3TZBA 1S7CA 2VHTA 4YALA 4PX5A 1QX3A 4JJFA 3RU2A 2HREA 4WT7A 2QM7A 3NDJA 3NR2A 1QJCA 5CFZA 2V9CA 3KOMA 5KSWB 1KOLA 3I4LA 2UZAA 3AFMA 3LBYA 1Z28A 4Y1RB 3ROKA 1DWUA 4EYOA 5JAPA 2CB9A 1HLDA 3QF7A 4K6OA 4LJAA 4ZAYA 1SXGA 1LSOA 2PD6A 4IXDA 4D42A 1K7EB 3TZCA 4RIFA 1E6LA 1OTYA 3VFDA 5C7YA 3IOEA 2FXIA 2QPOA 4GPEA 2WV9A 4QYWA 3GRYA 5CJJA 2NTNA 3GX1A 4HRVA 5J4HA 1TYAE 1T0UA 3PRYA 4YDSA 3KOOA 2C2GA 3RBVA 1ECBA 5IAJA 1B41A 1WULS 3KQWA 2X8JA 4UXJA 5DI3B 5MN4A 4FGUA 3MWJA 4Z49A 4AZTA 1X94A 3V00A 4UBNA 2ZBRA 4D8UA 4D9FA 3GGCA 3N5CA 4HRXA 3UWSA 3FVQA 2H1SA 2EW1A 1C7JA 4X65B 2IYPA 1CVRA 2PWZA 5F7XA 3CH4B 7AT1A 1G4HA 1KS2A 3SE7A 4AN0A 2OQRA 4QHSA 5NULA 4M2LA 1G6HA 4RJIA 5HG0A 3KZ1E 1IY8A 4PFKA 4C0HA 2GD6A 3LP6A 5TSDA 3K70D 4ZGBA 1UMDA 2P8SA 4IOJA 2VRNA 3TZ6A 3NORA 2PAAA 5EIFA 3NTXA 2IYOA 3A27A 1G8MA 2YMQA 2QW8A 3HB9A 4KYVA 3DTVB 4FMCB 1KEUA 2GEDA 4YAOA 4FB4A 2GILA 1AT1A 2Q6TA 4MGHA 1I9CA 1MAVA 4DIBA 3J81A 1I7NA 1PEAA 1A27A 2GD0A 3FDIA 3FH0A 3NLLA 4C22A 3Q3CA 4QOHA 2N9UA 4ZOQI 6Q21A 4K9DA 1UFRA 3OLVA 3DA8A 3M6IA 2JLWA 3L18A 2XV1A 2OG2A 4HNAB 1O6GA 3QEMA 1NXWA 4IYJA 1E4VA 4NRDA 2PEZA 3T0IA 1XZKA 1JFFB 1YR9A 4YLEA 1KTVA 5D3MB 5DM4A 1Y3CE 1YRYE 1NQVA 2VZ0A 3ASVA 4NL4H 5K09A 4FC6A 4JQYA 4EG7A 1H4VB 2XYRA 4DCGA 5F3DA 1D1QA 2VAXA 4B3DA 1FZQA 2WB4A 3QWAA 4W7SA 4YRPA 1JEQB 4GSKA 3FZNA 4P0TA 4ACAA 3CE6A 1GAXA 4PVCA 1V4NA 4CEIB 3D4OA 3WWPA 2AOVA 2BD0A 3HRIA 4MMZB 2G8LA 1O5OA 1RXIA 4CT5A 1UBJS 5L6LB 2YTZA 4JH0A 5FIUA 4ZVQA 3RSQA 3ZHVA 2AZDA 3ZU5A 1F2VA 1EFAA 4R5MA 1YXMA 1FP7A 5COAA 4YCMA 4UFNA 5CVTA 1DNPA 1I01A 1VMKA 1OXKB 3WP1B 1RLJA 3O4VA 4BO1A 4C4TA 1E0AA 2XITA 4RMHA 1DQNA 1RLOA 2CHUA 1G6OA 2IU3A 4X93A 2BJVA 4TN1A 1D3AA 2P78A 1PFKA 4MGIR 5B53A 2B3TA 2YBEA 4NCNA 5TE9A 1KVSA 2C97A 1VJCA 2QLMA 4F11A 4PYIA 1DLJA 1N2CB 3ZYZA 3O3CA 4FLMA 1D1TA 1XCMA 1DJQA 1Z5NA 5NLLA 1QGED 2NU8B 3FWHA 3WGHA 3G0HA 2IPMA 4R41A 1JDUA 1AV7A 1KYQA 4UM7A 1SCKA 1T8WA 3KZXA 1QGOA 1RRMA 2ADMA 2SKEA 1OR8A 3KKKA 3HVJA 1TO1E 4IXWA 3B36A 2ZSKA 1PD0A 1SQ0A 1QGZA 2NU6A 4P7JA 1EUQA 2XYPA 1IATA 2ZYRA 3AGPA 1JA0A 3DZ8A 4GPZA 1Q95A 1E2FA 3MYYA 2A3NA 4DR2B 4BFYA 1IUKA 4ZMBA 5H80A 3QLUA 2JGNA 5KKAA 2VH1A 3PLNA 4N5HX 5C52B 1T4BA 1QHHA 2N47A 5J2TF 3C3EA 1EHYA 3D4BA 2OAEA 3MRSA 5DW3A 1Z5ZA 1TE2A 2GESA 2ZU6A 3E9MA 2HIGA 4I5EA 5DK4A 4YP6A 3QVGA 1I30A 1KJZA 1WB4A 2EFCB 4KIUA 3BMQB 4RLHA 2D4HA 2A0UA 3QBVA 4LK2A 5JZVA 1O6ZA 5ELXA 4K3VA 2VWQA 1DUVG 1MAUA 2BLLA 4LEIA 4Z4QA 3K0CA 3WOVA 5JMWA 4BX3A 3QU9A 3WWCA 1QRRA 4ROSA 1QVWA 2CC2A 2HNBA 3VU0A 3SQOA 3UT5B 1CRLA 2JGIA 2J30A 3ZK7A 3D0KA 1SAYA 1NJ8A 2E7ZA 1QO0D 2QRNA 4RD0A 2XCLA 5BSGA 3JWHA 4IIFA 2WVHA 3P2MA 4XIGS 3EZGA 5B3LA 5MFZA 4F6LA 1H2HA 3V7WA 4P22A 1DAHA 2QPLA 4U2BA 4RZSA 1F3LA 1NJ5A 3A2NA 1K8XB 4L6CA 2VXOA 3TK1A 4DLBA 4E07A 3MUOA 2KSQA 3G1TA 5AI9A 1WE2A 1V5FA 4W9RA 1CLEA 1SWWA 3HGTA 4CDRA 3PJDA 4OXIA 5BWMA 2O8BB 3T1NA 1NVDA 4PYQA 4TN5A 1JQ5A 5HF5A 4W7HA 1V3TA 2OCBA 3HKEB 3F4LA 1BU8A 1ELOA 2QY9A 1ZGAA 3UMFA 4YT2A 1ZKMA 3ZVNA 1FLAA 1C3VA 5ALLA 5KTTA 1CB7A 3GFPA 3Q2OA 2PLRA 1CJBA 2HBYA 4YCCA 1GG9A 4BC1A 4KXNA 4V1CA 5E6UA 5M5BA 1N9ZA 1MEJA 2D59A 1G8SA 4NSNA 1ZMOA 1W4RA 2NO4A 1Q12A 1RAEA 1EFDN 4KG7A 4R2XA 4LXIA 1H2BA 2WWTA 3NVAA 3SKVA 3GUZA 4JYCA 4J91A 1N5JA 4C1NA 4GZ6A 5SZHB 3OF3A 4MVCA 1EVYA 2ZS9A 4KYUA 4A0QA 5BSVA 3RLFA 5IF3A 2HU2A 4ENRA 1Q2XA 1LU9A 2Q6OA 3GLGB 1UQUA 5SYAA 3BK7A 4A27A 2QVGA 1JIXA 4IJKA 2W6CX 4MVJF 5JMOA 1EVJA 1MFZA 1WVIA 3EW7A 4I3GA 4KN5A 2CUKA 2OCPA 3MTJA 3V33A 2KQUA 2O14A 1AN0A 2GJAA 3SZRA 4CL3A 5LUBA 4EG1A 1CY0A 2QX6A 1MOSA 1YKFA 1U1CA 2M6RA 2VH5R 5C8YF 1EUYA 3D6FA 4HTFB 5ALEA 5ICMA 1XMXA 2D5LA 4KV9A 4UBMA 5ES4B 1JIUA 1MO5A 2PMEA 1L7BA 3VGPA 5BSRA 1RW4A 5DSTA 3WGGA 1DC3A 4DIOA 2AOUA 2DTXA 4PRYA 4N48A 1RVDA 2Q3BA 1DINA 2OV8A 1KS9A 3PFWO 5GAJA 1E3MA 1JHMA 4XCQA 4KOEC 1E59A 2YVAA 4JCOA 2X41A 3QKSB 1BKDR 4K03A 3WSWA 4X84A 1Y6GA 4S24A 2TS1A 4JT4A 2VXBA 4PLVA 4BKMA 1RLMA 3BL8A 3GVPA 4TYQA 3BFXA 3OU7A 3U7GA 5JQGB 1BGXT 4EEXA 4KVGA 1T9ZA 4X1OA 5C32A 5LXTB 3PHIA 4DG5A 4R7TA 1DXQA 4E5VA 4FEGA 5JDCA 1ENZA 2IOFA 4ZA2A 5LQJA 1P5FA 2Q1UA 3L7KA 3VPAA