3CF0A

Structure of d2 subdomain of p97/vcp in complex with adp
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
281
Chain Sequence
ALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transitional endoplasmic reticulum ATPase
publication title Improved Structures of Full-Length p97, an AAA ATPase: Implications for Mechanisms of Nucleotide-Dependent Conformational Change.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 93
structure length 281
sequence length 301
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2008-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF09336 Vps4_C Vps4 C terminal oligomerisation domain
A PF17862 AAA_lid_3 AAA+ lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3cf0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3cf0A01
3AKYA 2QUZA 4FIDA 2RGEA 3MJRA 1BS1A 4DRZA 4G01B 3WYFA 4M22A 1G1MA 4AKIA 3AKDA 5GJVC 2OHFA 1Z3IX 1Q57A 4IDQA 4L4UA 4I1UA 3HYRA 3G0HA 3QKRA 1KI6A 4MQBA 5J40A 1JEEA 4D0NA 3KFXA 4DT1B 1ESMA 4GT1A 2C99A 3WBKA 2VHUA 4V0OA 2WZQA 4URUR 2AD5A 4PSVA 3AEZA 5E7JA 1U0HC 1U99A 2WKPA 3H2YA 4WZAE 1E9AA 4OHZA 3H86A 1AKYA 3QXJA 1E79A 1AS2A 2V8OA 5UKDA 1NBMD 2H16A 1GL7A 3FMFA 4URZR 1E0KA 1UBFA 3A1UA 4EPTA 2IUTA 2J9RA 4XJXA 4LHVA 4QHYA 3ASZA 2DY1A 4JLBA 4MYTA 2BIFA 121PA 3CX8A 2IYTA 4U00A 1W36D 3DVLA 3ECCA 2ZSFA 4D26A 4A15A 1IHUA 3IUYA 2ZJYA 5FOWA 3OEHD 4RZ3A 4TYYA 5L8VA 1S2MA 1Z0IA 2VIIA 4ZCLA 3WMGA 2OCPA 2CHGA 1GNRA 1II8B 1PV4A 2D7CA 1A7JA 4B73A 2QTFA 5IK2A 5C4MA 3EZ6A 4EPVA 3K53A 4O3MA 5EE3A 3NXSA 1EK0A 3ND9A 3IEVA 1RYFA 1W48A 1HQCA 1JJVA 2VQSA 2W2TA 2RAPA 3HPRA 4HEJA 1HQYE 2OILA 3EPLA 1SVLA 1HEIA 5DSZA 2BMJA 4AYWA 1VDZA 3HU1A 4PSAA 3SS8A 2QPTA 3BGWA 1DAKA 1R7RA 1AGRA 1EESA 3QKSA 1QHNA 1U0LA 3VNUA 1RZ3A 2OCBA 1DO2A 1OXSC 4RKFA 2NO7A 3MRSA 3QBVA 4Q1CA 3KJIA 2A5DA 2ZRPA 1GTVA 1TF5A 4XVUA 1YVDA 1SVOA 4BASA 1HT2E 2RCNA 4BZXA 2ZYTX 3EASA 4YDSA 1NP6A 1BMFD 2BHRA 1XFAA 2KE5A 3B9QA 4LHWA 5CK5A 5EXSA 3WNDA 1XCMA 2ZRBA 2ZJOA 1B0UA 4EFLA 1G4UR 4WBSA 4DJTA 4EQ6B 4L5BA 5JWHA 2VHJA 1COWD 4B2IA 1E79D 2XSZD 3LWNA 4Z8YA 5LBIA 5KOYA 2P0EA 3CF0A 4OI2A 2J1LA 2H57A 1ZNYA 1VCMA 2GXUA 4NYJR 3REGA 4LJ6A 4O25A 1DOAA 4Z1MD 4BFYA 2FU5C 4KSBA 3PUVA 4ARZB 4BFXA 4N3NA 1KI8A 5D3MB 3QI2A 3VU9A 1EWRA 2C8VA 3TJZA 3ZVLA 4BRUA 2JJ1D 1G9XA 3CRMA 4NBSA 2WWHA 4HDCA 1KMHB 3C16C 1QG2A 3Q72A 3OFND 4TTRA 4TL7A 3FWYA 1UPTA 5GJCA 2GVDC 4UNNA 3K0SA 1NVXQ 4V03A 4B6FA 3UWOA 1D5CA 4GOXA 4BZPA 3KDSE 4M1TA 4NMMA 2VP5A 5EP4A 5C4GB 5FOVA 5JJLA 2D06A 1OIXA 3MHVC 1E2HA 5G3YA 3OIVA 4UXHA 4GRAA 4NYMR 3A1SA 1NI3A 1VG0B 5JSZA 3KW6A 3OF5A 1KO1A 3I3SR 2WPDA 4W9MC 3PVSA 2DR3A 2PZEA 4N1AA 3V00A 3QXCA 4B3XA 2IC5A 1G3RA 2CLCX 4MYUA 3DM9B 4G5RA 4Q9IA 4FMDB 2J59A 5FOSA 4BQSA 4GI7A 3V9PA 2GKSA 2W58A 2WSSD 4M9XA 4PQYA 1FNNA 1I4LD 3ZDQA 4EDHA 4LBZA 2CL0X 2ASEA 2ZROA 3A8TA 1OIWA 1K5DA 2J87A 4Q7JB 2OUKA 2BMFA 3TUJC 3FHCB 4PC1A 4H1UA 4DC9A 4IW3B 4KFTA 3TK1A 1JAIA 1W4RA 1VMAA 1XEXB 4L9WA 3TAHA 3WNCA 4F4JA 3HR7A 3U4QB 5F3WB 2BJWA 1JECA 2C78A 2B92A 2IS2A 2CE7A 2QROA 3U3JA 1LV7A 4YLGA 3BB3A 3I4LA 3TVDA 3ADCA 4MRRA 2YOHA 3VHXA 4BFUA 4EPXA 2OBMA 2CVFA 3X1ZA 1WXQA 1JALA 5HZKA 1E9DA 3UXMA 3FFBA 221PA 3D3QA 4WIAA 1DS6A 2MSCB 1E94E 3JZMA 3EIHA 4PO8A 1L2TA 5JEDA 3VLFB 2OXRA 5CIWA 3IIMA 4BFSA 2NPIA 1Z5ZA 2P67A 2X8AA 1EFTA 2JLYA 4JL8A 3SHWA 1FP6A 1US8A 5BWMA 2BBWA 5EXTA 3T34A 3VR5A 3TIFA 1JQJC 2IL1A 5DN6D 2HT1A 2CJWA 1G19A 2GEUA 3QY0A 1C1YA 5EJEA 821PA 4XH9B 2WAXA 2NQ2C 2G88A 2IYXA 5FFMA 1DAMA 5FPSA 5HZHA 1RJ9B 3L0SA 3G5UA 1GNPA 5E3HA 5FPTA 1IJFA 1G41A 2CCGA 4N0EA 3LLUA 5DISB 3J81k 4MKIA 1KO8A 4RKEA 4O0MA 4MUAA 3AUYA 2C9CA 5FTJA 5DO9A 4TMWA 4PZZA 4B47A 2XX3A 2YOFA 4AG5A 4BEBA 3RWMB 1IJEA 3I5YA 4BUJA 3BB4A 4P4UA 3GJ3A 4RY2A 1ZRHA 3GFPA 1U8AA 3EAQA 4PR0A 4DKXA 1KK2A 1AIPA 1WDTA 1KMQA 2WM9B 3IO5A 2A78A 3GD7A 4DDVA 2GHIA 3U5ZB 2ZJ8A 2F3RA 3PCRB 3N70A 1G6HA 2H7VA 4KBFA 2V6IA 3GJ4A 3UIEA 1P2VA 2KJQA 3NIBA 4M0LA 1J8MF 5FUXA 4UXIA 4TL6A 1GDDA 2JJ2A 3TW8B 1C4OA 1MO6A 3CF6R 2HCBA 1G64A 5JJKA 4HZUA 3RNLA 2GESA 3CWZA 2AKAB 2LKDA 2X19A 3AF2A 721PA 3KQHA 4DLSA 4NCHA 2VO1A 2HJGA 2WPDD 4ZIRA 3THXA 2MSEB 1KSJA 3PR1A 1GL9B 4WAUA 4TQ9A 5BN4A 4C3ZA 4L15A 2F55A 1OKKD 1UF9A 1VYVA 2XNDD 2ZRNA 4IRUB 4P3YA 2J7PA 2I4IA 4GFDA 2PMKA 1GKIA 4M9QA 5AJYA 1DE0A 1KZ7B 3EIQA 4DUGD 4DLZA 2QG6A 4NKRA 2ZITA 5EP2A 5FBRB 4UJ3A 3MAAC 4B3BA 3RWOA 2OZEA 2IYUA 3KTAA 3QXHA 4QM6A 1FL9A 5KNDA 2X1VA 2H5EA 3THWA 2FEOA 2P5TB 2FWRA 5CITA 1XP8A 1QHHA 3U60B 2DZOB 1TADA 2LCFA 1JPNA 1ZAKA 4TMXA 4MYHA 4LI0A 2VHQA 3FPAA 4OHXA 3PITA 4X8HA 5AUPB 2OV2A 2ZSEA 3CF2A 1FTSA 3QUSA 5JBQA 2GJSA 3FMIA 1YZKA 4D25A 2YC2C 3EWSA 4A92A 1ZBDA 1E2GA 4HZUB 5BYJA 1DVRA 2HUPA 2ZEJA 4TTQA 5BXQC 1E2KA 4M1YA 2Q3FA 1N6OA 2EWVA 4RD4A 4RFSB 3T5DA 1T91A 2J0VA 3SN6A 1F5NA 3BH0A 2YWEA 1OHHD 4LJ5A 1UBCA 2ZXUA 2A3RA 3NEJA 3U7HB 1WCV1 2QSYA 1S9HA 1L4YA 1T4GA 1EG7A 1CS4C 1GG2A 2QP4A 4CVNA 5D3QA 3WHKA 1GILA 3OE7A 1OB5A 1AS0A 1XTRA 1XD8A 5AJXA 5FPHA 3KZ1E 2Z5FA 3EA0A 2ORIA 4Q18A 3VR4A 2MMGA 4A2WA 1N6IA 1NMZA 1G8PA 2H8KA 1W5TA 3QKUA 3E1SA 2KSQA 1E2QA 1DBSA 1BMFA 3PFIA 3NTUA 4IEIA 4IXNA 4TQAA 2W6JD 2WOJA 2ZR9A 2IYLD 3CIOA 3IBYA 2OESA 4PPNA 5CDFA 2XGJA 4HLCA 5FOXA 4RZXA 1XJCA 3GJ5A 3U3KA 3O8RA 4TL8A 2GXQA 5G41A 4ZDIA 2GCPA 1S1CA 3I92A 2OG2A 3A6PC 2W0MA 4X8OA 1BOFA 5K8IA 1L8QA 3CR7A 5DHAA 4EFNA 4F4IA 1KGDA 2HCJB 4BE7B 2YYZA 1P9RA 1EGAA 5KUTA 3WP1B 4LHXA 5BN5A 5GVRA 2IW3A 2BKUA 3O47A 5DYIA 5EXXA 4TLEA 3L2OB 2R6CA 1IM2A 3AP2A 2WJVA 2W2XA 1SVKA 3RC3A 4KI0A 2JLWA 2XB4A 1E4YA 5AR1A 2PJZA 3I8SA 1KIMA 3KL4A 5A0FA 4GMXA 3MD0A 4DDTA 2HXSA 3PJRA 4KYIB 2IT1A 2ZRHA 3OZXA 3IPXA 1D2EA 2B8WA 2HF9A 2DPXA 4B43A 5JSZB 4DLRA 2KB0A 3BFKA 2F43B 3IQWA 1CJKC 3I62A 4Q1EA 2YOGA 4C0BA 4A0GA 1KK0A 4LGMA 3VHLB 2YVUA 3VKWA 2F9MA 2AFHE 1CJVC 1ANKA 2Z4SA 1S96A 2VLIA 4MUBA 1UDWA 4WVFA 2RGNA 2RGNC 4DT1A 1OH5A 2NGRA 2N1BA 3BD9A 4Q9HA 2QAGB 2F1JA 5P21A 1Q0UA 2YWHA 2JLQA 1II0A 1W49A 1LF5A 2VA8A 1OXTA 3BE4A 4CDGA 4PANA 1GVNB 3IILA 5CJ2A 4FWTA 1XPRA 3ZD6A 5H1YA 1G7RA 1KI3A 1KSHA 4H1VA 3RRNA 5GVSA 1DADA 4KV9A 2ZQ5A 1YQTA 1KI4A 3AF4A 1G18A 3PIRA 4FN5A 4QJ4A 3EA5A 4E22A 4HB3A 3QNUA 1XMIA 3HP1A 1GZSA 5BN3A 4OJQA 1VIAA 2WWFA 1RYHA 2ZSDA 3EC1A 3P4XA 5JCPA 3VR2A 1O87A 2XOKD 1HV8A 3TR5A 1W47A 5IT5A 2ZJZA 5B30A 1VHTA 2VTKA 2AX4A 1CEEA 2FF7A 2OAP1 5FUWA 1IAQA 1N0VC 4NCIA 3W8RA 3WP0A 2QP9X 5C18A 1QHSA 3T1VA 3EZ9A 1OFTA 1P72A 4M21A 3X2SA 3Q7PA 3EPHA 2UVQA 1XX6A 4AD8A 3Q8XB 3R7WB 4TLCA 3RDPA 2PBRA 4TYQA 2YJTD 4JBYA 4WZ6A 4A2QA 1WP9A 3BH7A 1EFRA 4JZKA 3L8ZA 4ACBA 3SQXA 4WOPA 3E70C 1HUQA 2ODWA 1N25A 2PT5A 5KSZA 5KDOA 2QA5A 1HTWA 3AP1A 5F2EA 4I1SA 3CRVA 2G83A 3K9GA 5HKKD 3DHWC 2XAUA 4JLAA 4LBWA 1VECA 1Q1QA 4PC7A 1P7CA 1I4TD 6Q21A 2REOA 3HDTA 2CNWA 3TAUA 1N5LA 2JCSA 3H0KA 1P2UA 4JLDA 3U3RA 4X8LA 2PMDA 2O8FA 4Q1AA 2V1XA 4G0NA 4Q9KA 1FZQA 2JATA 4HB4A 1AKEA 1SVMA 2FOLA 3SJZA 2C98A 4FWIB 2ZE6A 4DSTA 1E1QD 4LYFA 2IWHA 2HLDD 2XTMA 1LS6A 2RGAA 1ZP6A 5EUMA 5JHGB 4C2UA 1SKYE 4M1WA 4JLVA 4CEIA 3C41J 3BJIC 4AWXA 1PZNA 4Z51A 3Q9LA 5SZHB 3TQFA 1OFUX 3K1JA 3GLFA 5EUQB 4A3VB 5AJWA 2QQ0A 3UG6A 3HYTA 4NE2A 2FPKA 4W5WA 5AUQA 4PAMA 5F9FA 4GITA 2FZ4A 4CEJB 3MUFA 4PTLA 3T15A 5CLLA 1M7GA 1VCOA 3TQCA 2DFNA 1RW4A 3SU8A 4QNMA 1TEVA 3EWAA 4LCBA 4LUCA 5DI3A 3TUIC 4QBFA 4S2EA 2YKGA 1CULC 2EVWX 2YC4C 1D2NA 3JVUA 1J70A 3MFYA 4YC7A 4DEYA 2HYIC 1YRBA 1G3IA 1CR1A 3NC1C 4DIDA 3O8BA 5FTNA 3DEFA 3QBTA 2JJ2D 1QZMA 1T0HB 2NIPA 4L8GA 3NEYA 3IHLA 3CPEA 2GRJA 2Z43A 1ZJ6A 5C1BA 1OE0A 3TE6A 1IXSB 1GITA 1DAEA 4R7ZA 3BRWD 1P75A 3FOZA 4LRSA 1PLKA 1II8A 2R6AA 4PPQA 3SZRA 3QPWA 2CLSA 3U6KA 5KNCA 2WWYA 5C46F 2JLRA 3A1TA 4TN1A 4NU0A 4KBGA 4Q48A 5SZKB 4UXJA 1J8YF 4P4TA 2GF0A 2ZTSA 4FMDF 1FQJA 2FPLA 2UKDA 4K81B 3AVWA 1RIFA 3S1AA 4ZIRB 4PO1A 5KSPA 1AZTA 2GZDA 3KKOA 2JJ8A 4DLWA 1UBEA 5K8UA 4RZUA 1X8JA 3W90A 2IA5A 4A6XA 4DSNA 3NBFA 1CP2A 3I32A 1E2MA 5CJPA 3GLHA 3RRZA 1PVOA 4AG6A 1WBDA 2ZRIA 2V3CC 2FMXA 4YMTA 1SXJC 1SXJA 1A2KC 2Y8EA 4E5UA 2O52A 4DCVA 5HKKA 2EFEB 4TL9A 2CXXA 2IYWA 4JLKA 5TARA 4UQOA 4MRPA 2XTNA 3FKSD 1XEXA 2HF8A 1W7AA 2ZAMA 1QHXA 4OK3A 5IDVA 4IFBA 621PA 1E2NA 4G5SA 2KBFA 3T35A 2FSGA 4EPWA 3IBGA 4Q9JA 5HPYB 3MJHA 2ZETA 4B34A 2ZE5A 3KFVA 2NO6A 2BMDA 4C7OA 3TLXA 1XD2B 2FEMA 2WJYA 1RKBA 4LHYA 4FXPA 1XTQA 3QVVA 2JLVA 4TMVA 2B8TA 2BV3A 5G40A 3ZVNA 4GBMA 4YONB 3R9XA 1IN4A 1XEWX 1KO7A 1UEIA 2Z4RA 1XTJA 2BKEA 2J0UA 4IVRA 1CLUA 2E87A 2QZ4A 2VP6A 4XTRA 5K8TA 4MGZR 1I2DA 2VP9A 4IKEA 2LWIA 4BWYA 3ZVMA 3L82B 4S35A 5KO2A 2KRKA 2REXB 1N0WA 3KQNA 1TL7C 1KY3A 1YU9A 1CJMA 5LPNA 1HT1E 2LKCA 2EU8A 3KKNA 3AJIB 3C14C 1LNZA 4B2PA 2G1KA 1KJZA 3LW7A 1TEXA 2GXSA 2ZE8A 2FH5B 2XXAB 3RRMA 2P6RA 1GFIA 4HUTA 1QHGA 2BCGY 1ZM3A 1RRPA 4MKHA 1KNXA 3A1WA 4D81A 3FHTA 5KNBA 1FNMA 1H8HA 1OW3B 1U8ZA 1MRSA 1IN5A 3KJEA 4HLUC 4HLUA 4C7OB 1OXVA 2C77A 4UNPA 2ZYWX 2VF7A 4EPYA 2EQBA 5JI3E 2Z6VA 3TW4A 2ERYA 4PX9A 4M1KA 1EFUA 1R0ZA 4ZCMA 2PJRA 1X1SA 4AYTA 3PUYA 1HY3A 1J99A 4OQLA 2WWWA 1IY1A 5FOTA 4E09A 3BBPA 3GP8A 2RB4A 4AC9A 2HDNB 1HE1C 3Q5DA 3R8CA 3CX7A 1TQDA 3I61A 4HZIA 3LO5A 4FCWA 1YR7A 5G53C 1SXJD 3GCGA 4NTZA 4LJ8A 4M9ZA 3VR6A 1KDPA 1U2RA 2A9KA 4A8JB 4C30A 2ZUBA 4C2TA 3AVYA 1SXJE 1CR4A 4OI1A 3QF4A 3GJXC 3VX4A 1FFHA 3GLHB 1TAGA 2DWOA 4KJZA 2P5SA 8OHMA 3M1IA 3BFXA 3ZLJA 1M7BA 2WICA 4HSEA 5J4LA 2R65A 2VL7A 2XB2A 3GJ8A 2V9PA 2F9LA 3OIUA 4AKEA 4Q9LA 1JXMA 2JLXA 4M1MA 3TRFA 2ANCA 2JLSA 4R9UC 4DZZA 4I4LA 2CDNA 2VRWA 5LD2B 4FINA 3SDZA 3AB3A 4Z54A 2C9YA 2Z83A 4EPRA 4KHZA 1OH7A 3GLIB 1OV4A 4OL0A 4QRHA 4Q4AB 5B57C 4GPTA 1N6NA 2AXPA 2D7DA 3GLGE 4JL6A 3PEWA 4TZ0A 1G3QA 2BM0A 5JECA 2WSSA 3FFAA 2WWXA 4Q03A 5JLJA 2PEYA 2XZOA 2RMKA 2PCJA 2XZLA 4DLUA 4ILEA 5EE9A 1EWQA 2ZRLA 3UKDA 2ZI5A 3DOFA 3K0FB 4WZBE 3V4FA 1Z6XA 4B3FX 1X37A 1UADA 4A8JA 2VF8A 4A8JC 2MSDB 4LY6A 2IYZA 3FKQA 3THXB 4Q1FA 4M1OA 1VYTA 4JLPA 4NYJQ 4RD6A 5DI3B 3DMNA 2FFBA 3A37A 5LDDC 4ESVA 4AKHA 3W6PA 2O8BB 1YR8A 1QVRA 1NN0A 3B1ZA 4DCTA 1R4AA 1ZNXA 2BM1A 5K8LA 3IPYA 2WKQA 1NSTA 4EJSB 4D0GA 3NHAA 3ZJYA 5LB4A 3GLFE 4TTPA 3MWKA 4ZKDA 3CNNA 1P9NA 2Z0MA 4CT5A 2WJIA 3SJBA 4EFMA 4Q4LA 3CKLA 2PX0A 3B85A 4PAOA 2SHKA 1UAAA 2CHQA 1H8EA 4TLDA 3SR0A 3IIKA 1XJQA 4PPGA 3UMRA 1AJEA 1HURA 4JT4A 3I8XA 2OLJA 3D6TB 2B7BA 1OB2A 4Q4HA 2J7PD 3AV0B 3IGFA 4HLDA 2N46A 1W0KD 3CBQA 1G291 1ZUNB 2IBMA 3THOA 1G8HA 4I1VA 4TYNA 4M4SA 4Q47A 5HCNA 5J4KA 1NVWQ 1E1RA 1FMJA 2O0HA 1KK3A 1AN0A 2DB3A 5FL7D 5DH9A 1E2PA 4QFMA 1QHIA 1NN1A 3ZH9B 5GJWC 4QM7A 1N6RA 4HDOB 1FQKA 4EUNA 2RKOA 3WY9A 2IEZA 3A4LA 2IWRA 1E0AA 1AM4D 3PEVA 2F43A 2JJ1A 3W6OA 1OH6A 4BLTA 1N2CE 4DB4A 4JYBA 4ZKEA 4RD1A 3I72A 4B3GA 1G4AE 1OYYA 1XMSA 3EC2A 4M1SA 2IS1A 4JIMA 3N5CA 1DO0A 1Z6TA 1JBKA 3SC3A 4QGHA 3K70C 3EARA 4JJZA 4TWZA 2WAYA 4FMBB 2V7QD 3UATA 2F1IA 1KJYA 1VG1A 2F3TA 2VP0A 4A0FA 2DWZB 1R5OA 2JAQA 4HAVA 1S3SA 2H18A 1G8YA 4JVSB 1J2JA 5A4JA 2Q21A 1GKYA 1U9IC 1U9IA 2XNDA 2JA1A 4D2IA 1NL3A 2PCLA 2G1JA 3CWQA 4TSFD 2G0NA 3KXKA 1S0UA 1Z2AA 1YHNA 1W5SA 1TTTA 2W6JA 1M1YE 2FSIA 2VHTA 3BORA 2JIZA 2XSZA 5JS8A 1UBGA 5IF9A 3T1QA 2FGJA 3TVTA 3ASYA 2E9SA 4OKSA 4KU4A 3JZAA 3BWDD 1K8RA 1SHZA 2ZVQX 4XD7A 4JLOA 3SYLA 3CO5A 4Q01A 4F91B 1CRQA 1ZM2A 1FTNA 3I5XA 2OXCA 4C0AC 1SHKA 1N0UA 1ZC4A 5B2ZA 2GJAA 2AN9A 2GWHA 1JR6A 4LRWA 3LBHA 3FMPB 5FTMA 3BXZA 3THYB 1N5IA 1TQ4A 1I2MA 4ZPXA 3B2EA 1N6PA 4PC6A 2CK3D 3EW9A 1E0SA 2E1RA 4G1UC 3L43A 1NG1A 2DWPA 3H4MA 3CLVA 1B23P 3LXRA 1LY1A 2IYRA 2ZR0A 3NKVA 2D4HA 3SEAA 4RD2A 3GLFB 1W0KA 3SBEA 1R6BX 2ZR7A 1IOZA 3EG5A 2FX3A 3KQUA 3AVTA 1MO3A 1MT0A 2CE2X 5JRJA 2ORVA 1VG8A 1JR3D 4M2LA 3R8FA 3E2IA 3FE2A 4B48A 2FNAA 3P20A 2QMOA 4BLQA 4AY2A 5FPKA 3CH5A 4AURA 1E2EA 5KSOA 2VP4A 2V1UA 2Q9BA 1ZM4A 3D8BA 4JSYA 5B64A 4F7WA 4R98A 4XD7D 4QGFA 4Q4HB 2GEVA 1GL6A 2F7SA 5DE3A 1JI0A 1Z63A 5JJIA 2BBTA 4B35A 3SFVA 2R6GA 1T5LA 5JI2E 3T12A 5FBWB 2BMEA 3GFOA 4BFZA 2FFQA 4IJMA 4JVLA 1E3MA 1II9A 3BFVA 4XVQA 4JVMA 3T1TA 1K6MA 1QBKC 3LLMA 3QKSB 3GLIE 3PEUA 3TR0A 1E98A 2QE7D 1Q21A 2GVZC 1X8LA 5EE1A 4DSOA 5L3QA 4LK2A 4C0KA 4B2LA 3KX2A 1DG3A 3NHBA 5F98A 4BFWA 3AM1A 3ZQ6A 2J0QA 1W4BA 4MRSA 3U2QA 3LA6A 2WOOA 2QNRA 2QMUA 4YMWA 3SYNA 4OI0A 3F0TA 1YJ5A 4G5QA 4HUQB 3EIEA 3AGPA 2A7QA 2V54A 2OE2A 2XOKA 3GJ7A 1AQUA 2KBEA 4JBWA 1NLZA 1U81A 1KI7A 3OIYA 1SVWA 3IHWA 5CIQA 3TSWA 3ZS8A 2RGCA 1KAGA 1W44A 2FJUA 3GEEA 3HU2A 1QG4A 3VX3A 2IUSA 5FOUA 3ZZUA 2AFIE 4L9SA 2WMNB 2O5VA 3RS0A 4ZCIA 1WRBA 3SE0A 3K9LA 4LBYA 2BOVA 5HR5A 3NH9A 4RVCA 3L0OA 2ZANA 2IF0A 2OFWA 2YINC 1BKDR 3SJAA 2OM2A 1T6NA 1W4CA 4LJ7A 1GNQA 3DKPA 4LJAA 4A1FA 2Q0HA 3K0FA 5ELXA 1NRJB 3W5JA 1HA3A 2OBLA 3HR8A 2ZI3A 3LH5A 5L3SB 1GRNA 4BGDA 3WRXC 4QGAA 3MWYW 3AVQA 2ZJ5A 4FWDA 1OF1A 2RGBA 2QL6A 5JCZA 1RRGA 1IN7A 1G6OA 3PEYA 3NDPA 3W8NA 3HU3A 1XPUA 2WVJA 1ZU5A 1XCGB 3OESA 1XTKA 1DAHA 4QXAA 2RGXA 4P32A 1XEFA 3GJ6A 3CM0A 1P2SA 4PXAA 3I1FA 1JJ7A 5CB8A 1E1RD 2P2LA 4EAQA 3VQTA 3AKEA 3GEHA 4V0ME 2FZLA 5FL7A 2JLZA 1Z0JA 3B8HA 2EFDB 3FYHA 4G5GA 3F5FA 4WXRA 5E4FA 5KDDA 4EQ6A 3KQLA 2Q3MA 1Z0AA 3X1XA 1XXHB 1JXOA 3UG7A 5FBQB 3RABA 4D4MA 2KI5A 2CEAA 2ATXA 2IHBA 3P27A 3QEJA 3CW2A 3SQWA 2ONKA 4I81A 2GEDA 2XITA 4LC1A 3V4RA 1KKMA 1XB2A 2OCAA 2R44A 4ZDKA 3C8UA 2WWGA 3W34A 4JLNA 2QMEA 3PUXA 2AK2A 2WJGA 1E2LA 4IOLA 3E5HA 3KJGA 4QHSA 4H9GA 1A2BA 2VPPA 3U44B 3VMFA 4PPFA 3U3MA 2BEJA 5HE8A 2Q9AA 5KU1A 3LY5A 1CBUA 4IDOA 5E7IA 1MV5A 4CZ2A 2ZS7A 1E2JA 1VTKA 1SQ5A 3CZPA 4JLJA 4OI4A 3SYKA 4WA7A 2A5JA 5F9HA 1XTSA 1RE0A 4OK5A 2GJKA 1E1QA 2F6RA 5M04A 4ITRC 4PZLA 5H70A 3HWSA 1Y3AA 2CLDX 4OBEA 2EYUA 2QEQA 2BCJQ 5D3MA 3ETLA 2ZRAA 4ERNA 1E9EA 1GOTA 1Q44A 3B78A 3BAFA 1CJTC 2ZYVX 1X3SA 3QG1A 2MMCA 4JJKA 2FG5A 4HAWA 4Q1BA 4K8OA 1ZCAA 1OIVA 1XRJA 4R2HA 4IFEA 2WHXA 1GRRA 3W9YA 2O8DB 4Q21A 1MABA 3U7GA 3DKVA 4E07A 3BOSA 1XD2A 2GTPA 4NDZA 3H84A 1YZQA 3PV0A 2J46A 3B1YA 4CEHA 1NG9A 1AA9A 4Q00A 3BB1A 2A5GA 2YWFA 4NZYA 2B21A 3LXXA 5FI0B 4YXWA 4DLXA 2CK3A 3FMOB 3U44A 3R9WA 1NSFA 5EE0A 4DEXA 1ZC3A 4RJLA 3OEED 1NLFA 2OO7A 2NG1A 1M7HA 1XD9A 1E69A 3OHMA 2QT1A 1KK1A 3P32A 4PSKA 1W36B 4MDEA 4FI3C 2W6IA 4RCYA 5BW8A 4ABYA 5JZVA 1JR3A 2OT3B 2WIBA 3QKRB 5B58C 3THYA 5KPJA 1DAFA 5JWOA 3Q85A 5J5CA 5AK0A 4CIDA 4GP6A 4B32A 4DSUA 3ZD7A 5TY0A 4PFSA 1KI6B 1CR2A 4U02A 3AH8A 5FH9A 4P4SA 1VYUA 4MDFA 3LBNA 2WSMA 1Z22A 2FA9A 2H92A 1RJ9A 1KDTA 4HB0A 3DZ8A 2WTUA 2J7KA 1EFCA 4FCVA 3KTAB 4RSGA 3RHFA 4MKGA 4A0RA 4M9SA 3THWB 2VSFA 2ZRKA 2IYSA 4US1R 3BC1A 4JKIA 1KMHA 1AK2A 1T9HA 1TNDA 4OYHA 1QF9A 1Z0KA 4DB2A 1MRNA 2A5YB 2G9NA 1RRCA 4XSHA 1SULA 2QAJA 1OHHA 4WW0A 1BH2A 2YZ2A 1QZXA 1HYQA 4FW9A 1U98A 3T61A 1TUEA 1N5KA 1Z07A 1ZMXA 2ZREA 3BS4A 1A82A 4P0TA 3RRYA 4DBLC 4DXAA 4DLVA 3K9NA 5DLQC 1LB1B 1T0JB 4B6EA 2D2EA 5TDHA 1MOZA 4A82A 2CNWD 4U7DA 4B76A 3VTKA 2R9VA 3QENA 5KTYA 4IVPA 5DHFA 1IBRA 4RFVA 3GFTA 1RRFA 3ZIAD 1TF2A 3EXAA 3W3ZB 4MYCA 5TVKA 1ZW6A 3D31A 4KFSA 1DEKA 1ONBA 2EWWA 2ZSBA 4NCJA 4KVGA 1KDRA 2ZRDA 2DFTA 2IS4A 2TMKA 4R2IA 4PQFA 1D9ZA 1E9CA 2IX3A 5JWRA 3VAAA 4GL2A 2ZRGA 4UNSA 1NN3A 5JRZA 2WWIA 1OFIA 4B74A 3B6EA 4UNQA 1GAJA 4TT3A 3K70B 1FUKA 4W5HA 1Z0DA 2XXAA 5JFGA 4GSYA 1LF0A 3X1WA 1GWNA 1T3LA 1GM5A 1M74A 1M34E 2QORA 3A58B 4D4KA 4I1OA 4IHQA 2QPAA 5CB6A 4OQFA 3LQRA 3K70D 2R2AA 3B1XA 2ODEA 4QKQA 2F1HA 3VU9B 3K8YA 5TMPA 3TH5A 4Q7LA 2CHVA 1KI9A 4KLNA 2ZJBA 2BBSA 3AGQA 3X1YA 2J45A 3LBIA 4HLQB 5SZJA 1W1WA 3U61B 2F1RA 2I1VB 2CJWB 1J90A 1YZUA 2FPMA 1O3YA 4Q19A 3NBZC 5CYPA 1XTIA 5JHHB 2PLFA 5DYGA 4XOIA 1Z6GA 2O8CA 3AF0A 4AK9A 2C04A 2O8BA 4Y0VA 2QENA 1U94A 1UKYA 4JL5A 1Z06A 3QXSA 2QBYA 3QE0A 1G21E 3KXIA 3WRYC 4IDHA 2VBCA 4GZLA 4IDPA 4OHWA 4BLOA 2ZE7A 3FB4A 4XTCS 1T8TA 5KHOC 1AQYA 1ESNA 1UFQA 1R5NA 2GBLC 2GBLA 2H17A 3I73A 3QF7A 1KJWA 4II7A 5J4YA 2YWGA 2ODBA 1KI1A 4PQRA 3CH4B 2BVNA 2BJVA 3TUZC 1WBBA 2QRZA 4LDJA 3JVVA 1UKVY 3CNLA 3SOPA 1NKSA 2R8RA 4LYJA 3DO6A 3IKJA 1P61B 1IN8A 2GETA 3PG5A 3TSOA 3T1OA 3LAWA 1IY2A 2OEPA 4NYIQ 5IHPA 3TGPA 2OFXA 2C5LA 1VCNA 1E9SA 4JYCA 1W2GA 3LDAA 4V0KA 4QBIA 4CT4B 2OAQ1 1L7VC 2ZUDA 1G17A 1TU4A 1W0JA 5L3SA 2I1QA 1D9XA 2UZIR 3C15C 3TSZA 2Q6TA 3UWKA 1UEJA 3ZQJA 1KDOA 2D2FA 4MGYR 1M8PA 3X1DA 3ADBA 3LV8A 2JLUA 2RH5A 4Z1MA 3Q5EA 3SHFA 3LFUA 1GRQA 2B7CA 2AKYA 3MWLA 1NMXA 4RCZA 1NIPA 2R62A 3LQQA 3O8CA 2VEDA 3QKTA 1D8TA 1E96A 1NF3A 4MGIR 4NP6A 1XZPA 3R7WA 4NH0A 2VH5R 5H8WA 2NOAA 3FGNA 1JNYA 4QBGB 4MH0R 1F2TA 2H1LA 4NCNA 2ZU6A 2IK8A 4NYIR 4TYWA 1Z28A 1T5IA 1WA5A 3DL0A 3LX5A 4F4CA 2JEOA 2GJ8A 1CKEA 4LJYA 4MITA 1DELA 1TPZA 4TMKA 2QTVB 3CONA 4YMSA 1S3GA 3RS2A 3OEEA 1NMYA 5KPDA 3NVAA 5EP1A 1TU3A 3WBJA 1Z47A 2AWNA 4KYUA 2IYYA 1S4QA 1XDBA 1RFLA 4HAXA 4MA4A 4F92B 2IYQA 4LRTA 4GNKA 1XXHA 1NVVQ 1Z83A 5DIFA 4LX0A 3G82C 5FR2A 3QSYA 2IXEA 3FKSA 4DLYA 4A6PA 5E7MA 4BEJA 2ZRCA 3ZYCA 3B7GA 1QRAA 3PENA 1ZUHA 2ATVA 3RS4A 3SJCA 1TQ2A 3UANA 421PA 1X6VA 2C03A 3KQKA 1NN5A 4LOAA 3AVUA 2HEIA 3CX6A 4C9BA 2GZHA 4TQUS 1EX6A 1OYWA 2XJ4A 4HDQB 2NZ8A 1DAIA 1P5ZB 1TF7A 2WKRA 1G5PA 5CM8B 3DPUA 1J7KA 1YKSA 2ODNA 3FTQA 2IS6A 2AXNA 5J4VA 1FX0B 2C9OA 1ZD8A 2JIZD 2VP2A 3CPHA 3OAAA 2CVHA 2DBYA 1G8GA 2FFHA 1Z6AA 3A36A 4EKDA 2QGNA 3UMSA 4LJ9A 2XTZA 3K0CA 3K0CC 3NG1A 3MG9A 4URXR 1U0JA 3TMKA 3AVVA 3SI7A 1F48A 2WBLC 3B1VA 4P31A 4A0HA 3RC8A 4A2PA 3OIWA 3QG5A 1X86B 3VR3A 1N6HA 1G7SA 2ZM5A 2GILA 4V0NA 1PLLA 1VPLA 1BIFA 1R0XA 2DFLA 1AS3A 4HAZA 4IOJA 3VR1A 1R5BA 5AJVB 1V43A 5HCIA 4C4PA 5L3VA 1P60A 2GF9A 1QVAA 2QT0A 2EFGA 4MRVA 5CLQA 2I3BA 2V7QA 4B3CA 1YZTA 4B33A 1CIPA 1I4DD 1NBMA 4LSGA 1G5TA 5EE5B 521PA 3NDBB 4Q02A 1PJRA 1ZNWA 1LS1A 2FGKA 5TB5A 2GJ9A 1G3UA 2BDTA 4AIIA 5IRCD 3S1AB 1KO4A 5G3ZA 4NYMQ 1Q3TA 4TSFA 1S8FA 2K5UA 4QG7A 2YNMA 1Z08A 4JT2A 1ZUIA 4GDFA 1W46A 3ND8A 4QC2A 1FW6A 4FWGA 4C0LA 1NVUQ 3K09A 3K09C 4C0HA 4BLRA 4AKGA 4JVNA 4ZDWA 2CBZA 2FFAA 2PL3A 2RHMA 3IO3A 3KXLA 1F6BA 2ZS9A 5KYKA 2VHCA 1PUJA 2OLKA 4MGKR 1XBTA 4TMZA 2AD1A 4UKDA 2A2ZA 1OLOA 1IY0A 1KSFX 1XNJA 2DCUA 2X2EA 1UM8A 4G5OA 4KO8A 3K0AB 2ZI9A 1YE8A 1YRAA 2G77B 1TQ6A 4TT3D 1KZGB 4D6PA 3GPLA 4AYXA 1NKTA 5FBVB 1UKZA 4QOSA 4CW7A 2GXAA 3CB4A 2PT7A 5J47A 3MSXA 3NH6A 1M6NA 1NNEA 3MMPA 3WHLA 2EFHB 3IDQA 2W83A 2FV8A 3VNVA 1CR0A 3AVOA 2O0JA 3U7FB 1KKLA 1GSIA 3QVUA 3L8YA 3MLEA 3C5HA 4LV5B 3GLGB 3ZIAA 1ZIPA 3RYTC 3GJ0A 2V55B 4DUGA 2QN6A 1E9BA 4CEJA 4POAA 3REFA 1PUIA 4O2LA 1YZLA 3M6AA 2BWJA 3B5JA 4QHTA 3B9PA 1NVMA 4D4JA 4DCUA 4LC0A 2UZ3A 2QBYB 1NY6A 3UK6A 2QPOA 4C0QC 1OH8A 1C9KA 4LPKA 2GZAA 3C5CA 2XJ9A 3P4YA 4A9AA 1CU1A 2J5XA 3ZVRA 1P9WA 2GK6A 1OXUA 2REBA 4OQNA 1F3OA 1X8KA 1KHTA 2CCJA 3OFNA 4Q5IA 1KO5A 5HE9A 3UPUA 3GLHE 4QGGA 4LWZA 4Q4AA 3DM5A 1MO4A 1PLJA 1SXJB 3LD9A 2PZGA 3L0IB 4DWJA 4ZI3A 2GK7A 1V5WA 3A4MA 4RD0A 1N6KA 1YZNA 4KVAA 5TV2A 1X1RA 4L16A 2W0SA 1OSNA 3PUWA 3CRQA 2VSXA 3BERA 4PO9A 2V6ZM 1VKJA 2ZYUX 2QMHA 3IEUA 1NJGA 3CZQA 3IIJA 1JAHA 2ZI6A 1ZCBA 5FL3A 1Q3HA 4Q7MB 3HJNA 3W5IA 2PLRA 2HJVA 4B71A 2O8FB 1Q1EA 2ZPTX 2FDCA 2WJJA 3RSLA 3ZZ0A 1CTQA 2XZPA 1G20E 2WV9A 4OJKA 4XSGA 3AP3A 1Q1ZA 2NO9A 4FD2A 1GKUB 4F93B 2O8EA 2DVWB 3D7MA 2IUUA 3U6BA 3L0PA 1ZNZA 3AVPA 3P1JA 4BLSA 4CGZA 1P2TA 4US0R 4FMCF 3SFZA 4LBVA 4DDUA 1ZYUA 3LVRE 4YQFA 1A4RA 3GEIA 3OEHA 1UKEA 3EZ7A 4CYMA 1BYUA 3CNOA 2AHOA 2R6DA 1E0JA 3C7KA 4URVR 1F2UB 1OT3A 2P6NA 3FVQA 2D74A 4LHZA 1G7CA 2CMKA 1F2TB 4ZO4A 2PX3A 1T3HA 3F3YA 2YV5A 4HUQA 3QPVA 4BLPA 3EPJA 1MR3F 1E32A 3DOEA 1D2MA 2G6BA 1SVIA 3NBXX 3Q3JB 2O8CB 5FPYA 2CCKA 2YHSA 4JMPA 2JDID 4JKYA 1DG1G 2GAOA 3K0EA 4B75A 1EXMA 1OFHA 2C95A 3N2IA 1IONA 4TLBA 4URWR 1OPXA 1SZPA 4LJ4A 3H1TA 1ZVQA 3KUCA 4DIEA 1XEWY 1ZD1A 2DFKB 3B1WA 4DHEA 2EFCB 3WNBA 1EX7A 4QJ5A 5FUYA 5HTKA 2P3SA 2FSHA 1OJLA 1FP7A 5LD2C 4HATA 1FPMA 3RS3A 4KCGA 3M0EA 1DARA 2GNOA 4OK6A 3K0AA 3CRRA 1W0JD 4HAUA 5AJZA 3W6NA 3QOFA 2O8DA 2J41A 4JLMA 4ARZA 1KAOA 1P3JA 1XPOA 3KKPA 1E99A 1G3MA 1OXXK 1TMKA 4C0JA 3EX7C 1WB9A 4G3XA 2BC9A 1XF9A 3N2EA 5E95A 1A1VA 4DDWA 1R10A 2ORWA 1NJFA 4ON9A 1FUUA 2IXGA 3KB1A 3QPUA 4HAYA 5EZ5A 5CYOA 3TNFA 4PHGA 3U3OA 1JPJA 4Q7KA 1N3BA 4Z8XA 2D62A 1KI2A 4I99A 3VFDA 1Q1BA 1Y63A 3Q7QA 3A1VA 1SGWA 2GCOA 1BO6A 5JMTA 2ZUCA 4TMTA 4EJSA 4EJSC 1SKQA 2KWIA 1T8UA 4YMVA 4GOJA 1MKYA 3PUZA 4Y0AA 5LB2A 4ACAA 3UMFA 4XVRA 3R20A 2QGZA 1VCIA 1XJ0A 3RLFA 1NIJA 2W6ID 4K46A 4NPHA 1P4SA 1WQ1R 1Z29A 4BPBA 4IOMA 4Q4JB 5AWFC 5BQ5A 2JGNA 1DAGA 3RSOA 1JR3E 4JBXA 4RFSA 1KSGA 4A36A 4GMDA 1AGPA 4OQXA 5EZ6B 1JB1A 5DNYB 1NY5A 3PXGA 1L4UA 5EP3A 1DPFA 1G7TA 1LVGA 1NLYA 2J3EA 4OHYA 2A5FA 4OQMA 5FBLB 4HYYA 2ZRJA 4KODA 1G5RA 5CK4A 1EFRD 3W3AA 2J0UB 1YR9A 2NO0A 3AKCA 3B82A 4P33A 2IHYA 3CUEF 1BYIA 1JEDA 1MO5A 3NC0C 4J0QA 1M2OB 4U5XA 1E2FA 3P26A 3KJHA 4TZ6A 1US8B 3AF1A 4RD3A 4DCSA 4DCNA 4ZDJA 3PQCA 4ESHA 2OFOA 1R0YA 1VHLA 4D82A 2BEKA 4IDNA 4O2RA 2NO1A 2RGGA 3K9HA 2X2FA 3O8DA 1RC8A 3GQBA 3KB2A 4IXMA 3ICQB 3VKGA 4GP7A 1GIAA 1Z6YA 4LV8B 5L3RA 5JEEA 1Z0FA 2RGDA 4YXWD 4V02A 4NCKA 4XWKA 1KOFA 3EPKA 2NPFA 2ZAOA 4KFRA 5FTKA 2EYQA 1IN6A 1N5JA 2QY9A 5FI1B 2QE7A 2NTYC 1A5TA 3QQ5A 1QDEA 1S9DA 1UDXA 4KFUA 1U8YA 4CF7A 3BIFA 2J0SA 4XWAA 1XMJA 4GOKA 1RVDA 4XWOA 1F60A 1SVSA 1R8QA 2QSZA 4JS0A 2VSOA 4KXFB 4B3DA 4KSCA 3U7EB 1H8HD 1SKYB 1E6CA 2VYFA 1NVVR 3WYAA 5A5GA 5AUOB 2HYDA 1MH1A 2HXYA 4LYAA 5TXGA 4JN6A 1XMVA 4YDHB 4BECA 3ADKA 2Q3HA 1KNQA 3AVXA 2ZVPX 4BFTA 3FHOA 5BYKA 3ZZTA 1HH4A 1WE2A 2Q9CA 4URYR 5DGXA 5JS7A 1R2QA 4PHFA 2NMVA 3F8TA 2C2HA 2PH1A 2PEZA 2NZJA 2DZNB 3WYGA 2G3YA 3T5GA 1KYIA 2ERXA 4P4SB 1XZQA 2WIAA 5CDFE 1FOEB 1WMSA 4DLTA 4R71A 2P6UA 4IVQA 3ICEA 2ZS8A 3SBDA 5FTLA 4QJ3A 2AR7A 1Z2CA 1ETUA 1KTVA 3KKMA 4KLZA 4BRWA 4F38A 1ZIOA 2GCOB 4UJ5A 1T3SA 1G16A 3MWJA 2GDJA 4QL3A 4ZV4A 1LW7A 3NWJA 1EFHA 3KKQA 2QM8A 3WMFA 1VG9B 2QRNA 1OKKA 1XXHE 2G0TA 2ZRFA 1E2DA 4A4DA 1ODFA 1GP2A 1TUIA 1XCPA 2W00A 1ZD9A 3U4QA 3HPQA 3RS7A 1W2HA 2DWQA 1E9RA 3GLIA 3CR8A 4OHVA 2O8EB 2X77A 1QHHB 1GUAA 4BFVA 4NHOA 2R6FA 1DTSA 1QHYA 1COWA 2DHRA 3RAPR 2JASA 3RANA 2W2VA 4C0SA 5J4HA 4W5JA 1H65A 5ANRB 5EQTA 1XU4A 2ZJ2A 3LW8A 4NONA 3OAAD 1D6JA 4LPSA 4RZ2A 5H68A 2ZSAA 2IF2A 2JDIA 2HV8A 3WXMA 2ZIAA 2ECKA 3EZ2A 3QXXA 4UNRA 4GZMA 5KSYA 2WMOB 3LX8A 3ZS9A 3DMDA 4JSTA 1HE8B 5KDLA 5L3QB 5GADl 1CF4A 1RPZA 4CEIB 1YZGA 5CM9C 1ZM9A 5C2JB 1LFDB 1H8ED 4PAQA 4D0LB 5FUVA 4DVGA 1WF3A 2D3WA 2ZRMA 1S1MA 2HLDA 2AL7A 4D4LA 3C4JA 2EW1A 1ZM7A 1Q12A 2ANBA 3EZFA 2ONJA 3LRPA 3ZGXA 1W4AA 2N42A 3M4YA 3QF4B 1R8SA 4PC2A 2IYVA 2OSBA 4PC3A 2QU8A 2IXFA 4Q1DA 1JQLB 5EXPA 2DYKA 3B60A 4V0MA 4US2R 3OE7D 1CRPA 1Z8FA 2AWOA 4MRNA 1C1KA 3ADDA 4LV6A 2A30A 2V6JA 3BK7A 5FR1A 4ASUD 1IXRC 4KITB 3DZDA 3GMTA 1R0WA 1UJ2A 1ZINA 2RHDA 4ZI2A 2P65A 2OCYC 4W7SA 3R9IA 4IOKA 2V4ZA 3KUDA 1IQPA 3WMEA 4QNRA 5AUNB 3QIAA 2FE4A 4QBHA 4FMCB 4N0DA 1P6XA 1P73A 4LYHA 3AQ4A 1ZU4A 3TBKA 4HI0E 2GAAA 5SZIA 1ELOA 3CRW1 5GJBA 4WXPA 1YR6A 3B13B 4KAXA 2OBNA 5DN6A 4HB2A 4D80A 3VKHA 3A4NA 2ZI7A 4EIWA 4M53A 2QI9C 5DI9A 4X8MA 1LTQA 4FCTA 2QM7A 1U90A 1G8FA 4CRWB 3ONWA 1VIYA 3QEOA 3GLGA 2CL7X 2L0XA 4YMUA 2GCNA 4IEEA 1F2UA 3FDIA 3CPJB 4Q66C 3SNHA 4MKFA 4FWHA 1E9FA 4TLAA 3LVQE 2FN4A 2FSFA 1FX0A 1NBME 3LNCA 3NBYC 2QQEA 4XIGS 3AF3A 3QJYA 2CL6X 3T06B 1KY2A 1E2IA 4ASUA 1Q20A 2IEYA 2QP3A 4LZZA 2BBOA 1IXZA 2QTHA 2XEXA 3RS5A 3RVBA 2ZU0C 2AK3A 2HT6A 4CEHB 1AZSC 5IK2D 1FMLA 2B6HA 2XNSA 2QAGC 2QAGA 2O0KA 4PHHA 4Q4JA 1MABB 2C96A 1TX4B 1P62B 1CXZA 2PZFA 2WJHA 4BZQA 4V0LA 3BH6A 4E03A 4TYPA 3TKLA 1K5GA 4B44A 4AI6A 1CJUC 4PHTA 1XWIA 1E4VA 2ZJAA 3IQXA 2ZI4A 3MCAA 1W36C 4PZYA 1Q22A 2GA8A 3AUXA 3MGCA 3DDCA 1N6LA 4NL4H 4M8NE
chains in the Genus database with same CATH superfamily
4D3DA 1HDYA 1M72A 3EAFA 2RGEA 2F8TA 1G5QA 4DV6M 1RQPA 3PNLA 4N5LA 3BWVA 4WKCA 5GJVC 3ANNA 4BX3A 4F2HA 5KJ6A 4MEBA 4FB5A 4I1UA 3HYRA 4AECA 5JD3A 2VHVA 2AUTA 4GT1A 1XK7A 4CBVA 2SCUB 1EGMB 2VDPB 4MA5A 4C21A 3L41A 1L5GB 1XNGA 4KPEC 1M6WA 5E7JA 3Q88A 5CAEA 4M0MA 1IMJA 4L7QA 4ZALA 1C7QA 4L76A 3IAUA 3H86A 1Z18A 1EXWA 1UC8A 3BK2A 3I8OA 4OO3A 4R1LA 1F0KA 3IA7A 2FZEA 4GF5A 2V8OA 3KOZA 4FMPA 1QB7A 3AHGA 3G9TA 1UBFA 4JC5A 4OREX 2A6PA 4GMFA 2IV3A 3L8MA 4XJXA 1T8YA 3RIXA 2ZB7A 4EPTA 4BMCA 4EMTA 7ADHA 4KR7A 2I2WA 4EMSA 1A96A 2ZIXA 3CX8A 5BOSA 1W36D 3OH8A 4IQ0A 4MUYA 2X6RA 4LQ4A 1EVLA 2ACVA 2VNSA 2ZSFA 3KPVA 2JGEA 4MYSA 4A15A 3FA2A 3IUYA 3RVJA 4D26A 2WG1A 5FOWA 4MROA 5BUZA 2HSWA 3RFVA 3ESXA 1KOJA 2OCPA 5IVHA 2EQ5A 4RA9A 3DTVD 4R8LA 1GNRA 1II8B 5LMNM 1VKRA 4LHSA 1GJRA 2FS1A 2VJCA 2D7CA 3CLHA 3NCHA 4XXHA 5G4LA 5C4MA 3LKBA 2JB9A 3HCPA 1F1JA 2QL9A 1SCJA 4O3MA 3TNLA 1RYFA 4IDGA 3RVMA 1W48A 1LU9A 1B3BA 1QLHA 4YT5A 5HM8A 1M3SA 1JJVA 2VQSA 3IB6A 3W1EA 1O03A 2OILA 3EPLA 5DSZA 3TFQA 1VDZA 2VNKA 2AEFA 1HLFA 5EMLA 5DK6A 4BQRA 1CW2B 4AICA 2WNHA 3QX3A 3IELA 2XKKA 2H00A 2IKSA 4AVYA 1WB5A 2MINB 2PKRA 4MS1A 4EJ2A 4ZOQI 1QHNA 1U0LA 4LSZA 3ENNA 1LX7A 3M1YA 2OB1A 5ENZA 5KNBD 4C43A 5LWQA 2NO7A 3MRSA 4L07A 4WCVA 1FFYA 1YT5A 1Q7CA 1KFVA 2ADFA 2I03A 3O4GA 3PC2A 1GTVA 4J0HA 3ZQKA 1ZRMA 1VHJA 2J48A 4XFKA 3TI9A 3NMUF 1KGSA 4QOJA 1HT2E 2JD0A 5CM2Z 3O8QB 4X1IA 4YDSA 4N6OA 3KVOA 3PNKA 4KTTE 1BMFD 2BHRA 2UUPA 2KE5A 2B35A 3WNDA 2WFAA 5CNJA 3K8QA 3EIXA 5I4KA 4P36A 4HPJB 1B0UA 4K40A 3TLZA 2YJGA 2IH5A 1SCNE 1TJ3A 3IOCA 3I76A 4L5BA 1TJ5A 2XQKA 5DYTA 4G4QA 1COWD 3CEJA 3EG9A 2FW0A 3QVTA 4QE3A 5ALHA 5E1OA 3L6EA 5FYQA 5KOYA 3HSSA 3Q1LA 3OO0A 3CF0A 2GFQA 4WADA 3C5WP 5CU7A 1C3EA 3U3XA 4RXUA 4CN9A 2EL9A 4BFYA 1A76A 2JRCA 2WTAA 4LVCA 4BNUA 4N7JA 4TUYB 5B4UA 3ZVLA 3VU9A 3FNIA 4RDHA 3RU3A 5MN4A 1LDBA 1FXWA 3R75A 3UVEA 1NVBA 2OWDA 3BX1A 4HX2A 5D85A 2P41A 1SIUA 3PXXA 5EZYF 2JI6A 1SOWA 3CRMA 1WCIB 4NBSA 1QUFA 2W9XA 2WWHA 4BWVA 1GPYA 2PPLA 2DEUA 1V1RA 4JUCA 1D4FA 2I2DA 4MVJD 1LPSA 1HZZA 2IOFK 3FKJA 3MZ0A 2AJDA 2UZ0A 4FFOA 3K0SA 4LY0A 1NQAO 3KAQA 1L8LA 4MAAA 3DYIA 4P08A 2OYRA 3UWOA 5FQOA 3HHEA 3PNOA 2KNVA 4LGYA 2ZYGA 3H87A 4GOXA 3VNAA 3KDSE 3CZ4A 4GXQA 4JOCA 1Z6PA 4GS5A 3PFBA 4NMMA 4XCXA 4D6YA 4DR5B 3AR8A 3BRWA 5D87A 2NYAA 4EGSA 5JJLA 3FVWA 4H1HA 3AERA 3MHVC 1E2HA 3K9WA 1YA4A 1M2GA 1P1CA 2IPAB 1VG0B 1V71A 1WVMA 4IVNA 1DIOB 1J00A 1UODA 4OU5A 3TIIA 5AI9A 1SC1A 2WPDA 1RQLA 4HF7A 2DR3A 1GXSB 4N1AA 4D44A 3QXCA 5CAEB 4B3XA 3VAZA 3ZX5A 1V8FA 5F64A 3M6XA 3A0RB 1KQOA 1YC5A 2PX8A 5I3CA 1PO7A 4QPNA 1I1OA 4GI7A 2CFTA 1Y3HA 3Q3CA 3V9PA 2W58A 2QL5A 6NULA 4M9XA 4PQYA 5AW2A 1GNSA 1FNNA 2W8BA 4OGGA 3ZGLA 3ZDQA 4EDHA 5BR8M 4LBZA 2CL0X 4Q7JB 3DWEX 4BP8A 4CHGA 1E63A 4FHEA 4PC1A 3K9OA 3DAOA 4D57A 4IW3B 1I94M 4KFTA 3JQBA 1JAIA 1XEXB 3EISA 3TAHA 5J2TF 4UBKA 3EIFA 3SF0A 4L7VA 2C78A 5JCJD 1B43A 2B92A 2ZSJA 3PXBA 4HJRA 2HAEA 2X40A 4MHOA 2X3FA 4NV1A 4CIBA 1QZEA 2O1EA 2YQ4A 3BB3A 3I4LA 4IX1A 4YRCA 1G2QA 4NSOB 3TVDA 3VHXA 5BV2P 3AOEC 2QJWA 2J9FB 2ZWPA 4EPXA 3IRVA 2QUIA 4RE6A 3N75A 1C5KA 2APJA 3T5AA 2Y0QA 4LC9A 221PA 4WIAA 4JMLA 4X95A 3EIHA 2WSYB 3F1LA 1L2TA 4YCSA 2IV7A 3Q15C 5CIWA 3H4IA 3NV7A 4MUMA 4OXKA 4Q3EA 1MXFA 4UVDA 2X8AA 4MVJA 2QE6A 3KT0A 4LY3A 1GPWB 3STVA 3E22A 3SHWA 1F8YA 3HJUA 2B99A 5BWMA 1MX9A 5BW5A 3RUDA 3T34A 3VR5A 3I37X 4X64M 1VE3A 2I71A 2JBWA 1WPQA 2RAVA 3LYAA 5DHQA 5JE8A 3T52A 1G19A 5HUQA 1L6IA 2OV1A 4EF5A 3IOBA 4EHKA 5EJEA 3JALA 3KHTA 4QOZC 2NQ2C 3H9EO 3EVGA 1DAMA 5HKOA 2A86A 1RJ9B 5LQSA 4C6TB 4ECEA 1H1LA 2DH5A 4KXXA 1QLWA 3C2QA 4N0EA 2LPMA 2I3AA 5DISB 3NP7A 4RKEA 1IIRA 4M37A 4YACA 5KYWB 1YDWA 5EXDA 3HVHA 4H6XA 4Z9FA 4TMWA 4ICIA 1JDSA 2JAPA 1ACLA 3RWMB 4BUJA 1QH0A 1WW8A 3BB4A 1Z2EA 5AM4A 3UAWA 3B48A 3QVJA 2RSLA 4DKXA 1WDTA 4NBWA 4DLKA 1KP9A 2ILTA 3AI3A 3NBIA 2QN8A 4P7JA 4BFLA 2JJYA 3RGGA 4BUCA 4BP3A 1H6DA 3I4FA 3Q8LA 2KJQA 2WNIA 3PZRA 1I0ZA 4UEKA 4Y2VA 5FUXA 5ITRA 5ADWA 3EGEA 1JKJB 2JJ2A 2B36A 3TW8B 1HWYA 4WA8A 4ISBA 5KWEA 4UZSA 3CF6R 4JGBA 4KK3A 1PJ8A 1WJGA 4BJHB 3RS9A 1F2VA 3FYSA 3Q6MA 1ZW1A 4TRMA 1DZIA 2X19A 3AETA 3C98A 4R7GA 2FUKA 1IG3A 3FFXA 4CKEA 2QYSA 4XUCA 2Q2VA 3E3AA 2HJGA 1SCBA 1KQFA 1GT6A 1G6Q1 1TZCA 3E15A 5DHRA 5DM4A 4XPIB 5M3BA 2HHAA 3S2EA 4HAOA 2O1XA 4KWIA 2AG1A 3E9ZA 3ZHVA 3H2IA 3WTBA 4F2GA 4RTQA 1HR0B 1Q0RA 2ZUFA 1UF9A 1VYVA 4OGKA 4RYLA 1FFCA 1JG7A 2I4IA 1DQSA 5KEIA 1BW9A 2PMKA 3WDKA 4PYOA 4HYTA 3I9MA 1Y1QA 3QWAA 3URKA 1ZGJA 5AJYA 1EHYA 1V8PA 1YOVB 1T0UA 1O5OA 3BYZA 2P1RA 4LZPA 2UXDB 4QPZA 1YQEA 4HX5A 2VEOA 5IBPA 2KLBA 4TYYA 4MGZE 3A14A 4DLZA 4EGFA 1NQXA 4E11A 5EP2A 1CQIA 3ZLVA 4UJ3A 4OXIA 1XLTC 5J63A 3ABIA 1TCVA 3BJZA 4ZP1A 2OZEA 4I1YA 3QXHA 1ZWKA 1LW6E 1ORIA 4ETWA 3D7KA 3CXRA 5IZ7D 2I7CA 1ULZA 4OJNA 1CNEA 5EQDA 4ZYVA 2H5EA 4GYYA 2FEOA 3PHJA 1RDFA 4PFKA 1S2LA 3JQ8A 5DRYA 4BWFB 5IN5A 3FPAA 3HO6A 1H5UA 5AUPB 2OV2A 5AI8A 3QUSA 2QZJA 5CH3A 4J7AA 5FBZA 3FMIA 3FMVA 5I7OA 1GTZA 4FM9A 2C2BA 3DMYA 3L40A 4OFXA 1ZBDA 2RI1A 5A9SA 5BYJA 1OTRA 3R5KA 2OUIA 2JPDA 3HQ4O 4M1YA 4Y2TA 4RD4A 1RM5A 1YHYA 2YN2A 4L28A 1T91A 4CL3A 2C92A 1IBMM 1AF7A 3L1VA 1OHHD 4G9EA 3I2KA 4TROA 4NIMA 3O8OB 2ZXUA 2A3RA 3PGA1 1J22A 3VDPA 4CXMA 4EG3A 1WCV1 1GLVA 2L82A 1XNQM 3KR9A 1BDIA 3TR6A 3UWDA 4ZXFA 4BO9A 1EFPA 2NX2A 1F9EA 5THXA 3SE7A 1NT4A 2ZBEA 1OI7A 4I5SA 4NBLA 3WYBA 2Z2XA 1SA0A 2ORIA 4Q18A 2QN7A 3SKXA 3VR4A 3R7BA 1YR1A 3E7XA 4HRXA 4PIVA 3A42A 1MOSA 4A2WA 3PPYA 4WGGA 1T1IA 2J6CA 4C5CA 2HKJA 1WZUA 4ZN6A 1J9ZA 3KJXA 4D46A 3UT6A 5TGZA 3PLNA 1FFGA 2WOJA 3LPDA 1JG4A 2IYLD 5ARDA 3QTTA 4JI6B 3ABOB 3TGLA 5JBIA 1DRWA 2GI4A 2HI0A 5KI6A 2JWSA 1XJCA 3GJ5A 5HBGA 4BVAA 4TL8A 4U0KA 4LVOA 3CVOA 1HFWA 1W93A 1X7WA 3U1BA 2OG2A 4ZQGA 4DMRA 1GGHA 4X8OA 3T3EA 5K8IA 4EKYA 2EZ8A 3K1ZA 3DZIA 2RHTA 5DHAA 2NTEA 4Z6KA 2V45A 4M7PA 5C5IA 5D84A 4QT0A 2BFMA 4JP3A 4XE5A 2G9UA 3JARB 1YQWA 3L8DA 3I6BA 5GVRA 3CUWA 4MW0A 1XA4A 2QVLA 3EW7A 2FWMX 1NDQA 3H3JA 4ZWNA 4C4RA 2P2NA 2WJVA 3GEGA 2W2XA 5CCDA 2CZQA 3WBFA 3GPYA 1QQTA 3HM2A 4IJUA 2IZOA 3L04A 4ZO6A 2Y93A 3I8SA 4GMXA 1PGPA 3RU7A 3C0KA 2HXSA 1CF2O 4HMOA 4LMPA 4FXOA 3A45A 1JQEA 1N1DA 4R2JA 1KDZA 3W1WA 2ZRHA 3EUAA 3IPXA 4PCZA 1PT8A 2H7CA 4NNJA 5AMXA 3SIWA 2AN4A 2B8WA 2PSJA 2DPXA 3DLPX 2I4TA 4GVXA 5ALLA 5DNDA 2EKKA 1LZLA 1IOLA 1QGOA 2FUG1 3G6KA 2QR3A 2KB0A 2V3WA 3A1FA 5ER9A 3UK0A 1B15A 3U39A 3ITKA 3DTVB 3SM9A 4K86A 3HFSA 4MVJG 2XQVA 3A98B 2AFHE 1ANKA 3LCJA 3UKJA 4EA7A 1Y6RA 5JLAA 3ZTTA 1OH5A 4O4JB 1ZK4A 2NGRA 3KLPX 4EGCB 4FZJA 3ZGOA 1JQBA 1XAGA 2Z2YA 3S8YA 2F1JA 1LEHA 1NHWC 2GFIA 3KD3A 4AQDA 1JEOA 1ZN8A 4O2AF 2BAGA 3WQBA 5MHTA 5A05A 4H4EA 4QUHA 3UNXA 3J81k 2GD0A 5AKJA 2Z6AA 2PKEA 3PHLA 1EP2B 3PNQA 1DC7A 2C59A 4P98A 1MGOA 2IOHA 1X1BA 1H5QA 5G0VA 4BNDA 3FNHA 4DILA 3OEWA 3IILA 3LPNA 1PR3A 4ZYYA 4Q05A 2OPHA 3F71A 4OQDA 3TX2A 4U0JA 5GVSA 4ENRA 3GN1A 1G21A 1P8JA 1G8MA 1VXOA 1Z73A 1KI4A 2AN5A 3BL6A 4KO4S 3SS7X 5ALXA 3GRVA 2VA9A 4ARBA 3FR8A 4ES6A 2FWJA 2FVXA 1IZZA 3V8QA 4CISA 3PL1A 3A4VA 1GZSA 2F64A 3HZJA 1QCCA 2EX0A 1ECCA 2C97A 2DPGA 3GFFA 5GONB 2A9FA 3AY0A 2R1VB 3QLJA 4HLNA 1PL6A 1WW3A 2VWHA 3LWZA 3P4XA 1UBRS 2DAMA 4DS3A 1O87A 3C3DA 1HV8A 2NXJA 1W47A 2YZGA 1KH1A 2C1EA 4YHHM 2FMFA 1A71A 4GC9A 2AX4A 2C7BA 1DCFA 3A31A 3VKUA 3W5UA 4ZK2A 4CM8A 1XRNA 2WJ6A 4IUCS 1B00A 3ETGA 1N36M 3QA3E 1QHSA 2I8LA 3WLNA 3GPUA 5C8YF 3DMHA 4M21A 3ITEA 3N2NA 4LYGA 4OU4A 2JGIA 2UVQA 2Q3CA 1OFGA 3PEYA 3BHJA 3ECSA 3O73A 2WYIA 4BYMA 3U56A 2YJTD 4JBYA 4C0WA 4TRRA 1P39A 1MUUA 1Z5PA 3I12A 2CXTA 3W3AD 4LNHA 1Y98A 3PDCA 3QPCA 2Q7DA 5K6RA 2YV3A 3SQXA 4YYZA 3C8ZA 3PJEA 3EWNA 3L26A 4M7OA 4R51A 3WLFA 2CXRA 5F52A 1PWZA 2QA5A 2DECA 4LF6M 3CLKA 1DBPA 3LHIA 2F4VB 4ZAFA 3ZLTA 2QTGA 5HKKD 2AJCA 3RGSA 3OETA 1TVCA 3HJSA 1RRMA 1SQ6A 1OT5A 4GRIA 1MC8A 3DC2A 1FCJA 3F6SA 3RC9A 1K7CA 3ZCUA 3L0ZA 2DFVA 1R15A 4GXTA 5DB4A 5GV8A 2CNWA 2O3UA 2JCSA 3AR2A 4BBZA 3V4LA 2KYRA 3FCYA 3VC1A 4ZC1A 5BO5A 2V1XA 3G0BA 4G0NA 4Q9KA 2CDBA 2JATA 3VBEA 3EUWA 5T4EA 5AI5A 4GR5A 5L7YA 3WB2A 2NUTA 4TLLB 5BUCA 1N2EA 1I5RA 1Q7RA 1KWGA 1E1YA 1P0PA 4LCEA 2L18A 3EGVA 4OH1A 1E1QD 3MQ2A 4CT0A 1FNBA 3KUXA 5JNUA 3B5EA 3GARA 4D9MA 1SKYE 1DTEA 1FYFA 1Z7WA 2JK1A 4M1WA 1UT6A 2QYOA 2OOAA 3DE7X 1CUJA 3U6QA 3BJIC 2XB6A 3KT8A 5HILA 4QFDA 5KX5F 3JVDA 2VQDA 4PGAA 4DQUA 4FR0A 4MV0A 4G65A 1LTMA 1YI1A 3K1JA 4BXOA 3UG6A 5CMLA 5AJWA 2BUCA 2QQ0A 2XXBA 3IP8A 4LK3A 2R8EA 2FMHA 1GLNA 2L17A 1A8SA 4GITA 3T7RA 3T15A 1BA2A 1WZ2A 5AHOA 3I09A 3TQIA 1NVMB 1TEVA 4NG4A 2YKGA 2EVWX 1KY4A 2YC4C 3DH0A 3IP1A 1J70A 2PN1A 3ITNA 3JVUA 4MPDA 3MINB 4YC7A 5DX8A 1OYOA 4Z0TA 5CPFA 3KYCA 1CR1A 4DIDA 4QQ8A 2WC1A 3ANXA 2PK3A 1T1EA 4G0QA 1ZMTA 4RIIA 1FYDA 4OUDB 4P4NA 5LQCA 4P84A 2NIPA 4AF8A 4L8GA 1JF8A 4D5EA 3QPAA 7AT1A 3UK7A 1X1TA 2XYGA 2Z43A 3UV7A 3W79A 2GCGA 2ZW9A 3V1KA 1NQOA 2JP7A 3E58A 4TM8A 3PR2B 4LRSA 5ICSA 2R6AA 4PPQA 3ZEIA 3SVTA 2BGTA 2C7PA 3QYFA 1D0VA 1I3CA 3A1TA 5C46F 1XZKA 3OWHA 1I32A 1NW7A 2OR3A 4JDUA 3EBOA 4Q48A 3U7IA 1Z88A 1D2CA 3DUFB 4EF6A 4IGFA 2GZ1A 1TOAA 3RADC 4X20B 4GOOD 1R5JA 1B26A 2AZXA 1O57A 2ABWA 1P4RA 2FPLA 2CFIA 2UKDA 3FFWA 1AXGA 3FZQA 3MPOA 4K81B 3AVWA 3REOA 4ZIRB 4PO1A 3J2PB 3QHAA 4M7WA 4MW4A 5TPWB 1ZJWA 1PQ4A 2GZDA 2O2HA 1F8GA 1DWQA 1SBTA 3VXKA 3NBFA 3U3DA 2RCYA 2XUPA 5M7EA 2ZTDA 4ZOAA 5H80A 3RRZA 4TQGA 4AG6A 1GA6A 1ZOSA 3IECA 4KXNA 1GT91 1KS2A 2VTDA 2GRUA 4CMAA 4YMTA 1Q2XA 2MSKA 4LYEA 5E4TA 4G1MB 1ATZA 4Z3OA 3A6DA 4JV5M 2D4AA 1RQRA 2EFEB 2X4LA 2X6QA 1Q5PA 4J2HA 4EM6A 2HL6A 2W4QA 4UQOA 3RSSA 1H4QA 3BEOA 2JF0A 2XTNA 1TO2E 1U3WA 2XKAA 3JU3A 4MRPA 4PIMA 2PVCA 4D6XA 5B36A 1W7AA 3BGDA 5IDVA 1EBBA 2KBFA 3MUEA 3WL8A 2JH8A 2QJRA 2A92A 1L9KA 4RSHA 4QUBA 4E5YA 4Q9JA 1TEHA 4KR0A 5HPYB 4Z6YA 4A16A 1SCUA 3RSFA 2NO6A 4FPXA 2MWMA 4MGEA 2Y1CA 4PZDA 2PMFA 3U9SA 1T6ZA 3P4UA 4C1BA 1XD2B 1KTIA 4C7OA 4FXPA 1KERA 4X9XA 1NFRA 1BE8A 5IK2A 4MARA 4IDBA 3QVVA 1L5SA 1AKQA 3GZTB 3F1KA 1EPUA 2B8TA 2QLBA 4Y2QA 2NSLA 1FU4A 2ZJ3A 1QHEA 4GBMA 3G0CA 3KPYA 4MLCA 3UENA 5HHTA 4DIFA 1DIGA 1EVJA 5ICGA 3VU0A 1KO7A 2BHLA 1UEIA 3FLBA 3H4TA 2PX2A 1DKLA 3KSXA 1SBHA 2QRPA 4QFBA 4JB0A 4RVOA 4JB8A 2O06A 2IHUA 3OP4A 2QZ4A 2VP6A 2ZPAA 4S2UA 4BHTA 1NBHA 2YJ6A 3BA6A 2YYAA 3IVXA 3JAKB 1A2OA 5HBRA 1MOPA 2VP9A 3PFNA 4BE4A 2LWIA 3CBGA 3L82B 4UM7A 1PJSA 2AOVA 5KO2A 4MM3B 1LNQA 5CB4F 2ZBKB 2QUAA 2FEWB 3GWGA 4F86A 2NU8B 2O6LA 5BYAA 5LA6F 2L42A 1I7SB 2ALJA 4AZSA 1RQ2A 1M1XB 4J0IA 2O25A 1HT1E 2LKCA 3NHLA 2PZBA 3ZWWA 1P0FA 3BXWA 5E6RB 2EU8A 3KKNA 4FBGA 3AJIB 2DPMA 2ZFUA 4QQFA 3QVKA 1RWPA 1BS9A 3PHIA 5EHXA 1U04A 1YRWA 1ZK2A 1U0FA 2JFZA 1R0CA 2P6RA 1IBKB 1QIHA 3A7DA 2AE1A 1QHGA 1O08A 1ZM3A 1RRPA 5T4FA 4HDSB 1XDWA 5JAZA 3WGKA 3FHTA 3RJ5A 1H8HA 3CH7A 3K2LA 4ZGWA 2OAGA 1SRRA 4HLUA 4BZWA 3MTAA 3E9DA 4CF3A 4UNPA 3DE1X 4LJLA 4MI9A 3KM0A 2X5JO 4DR1B 1DQPA 3E81A 4PW0A 5KJEA 1XEAA 2WU1A 3SC2A 2C5EA 2W6PA 2WJPA 4TPKA 4K9MA 1COZA 2H54A 4JEMA 2AUMA 4YRBA 3ILXA 1P5FA 4ZCMA 1A8IA 4JI2B 1B0ZA 1HY3A 2VFAA 4D9HA 5TT0A 4JNKA 1KRHA 2WYOA 4HDMB 2C3UA 4AC9A 3GP8A 2VQ6A 2EHDA 1HE1C 4A5SA 2DOKA 1CUHA 2XMSA 1XAHA 2D8AA 4NCBA 4YCCA 4AXBA 4LWPA 2Q2EB 3W2IA 5HIJA 5EZQA 4HZIA 3LO5A 5CCEA 8AT1A 2RD2A 1JG3A 1WXFA 4KQKA 5DM2A 4QOHA 4Y9TA 4MJXA 2B5WA 4EUKA 3G02A 1SXJD 1W5AA 3I2GA 3JZIA 3W8EA 4A2CA 4P16A 1XMXA 4LJ8A 2Q6VA 3AHHA 3K8ZA 3DZGA 3RVRA 5TE9A 4RF0A 2J5RA 4CM3A 2Q6IA 3LA8A 4AO7A 4WFQA 5SV2A 4KQFA 1L4FA 5AIBA 2VUHB 4I1RA 4L0QA 3AVYA 1E3WA 1CR4A 1GZ7A 3I04M 1LPOA 3GJXC 1FFHA 4O4HB 1CX9B 1TAGA 2BEUA 2DWOA 1U2PA 4KJZA 4MW6A 1SHLA 2OFFA 4DMCA 2WICA 2FR8A 4CODB 4HSEA 4PO3X 2I8CA 5SYMA 2R65A 1B8NA 4EENA 3E2PA 3T1YM 1FSGA 1RJGA 4G4OA 2V9PA 2XODA 3OIUA 4NV3A 5HP4A 3B3FA 1DC4A 1AQLA 3A3OA 3ICVA 3SBJA 4MHSA 5C7YA 1BXGB 1W76A 2G6TA 2JLSA 3B2NA 4R9UC 2CDNA 4HHEA 4FINA 4Z54A 2W6ZA 3TQRA 1QH1A 1OH7A 3PDWA 4N0PA 5JY6A 4QQNA 2WK1A 5DFAA 4CV0A 4Z4FA 1N6NA 5F1KA 2OGUA 2D7DA 2A3NA 4ZTZB 3PEWA 4TZ0A 1XKQA 2VJPA 3L6OO 1UBKS 1V3QE 2BM0A 1M8FA 4URHA 2OA0A 2ZIFA 3KOYE 1BE6A 4Q03A 3O6VA 2FZCA 3QNWA 4PS1A 5ELLA 5JLJA 4KW7A 3ZXXA 3T8YA 2PCJA 3EDYA 5LLDA 3G9QA 1TM5E 4JI1B 1UBOS 1NYQA 2E7ZA 2ZI5A 3DOFA 2X5KO 2OVFA 3V4FA 2KMLA 3VAYA 3VC3A 1ODTC 1PNQA 3DXFA 3W04A 5B1YA 4A8JA 3J7AC 1N5OX 4IBFA 1K08A 4LY6A 3DULA 4NPCA 3FKQA 5LQAA 3THXB 3C9PA 2IRWA 2FSVA 2DHEA 3A70A 3QSGA 4KC0A 1VYTA 4Q1FA 4F3CA 1IVNA 3MHTA 1TUGA 3C3EA 5DI3B 1JJFA 4KQ1A 2FFBA 4YRFA 4R9VA 1VYHA 5IP5A 1Q2UA 2E5WA 3CZAA 1QVRA 4ZRDA 5BR1A 2V6BA 3VDMA 1VBMA 3L92A 1JHOA 4KX3A 5C9ZA 3IAM6 2R8YA 1V26A 2O01F 3B9BA 3GC6A 3PTLA 1UDRA 5DBEX 4MWZA 3ZJYA 4K5QA 1FDTA 3KQMA 5DIZA 1UWVA 2OP1A 3CNNA 5EIBC 1C3LA 1EJ6A 1PN3A 4ALLA 1P3QQ 4RGBA 3CKLA 4K26A 2PX0A 4PAOA 4WCFC 5E4JA 4BGIA 2CHQA 1CDZA 1XO1A 4QXPA 1CWUA 4TLDA 3RHSA 3ZV6A 4PPGA 4EG8A 4EUSA 2X0RA 3HY4A 3SEZA 4X3PA 5DW3A 1HURA 5L7WA 1WJ7A 1EVYA 3I8XA 4NS1A 5ITZA 2ZUUA 4LRTB 1DKRA 3EY4A 3GIWA 3I5MA 3ST7A 4Q4HA 2J7PD 3TD6A 3IGFA 1OLSA 4HLDA 1W0KD 3W2FA 4D8UA 5FOQA 4OQPA 1G291 3SSOA 3TFWA 1MGPA 2IBMA 5DNYA 5ESDA 1G8HA 2IGBA 2YV1A 4I1VA 2ZIWB 4PAWA 3HYNA 4Q47A 4ENQA 4E2ZA 5CEEA 5I51A 3JQAD 1YRLA 1RYBA 1E1RA 1FMJA 1GFSA 3GVXA 4TXJA 2AV6A 4OSOA 3V9AA 4IDEA 5KYYB 3SDBA 3HLTA 2YVKA 3VPGA 1C9YA 4B3TB 1QHIA 3EA4A 4FUTA 1PTJA 4U6NA 3U37A 4NENA 1K3FA 5CDYA 1YTLA 3O4JA 4IFTA 2QD4A 3HKEB 1ESZA 2R1UA 3A4LA 4IQ4A 1XQWA 2PNJA 3W6OA 1PGQA 3ZU4A 4EL0A 4P0PB 4IBKA 1ISGA 1OWLA 3V7UA 1CZNA 3KB6A 4RD1A 4DIOA 1CNMA 3I72A 4JDPA 1G4AE 2H4XA 1M1ZA 1RAHA 3EC2A 4XAQA 2B1IA 4MV6A 2HWKA 2XMPA 1P1BA 1YE9A 3B2QA 3MT9A 1WUKS 3MEQA 3V33A 1ECGA 3KWFA 4QGHA 5EVJA 3EARA 4JJZA 5FPQA 2WAYA 3PD0A 1QK3A 4FMBB 2F1IA 2OAEA 4RJIA 3RFUA 3U6SA 3UATA 1GPUA 1Z4NA 1VG1A 3UMVA 4OSPA 2VP0A 4GQBA 5LXTB 3MF4A 3CKYA 4A0FA 4KDCA 5LOVB 1S3SA 1JLLA 2H18A 3U49A 1CVIA 4OMDA 2JC3A 3JY6A 1V9CA 3OJCA 2N3ZA 4N8EA 5BOVA 4ZEMA 5ITWA 1U9IA 1JIKA 2VYVD 4H3VA 4KK4A 1HDGO 3T3HA 2X0KA 1NL3A 4OVZB 3CWQA 3ELUA 1J5PA 1V6AA 3PPXA 1F6WA 3W8FA 3MAJA 5JS1A 3UMCA 3A6EA 1UDAA 3KQYA 1EUCA 5CX1A 2GPTA 3WL3A 5THKA 1CIVA 4K6HA 4PSUA 1R9NA 4NULA 2P2YA 1E4EB 2W6JA 3RJTA 1M1YE 3H11A 3ZV7A 2VHTA 1KYXA 1AE1A 2XSZA 5LL6P 2XDQB 3VO2A 2W42A 2OYSA 4MO9A 4CM6A 2FGJA 3OC0A 7REQB 2R6R1 3JQAA 2E9SA 3ODPA 3BWDD 3L27A 1EQUA 2NU7B 2P5YA 3NYIA 5LDGA 2IZ0A 1QDUA 3CO5A 3L29A 2UAGA 4IJKA 1TKAA 1FTNA 3IB3A 2FRDC 4CMGA 2JCVA 3U7JA 4C0AC 1YK1A 1N0UA 5JTUA 1E8NA 4YRRA 2W37A 4UEQA 3HM9A 1QFXA 5I7VA 4ZT6A 3SQWA 1MC1A 3IDSA 4AP5A 4RQTA 2GM5A 3BXZA 2ZB4A 3DA8A 3HJCA 3D8RA 4CQMA 4J7XA 4ZPXA 1ONOA 1AU9A 3V8MA 1N1EA 3H4MA 2DWPA 2TECE 2YQ5A 5JSQA 5EQJB 3WGZA 1H4SA 1ULBA 2QRLA 1CDDA 3IVRA 3JWGA 5A9TA 4D4IA 4DMGA 1AH2A 3LO8A 2DAPA 4RD2A 2I55A 1BD3A 1NWHA 4FNMA 4HTFA 1Q0LA 4F1JA 3EG5A 2R7LA 2WNSA 3TNYA 2RHJA 1BDJA 3P0HA 3FSGA 4J1TA 3VTFA 5JRJA 4U2KA 4PFJA 1JR3D 1I1HA 2QD1A 3HKCA 1NDHA 1HI9A 2KHZA 1VDMA 5AM3A 3OQPA 1VJ5A 2X0NA 2JW5A 1E2EA 1E5VA 1MAAA 2VP4A 2V1UA 2W48A 2Q9BA 1HYBA 3D8BA 1ULTA 2W5UA 3BJMA 3IJEB 3N59A 4LN1A 1VP9A 2YS6A 4QGFA 4XD7D 4BBJA 5B64A 4AS2A 2REQA 3OE5A 4DR5M 3U4CA 4XYLA 1Z63A 3STWA 2O19A 1Z12A 4B35A 3DTTA 3SFVA 1S8NA 1W5FA 1FFXA 1WGLA 5HEKA 1S4MA 3AQIA 2K47A 5FBWB 2AUNA 5EHZA 4IJMA 4TVKA 3BFVA 1S8OA 5BPVA 1SCQA 2R4UA 2EKBA 1S2IA 1P2DA 3AL3A 3N0VA 5FJJA 3X43A 1K6MA 3DL7A 8ABPA 3LLMA 4BXOB 3HY6A 4ZJUA 4YJ2B 3OZEA 2P40A 3AT1A 4GKKM 3QKSB 1BWRA 4MWTA 4W5NA 3UFXA 4ZI7B 3SQLA 3I2HA 1C1XA 4YXFA 2NADA 4QATA 3E82A 1I6KA 3BULA 1DG3A 3A2LA 3FNFA 1FBTA 3LWDA 4MX8A 3KQTA 4MW1A 2ZJ6A 1AY0A 2XUQA 4X91A 5BR4A 5AW7A 2PG3A 5KKAA 3U2QA 3BREA 3GNTA 2QNRA 3IAHA 4H16A 5JS2A 3GQ4A 3IDFA 1IVYA 1Y4AE 3WRWA 1MD9A 4JU8A 4XBOA 1GG8A 4MUEA 2A84A 2I91A 3AGPA 1BS2A 2V54A 2XOKA 3QI7A 1AQUA 1VDLA 2KBEA 2LVOC 4ZVOA 4J91A 2AN3A 3VNBA 1ISJA 3TSWA 1GO5A 4A8TA 2FJUA 4KMSA 5CVJA 2WJZB 3H2HA 3PX2A 4KV7A 1ZOPA 2IUSA 1H0HA 1KJQA 3L8FA 4NV0A 2WIGA 1PZXA 5FOUA 3ZZUA 4X71A 3WSVA 3ZE7A 3RS0A 1DIHA 2Y77A 3FYUA 4Y1RA 1WRBA 4M87A 4ZCIA 5CBPB 5IVKA 2IH2A 3QE3A 3WGLA 1HKHA 3N2ZB 4OYLA 1QAOA 1C80A 1ZG3A 4IJWA 4RVCA 4KQ9A 1MV8A 1HE3A 3L9XA 1FMFA 4FSXA 3WJAA 5LZ2A 1T6NA 1W4CA 2K9DA 4LJ7A 1GNQA 2R3SA 3EEFA 5I5EA 1S7GA 1NRJB 3KZNA 3HBNA 3W5JA 2OBLA 4E5NA 4GLBA 3MB8A 4UBLA 2X58A 3LH5A 2VK8A 5L3SB 3K0KA 4BGDA 4ZREA 3WRXC 1KQPA 3W9SA 4CLRA 2ZJ5A 5H81A 2ZP1A 1JIQA 1OF1A 2RGBA 3MD9A 2BHSA 2O7QA 2Z8XA 3IYLW 2QL6A 4U7FA 4Z4QA 3W8NA 4P81A 1Q3CA 1EEXB 3ZE6A 2WVJA 4A10A 2EC5A 4IHKA 2IXTA 2QSUA 4GM4A 4QXAA 3TEMA 1B2RA 1XEFA 3GJ6A 5H9WA 3CM0A 4J6EA 1YS6A 2Z56A 1IPEA 3IEXA 2H1HA 3Q4GA 5CB8A 3BL8A 1KFKB 2YCLA 3VQTA 1FU7A 2PR2A 2XB8A 1V8ZA 1RD4A 4FFBA 3HN6A 4JJEA 2X7HA 3EXG2 3MWDB 1A88A 1UC4B 1Z0JA 2FQWA 4BYGA 2WIFA 1CUCA 4DUPA 2OCIA 2ADOA 4M0KA 2BZSA 4RTLA 2YNMD 1L5MA 1PJ4A 3HB4X 2Z4TA 1TMOA 5EIFA 2H1FA 2FJPA 1H1DA 2PWZA 3BE8A 3IT0A 4WLEA 2R46A 4BNFA 5ABPA 3KQLA 2FG6C 2WFLA 1NRWA 4F1KA 1JXOA 1EVQA 3VPHA 1CC1S 2XNCA 4GEKA 3SYRA 3RABA 2HQRA 3IHKA 5CVUA 2CEAA 1MIOB 1Z45A 3P27A 5HS6A 4IPTA 4AZFA 3RFFA 3CNEA 1M1NB 3QEJA 2I6SA 4X7BA 1JV2B 3WQHA 3KE8A 2PSHA 1VB5A 1ILEA 1YJAA 2VRBA 3L4SO 5IWCA 2OCAA 3ZIDA 1IWOA 3C8UA 4ZDKA 3FOBA 2WWGA 2ZYAA 3N8DA 1LZKA 4AJOA 2QJFA 2WJGA 1U2QA 2J5YA 1KARA 1VL6A 3T7SA 3KJGA 1UPFA 3BXHA 1OLUB 3U44B 3WB0A 3ZBUA 4JZYA 4AAYA 4E1VA 4YT8A 2F3QA 3M2TA 1X8XA 4WEQA 5JFOA 3PC3A 1E2JA 1XWFA 5KC9A 1Z34A 4G0YA 1DBIA 2X5XA 4Q39A 3OPYB 5EYPA 3S99A 1KVSA 3N2GA 3SG0A 4HVTA 1S3FA 4WA7A 3NGLA 5F9HA 1N32B 1CEYA 4RF2A 1I14A 3DD5A 3OM1A 4OK5A 5KQDA 3Q11A 2FHPA 4ZQEA 4PZLA 5H7XA 5AW4A 3JWHA 4HWOA 4OLBA 1UP4A 2C5FA 2TRSB 1CUYA 3RB8A 4O0LA 3RYIA 2E4AA 3GUHA 3INRA 3BE5A 3ED5A 1ITZA 1EBUA 3OQNA 2XCTB 4DQ0A 3N39C 3JD2A 3BAFA 3O38A 4ND3A 3GU3A 4JJKA 4QASA 1JHRA 2DNAA 1KQ3A 4KP7A 1XZIA 3ZV4A 1OIVA 2R8ZA 3D2AA 4RCVA 5I9LA 2RHGB 2W2NA 2AMVA 4IFEA 1M0TA 3HJ8A 5DCYA 2O8DB 5E9AA 4IMJB